A0A3Q0KUZ1_SCHMA Loading...

Smp_205170

AlphaFold DB , UniProt , Accession A0A3Q0KUZ1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 51 aa.

						>A0A3Q0KUZ1_SCHMA|A0A3Q0KUZ1
MKRTKQKSCAMEMAGKPTRYEQALINIYSQTKMNDRHAMNKMRNVHTHALI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.5	Low	65.6	Low	225 Å²	225	138.9 Å²	138.9	100%	1.108	69%	0.687	S	S	*	*				0	-6	0	-81.6	178.1	145.9	0	0	116.4	R3 T4	M1-R3 PolarHBondContact O-N 3.5Å; M1-T4 PolarHBondContact O-OG1 3.33Å
2	K	65.2	Low	65.7	Low	195 Å²	195	136.1 Å²	136.1	85%	0.848	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.8	-20	-176	-65.5	-174.7	179.5	178.7	0	116.3	T4	K2-T4 VanDerWaalsContact C-N 3.33Å; K2-T4 PolarHBondContact O-N 3.28Å
3	R	65.2	Low	66.3	Low	209 Å²	209	135.1 Å²	135.1	79%	0.789	67%	0.665	S	S	*	*	H	α-helix	trans	-64.7	-30.2	-177.1	-100.8	-177.4	-179.9	-177.6	0.4	114.1	M1 K7	M1-R3 PolarHBondContact O-N 3.5Å; R3-K7 PolarHBondContact O-N 3.04Å; R3-K7 VanDerWaalsContact O-N 3.16Å
4	T	69.5	Low	66.9	Low	104 Å²	104	131.9 Å²	131.9	64%	0.638	67%	0.671	S	S	*	*	H	α-helix	trans	-69.3	-39.1	-175.4	-6.7	0	0	0	0	112.1	M1 K2 K7 S8	M1-T4 PolarHBondContact O-OG1 3.33Å; K2-T4 VanDerWaalsContact C-N 3.33Å; K2-T4 PolarHBondContact O-N 3.28Å; T4-K7 PolarHBondContact O-N 3.27Å; T4-S8 PolarHBondContact O-N 2.93Å; T4-S8 VanDerWaalsContact O-N 3.11Å
5	K	66.8	Low	67.7	Low	168 Å²	168	127.9 Å²	127.9	73%	0.73	68%	0.676	S	S	*	*	H	α-helix	trans	-66.7	-41.1	177.9	-170.2	167.2	-178.4	172.8	0	112.2	K7 S8 C9	K5-K7 VanDerWaalsContact C-N 3.34Å; K5-K7 PolarHBondContact O-N 3.08Å; K5-S8 WeakPolarHBondContact O-CB 3.35Å; K5-S8 PolarHBondContact O-N 3.4Å; K5-C9 PolarHBondContact O-N 3.33Å; K5-C9 VanDerWaalsContact O-N 3.16Å; K5-C9 PolarHBondContact O-SG 2.87Å; K5-C9 VanDerWaalsContact O-SG 3.41Å
6	Q	64.4	Low	68.6	Low	152 Å²	152	126.7 Å²	126.7	71%	0.71	66%	0.663	S	S	*	*	H	α-helix	trans	-65.9	-36.7	177.5	-163.2	168.5	27.2	0	0	112.2	C9 A10	Q6-C9 PolarHBondContact O-N 3.32Å; Q6-A10 PolarHBondContact O-N 3.19Å
7	K	65.7	Low	69.5	Low	139 Å²	139	122.8 Å²	122.8	60%	0.604	65%	0.647	S	S	*	*	H	α-helix	trans	-62.6	-39.7	171.4	-77.9	-173.6	173.5	-169.1	0	112.7	R3 T4 K5 A10 M11	R3-K7 PolarHBondContact O-N 3.04Å; R3-K7 VanDerWaalsContact O-N 3.16Å; T4-K7 PolarHBondContact O-N 3.27Å; K5-K7 VanDerWaalsContact C-N 3.34Å; K5-K7 PolarHBondContact O-N 3.08Å; K7-A10 PolarHBondContact O-N 3.29Å; K7-M11 WeakPolarHBondContact O-CG 3.38Å; K7-M11 PolarHBondContact O-N 3.11Å; K7-M11 VanDerWaalsContact O-N 3.1Å
8	S	66.5	Low	70.5	Confident	61 Å²	61	119.6 Å²	119.6	43%	0.427	63%	0.633	S	S	.	*	H	α-helix	trans	-62.3	-43.8	176.8	-165.8	0	0	0	0	112	T4 K5 A10 M11 E12	T4-S8 PolarHBondContact O-N 2.93Å; T4-S8 VanDerWaalsContact O-N 3.11Å; K5-S8 WeakPolarHBondContact O-CB 3.35Å; K5-S8 PolarHBondContact O-N 3.4Å; S8-A10 VanDerWaalsContact C-N 3.28Å; S8-A10 PolarHBondContact O-N 3.49Å; S8-M11 PolarHBondContact O-N 2.85Å; S8-E12 PolarHBondContact O-N 3.22Å
9	C	66.6	Low	71.5	Confident	67 Å²	67	125.3 Å²	125.3	45%	0.453	65%	0.645	S	S	.	*	H	α-helix	trans	-62.9	-34.7	177.4	-62	0	0	0	0	112.5	K5 Q6 E12 M13	K5-C9 PolarHBondContact O-N 3.33Å; K5-C9 VanDerWaalsContact O-N 3.16Å; K5-C9 PolarHBondContact O-SG 2.87Å; K5-C9 VanDerWaalsContact O-SG 3.41Å; Q6-C9 PolarHBondContact O-N 3.32Å; C9-E12 PolarHBondContact O-N 3.42Å; C9-M13 PolarHBondContact O-N 2.9Å
10	A	66	Low	72.4	Confident	66 Å²	66	128.7 Å²	128.7	55%	0.545	65%	0.651	S	S	.	*	H	α-helix	trans	-68.1	-39.1	175	0	0	0	0	0	112.3	Q6 K7 S8 M13 A14	Q6-A10 PolarHBondContact O-N 3.19Å; K7-A10 PolarHBondContact O-N 3.29Å; S8-A10 VanDerWaalsContact C-N 3.28Å; S8-A10 PolarHBondContact O-N 3.49Å; A10-M13 PolarHBondContact O-N 3.4Å; A10-A14 PolarHBondContact O-N 3.22Å
11	M	66.7	Low	73.3	Confident	142 Å²	142	127.2 Å²	127.2	70%	0.7	64%	0.641	S	S	*	*	H	α-helix	trans	-66	-36.5	174.7	-67.9	176.3	-169.4	0	0	112.1	K7 S8 M13 A14	K7-M11 WeakPolarHBondContact O-CG 3.38Å; K7-M11 PolarHBondContact O-N 3.11Å; K7-M11 VanDerWaalsContact O-N 3.1Å; S8-M11 PolarHBondContact O-N 2.85Å; M11-M13 VanDerWaalsContact C-N 3.3Å; M11-M13 PolarHBondContact O-N 2.94Å; M11-A14 WeakPolarHBondContact O-CB 3.28Å; M11-A14 PolarHBondContact O-N 3.49Å; M11-A14 VanDerWaalsContact O-N 3.17Å
12	E	67.2	Low	74.9	Confident	105 Å²	105	120.3 Å²	120.3	49%	0.491	61%	0.607	S	S	.	*	H	α-helix	trans	-63.5	-33.9	176.2	-79	-173.7	-148.6	0	0	113.6	S8 C9 A14 K16	S8-E12 PolarHBondContact O-N 3.22Å; C9-E12 PolarHBondContact O-N 3.42Å; E12-A14 VanDerWaalsContact C-N 3.31Å; E12-K16 WeakPolarHBondContact O-CD 3.34Å; E12-K16 WeakPolarHBondContact O-CG 3.46Å; E12-K16 IonicContact OE2-NZ 2.99Å; E12-K16 PolarHBondContact OE2-NZ 2.87Å
13	M	73.1	Confident	76.4	Confident	123 Å²	123	113.2 Å²	113.2	61%	0.606	58%	0.584	S	S	*	*	H	α-helix	trans	-75.4	-19.4	176.4	-73.3	-60.3	-59.8	0	0	112.8	C9 A10 M11 G15	C9-M13 PolarHBondContact O-N 2.9Å; A10-M13 PolarHBondContact O-N 3.4Å; M11-M13 VanDerWaalsContact C-N 3.3Å; M11-M13 PolarHBondContact O-N 2.94Å; M13-G15 PolarHBondContact O-N 2.86Å
14	A	75.3	Confident	77.8	Confident	91 Å²	91	108.9 Å²	108.9	75%	0.752	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.5	-18.2	-176.3	0	0	0	0	0	113.8	A10 M11 E12	A10-A14 PolarHBondContact O-N 3.22Å; M11-A14 WeakPolarHBondContact O-CB 3.28Å; M11-A14 PolarHBondContact O-N 3.49Å; M11-A14 VanDerWaalsContact O-N 3.17Å; E12-A14 VanDerWaalsContact C-N 3.31Å
15	G	78.6	Confident	78.9	Confident	71 Å²	71	108 Å²	108	73%	0.732	57%	0.567	S	S	*	*	S	Bend	trans	-121.6	-4.9	179.5	0	0	0	0	0	115.6	M13	M13-G15 PolarHBondContact O-N 2.86Å
16	K	82.6	Confident	80.1	Confident	109 Å²	109	103.6 Å²	103.6	47%	0.474	55%	0.551	S	S	.	*	S	Bend	trans	-87.2	127.3	178.4	-70.2	173.6	-170.8	173.2	0	108.5	E12 T18	E12-K16 WeakPolarHBondContact O-CD 3.34Å; E12-K16 WeakPolarHBondContact O-CG 3.46Å; E12-K16 IonicContact OE2-NZ 2.99Å; E12-K16 PolarHBondContact OE2-NZ 2.87Å; K16-T18 PolarHBondContact O-N 3.36Å
17	P	84	Confident	81.5	Confident	60 Å²	60	101.1 Å²	101.1	39%	0.39	54%	0.542	S	S	.	.	P	Polyproline II helix	trans	-57.2	139.3	173.4	23.9	-31.7	0	0	0	109.2	E21	P17-E21 WeakPolarHBondContact CA-OE2 3.37Å; P17-E21 HydrophobicContact CB-CB 3.7Å
18	T	87.7	Confident	82.6	Confident	65 Å²	65	102 Å²	102	40%	0.399	54%	0.542	S	S	.	.	P	Polyproline II helix	trans	-56.1	160	167.8	61.5	0	0	0	0	109.8	K16 Y20 E21 Q22	K16-T18 PolarHBondContact O-N 3.36Å; T18-Y20 PolarHBondContact O-N 3.47Å; T18-Y20 VanDerWaalsContact O-N 3.1Å; T18-E21 WeakPolarHBondContact CG2-OE2 3.41Å; T18-E21 PolarHBondContact N-OE2 3.25Å; T18-E21 PolarHBondContact O-N 3.5Å; T18-E21 VanDerWaalsContact O-N 3.12Å; T18-E21 VanDerWaalsContact OG1-CG 3.32Å; T18-E21 WeakPolarHBondContact OG1-CG 3.49Å; T18-E21 PolarHBondContact OG1-N 3.22Å; T18-E21 VanDerWaalsContact OG1-N 3.1Å; T18-E21 PolarHBondContact OG1-OE2 2.95Å; T18-Q22 PolarHBondContact O-N 3.38Å
19	R	89.4	Confident	83.7	Confident	228 Å²	228	101.8 Å²	101.8	86%	0.86	54%	0.541	S	S	*	.	H	α-helix	trans	-53.9	-32.3	173.2	-68.6	-178.6	64.8	-163.8	-0.9	112.2	A23	R19-A23 WeakPolarHBondContact O-CB 3.44Å; R19-A23 PolarHBondContact O-N 3.27Å; R19-A23 VanDerWaalsContact O-N 3.09Å
20	Y	88.3	Confident	84.8	Confident	194 Å²	194	104.3 Å²	104.3	76%	0.761	55%	0.546	S	S	*	.	H	α-helix	trans	-71.4	-47.5	176.8	-65.4	-68.7	0	0	0	112.3	T18 Q22 A23 L24	T18-Y20 PolarHBondContact O-N 3.47Å; T18-Y20 VanDerWaalsContact O-N 3.1Å; Y20-Q22 VanDerWaalsContact C-N 3.32Å; Y20-Q22 PolarHBondContact O-N 2.89Å; Y20-A23 WeakPolarHBondContact O-CB 3.48Å; Y20-A23 PolarHBondContact O-N 3.12Å; Y20-L24 WeakPolarHBondContact O-CG 3.43Å; Y20-L24 PolarHBondContact O-N 2.95Å
21	E	91.1	Very high	86	Confident	97 Å²	97	104.6 Å²	104.6	45%	0.453	54%	0.541	S	S	.	.	H	α-helix	trans	-60.6	-42.1	175.6	-73.5	165.7	136.4	0	0	111.7	P17 T18 A23 L24 I25	P17-E21 WeakPolarHBondContact CA-OE2 3.37Å; P17-E21 HydrophobicContact CB-CB 3.7Å; T18-E21 WeakPolarHBondContact CG2-OE2 3.41Å; T18-E21 PolarHBondContact N-OE2 3.25Å; T18-E21 PolarHBondContact O-N 3.5Å; T18-E21 VanDerWaalsContact O-N 3.12Å; T18-E21 VanDerWaalsContact OG1-CG 3.32Å; T18-E21 WeakPolarHBondContact OG1-CG 3.49Å; T18-E21 PolarHBondContact OG1-N 3.22Å; T18-E21 VanDerWaalsContact OG1-N 3.1Å; T18-E21 PolarHBondContact OG1-OE2 2.95Å; E21-A23 VanDerWaalsContact C-N 3.33Å; E21-A23 PolarHBondContact O-N 3.42Å; E21-L24 PolarHBondContact O-N 3.49Å; E21-I25 VanDerWaalsContact O-CG1 3.31Å; E21-I25 WeakPolarHBondContact O-CG1 3.41Å; E21-I25 PolarHBondContact O-N 2.92Å
22	Q	94	Very high	87.1	Confident	81 Å²	81	104 Å²	104	38%	0.379	54%	0.535	S	S	.	.	H	α-helix	trans	-63.4	-38.9	175.7	-171.2	61.7	63.4	0	0	112.1	T18 Y20 I25 N26	T18-Q22 PolarHBondContact O-N 3.38Å; Y20-Q22 VanDerWaalsContact C-N 3.32Å; Y20-Q22 PolarHBondContact O-N 2.89Å; Q22-I25 PolarHBondContact O-N 2.86Å; Q22-N26 PolarHBondContact NE2-OD1 3.34Å; Q22-N26 WeakPolarHBondContact O-CB 3.38Å; Q22-N26 PolarHBondContact O-N 2.84Å; Q22-N26 PolarHBondContact O-OD1 3.11Å
23	A	95.1	Very high	88.1	Confident	46 Å²	46	104.5 Å²	104.5	38%	0.38	54%	0.538	S	S	.	.	H	α-helix	trans	-63.3	-41.9	175.2	0	0	0	0	0	111.7	R19 Y20 E21 N26 I27	R19-A23 WeakPolarHBondContact O-CB 3.44Å; R19-A23 PolarHBondContact O-N 3.27Å; R19-A23 VanDerWaalsContact O-N 3.09Å; Y20-A23 WeakPolarHBondContact O-CB 3.48Å; Y20-A23 PolarHBondContact O-N 3.12Å; E21-A23 VanDerWaalsContact C-N 3.33Å; E21-A23 PolarHBondContact O-N 3.42Å; A23-N26 PolarHBondContact O-N 3.08Å; A23-I27 VanDerWaalsContact O-CG1 3.31Å; A23-I27 WeakPolarHBondContact O-CG1 3.36Å; A23-I27 PolarHBondContact O-N 3.42Å
24	L	94.6	Very high	88.7	Confident	118 Å²	118	103.9 Å²	103.9	62%	0.618	54%	0.537	S	S	*	.	H	α-helix	trans	-63.7	-45	176	-68.7	174.9	0	0	0	112.1	Y20 E21 N26 I27 Y28	Y20-L24 WeakPolarHBondContact O-CG 3.43Å; Y20-L24 PolarHBondContact O-N 2.95Å; E21-L24 PolarHBondContact O-N 3.49Å; L24-N26 VanDerWaalsContact C-N 3.26Å; L24-N26 PolarHBondContact O-N 2.92Å; L24-I27 PolarHBondContact O-N 3.05Å; L24-Y28 WeakPolarHBondContact O-CB 3.48Å; L24-Y28 PolarHBondContact O-N 3.49Å
25	I	92.7	Very high	89.1	Confident	85 Å²	85	104 Å²	104	44%	0.436	53%	0.525	S	S	.	.	H	α-helix	trans	-58.9	-41.2	175.4	-68.8	165.2	0	0	0	110.5	E21 Q22 S29	E21-I25 VanDerWaalsContact O-CG1 3.31Å; E21-I25 WeakPolarHBondContact O-CG1 3.41Å; E21-I25 PolarHBondContact O-N 2.92Å; Q22-I25 PolarHBondContact O-N 2.86Å; I25-S29 VanDerWaalsContact O-CB 3.3Å; I25-S29 WeakPolarHBondContact O-CB 3.45Å; I25-S29 PolarHBondContact O-N 3.31Å; I25-S29 PolarHBondContact O-OG 2.88Å
26	N	92.7	Very high	89.7	Confident	76 Å²	76	107.8 Å²	107.8	41%	0.406	52%	0.518	S	S	.	.	H	α-helix	trans	-67.2	-41.9	178.2	-72.4	2.5	0	0	0	112.1	Q22 A23 L24 Q30	Q22-N26 PolarHBondContact NE2-OD1 3.34Å; Q22-N26 WeakPolarHBondContact O-CB 3.38Å; Q22-N26 PolarHBondContact O-N 2.84Å; Q22-N26 PolarHBondContact O-OD1 3.11Å; A23-N26 PolarHBondContact O-N 3.08Å; L24-N26 VanDerWaalsContact C-N 3.26Å; L24-N26 PolarHBondContact O-N 2.92Å; N26-Q30 WeakPolarHBondContact O-CB 3.3Å; N26-Q30 VanDerWaalsContact O-CG 3.24Å; N26-Q30 WeakPolarHBondContact O-CG 3.45Å; N26-Q30 PolarHBondContact O-N 3.02Å; N26-Q30 PolarHBondContact O-NE2 3Å
27	I	93	Very high	90	Very high	99 Å²	99	108.8 Å²	108.8	51%	0.508	52%	0.524	S	S	.	.	H	α-helix	trans	-62.9	-50.2	176.1	-69.6	164.2	0	0	0	109.9	A23 L24 S29 Q30 T31	A23-I27 VanDerWaalsContact O-CG1 3.31Å; A23-I27 WeakPolarHBondContact O-CG1 3.36Å; A23-I27 PolarHBondContact O-N 3.42Å; L24-I27 PolarHBondContact O-N 3.05Å; I27-S29 VanDerWaalsContact C-N 3.33Å; I27-S29 PolarHBondContact O-N 3.19Å; I27-Q30 PolarHBondContact O-N 3.39Å; I27-T31 PolarHBondContact O-N 3Å; I27-T31 PolarHBondContact O-OG1 2.94Å; I27-T31 VanDerWaalsContact O-OG1 3.11Å
28	Y	90.3	Very high	90	Very high	157 Å²	157	108.2 Å²	108.2	62%	0.616	52%	0.524	S	S	*	.	H	α-helix	trans	-57.8	-45.5	179.3	178.4	-99.7	0	0	0	112	L24 Q30 T31 K32	L24-Y28 WeakPolarHBondContact O-CB 3.48Å; L24-Y28 PolarHBondContact O-N 3.49Å; Y28-Q30 PolarHBondContact O-N 3.25Å; Y28-T31 PolarHBondContact O-N 3.5Å; Y28-K32 HydrophobicContact CE1-CD 4.45Å; Y28-K32 WeakPolarHBondContact O-CB 3.24Å; Y28-K32 PolarHBondContact O-N 3.37Å
29	S	88.3	Confident	90	Very high	57 Å²	57	109.8 Å²	109.8	40%	0.399	53%	0.528	S	S	.	.	H	α-helix	trans	-64.6	-40.2	178.8	-59.1	0	0	0	0	112.2	I25 I27 K32 M33	I25-S29 VanDerWaalsContact O-CB 3.3Å; I25-S29 WeakPolarHBondContact O-CB 3.45Å; I25-S29 PolarHBondContact O-N 3.31Å; I25-S29 PolarHBondContact O-OG 2.88Å; I27-S29 VanDerWaalsContact C-N 3.33Å; I27-S29 PolarHBondContact O-N 3.19Å; S29-K32 PolarHBondContact O-N 3.43Å; S29-M33 VanDerWaalsContact O-CG 3.3Å; S29-M33 WeakPolarHBondContact O-CG 3.39Å; S29-M33 PolarHBondContact O-N 3.04Å
30	Q	90.6	Very high	90	Very high	121 Å²	121	102.8 Å²	102.8	57%	0.565	51%	0.508	S	S	*	.	H	α-helix	trans	-65.9	-45.2	176.6	-76.4	174.2	94.3	0	0	112.3	N26 I27 Y28 K32 M33 N34	N26-Q30 WeakPolarHBondContact O-CB 3.3Å; N26-Q30 VanDerWaalsContact O-CG 3.24Å; N26-Q30 WeakPolarHBondContact O-CG 3.45Å; N26-Q30 PolarHBondContact O-N 3.02Å; N26-Q30 PolarHBondContact O-NE2 3Å; I27-Q30 PolarHBondContact O-N 3.39Å; Y28-Q30 PolarHBondContact O-N 3.25Å; Q30-K32 VanDerWaalsContact C-N 3.33Å; Q30-K32 PolarHBondContact O-N 3.11Å; Q30-M33 PolarHBondContact O-N 2.94Å; Q30-N34 PolarHBondContact O-N 2.78Å; Q30-N34 PolarHBondContact O-ND2 3.17Å
31	T	91.7	Very high	90	Very high	72 Å²	72	100.1 Å²	100.1	44%	0.442	50%	0.5	S	S	.	.	H	α-helix	trans	-58.5	-46.7	176.1	-56.1	0	0	0	0	110.8	I27 Y28 M33 N34 D35	I27-T31 PolarHBondContact O-N 3Å; I27-T31 PolarHBondContact O-OG1 2.94Å; I27-T31 VanDerWaalsContact O-OG1 3.11Å; Y28-T31 PolarHBondContact O-N 3.5Å; T31-M33 VanDerWaalsContact C-N 3.3Å; T31-M33 PolarHBondContact O-N 3.44Å; T31-N34 WeakPolarHBondContact O-CB 3.3Å; T31-N34 PolarHBondContact O-N 3.09Å; T31-N34 VanDerWaalsContact O-N 3.11Å; T31-D35 VanDerWaalsContact O-CG 3.27Å; T31-D35 PolarHBondContact O-N 3.21Å
32	K	89.8	Confident	89.7	Confident	130 Å²	130	101.6 Å²	101.6	57%	0.565	51%	0.509	S	S	*	.	H	α-helix	trans	-60.9	-37.2	177.8	-170.4	176.2	-177	175.9	0	113	Y28 S29 Q30 R36	Y28-K32 HydrophobicContact CE1-CD 4.45Å; Y28-K32 WeakPolarHBondContact O-CB 3.24Å; Y28-K32 PolarHBondContact O-N 3.37Å; S29-K32 PolarHBondContact O-N 3.43Å; Q30-K32 VanDerWaalsContact C-N 3.33Å; Q30-K32 PolarHBondContact O-N 3.11Å; K32-R36 PolarHBondContact O-N 3.45Å; K32-R36 VanDerWaalsContact O-N 3.08Å
33	M	86.8	Confident	89.4	Confident	115 Å²	115	105.9 Å²	105.9	57%	0.567	52%	0.521	S	S	*	.	H	α-helix	trans	-69.6	-38.7	175.2	-72.1	-60.4	-66.4	0	0	112.2	S29 Q30 T31 R36 H37	S29-M33 VanDerWaalsContact O-CG 3.3Å; S29-M33 WeakPolarHBondContact O-CG 3.39Å; S29-M33 PolarHBondContact O-N 3.04Å; Q30-M33 PolarHBondContact O-N 2.94Å; T31-M33 VanDerWaalsContact C-N 3.3Å; T31-M33 PolarHBondContact O-N 3.44Å; M33-R36 PolarHBondContact O-N 2.91Å; M33-H37 PolarHBondContact O-N 2.98Å
34	N	85.7	Confident	89.1	Confident	109 Å²	109	108 Å²	108	58%	0.583	53%	0.526	S	S	*	.	H	α-helix	trans	-64	-43	174.2	-72.6	-27.5	0	0	0	111.6	Q30 T31 R36 H37 A38	Q30-N34 PolarHBondContact O-N 2.78Å; Q30-N34 PolarHBondContact O-ND2 3.17Å; T31-N34 WeakPolarHBondContact O-CB 3.3Å; T31-N34 PolarHBondContact O-N 3.09Å; T31-N34 VanDerWaalsContact O-N 3.11Å; N34-R36 VanDerWaalsContact C-N 3.31Å; N34-R36 PolarHBondContact O-N 3.44Å; N34-H37 WeakPolarHBondContact O-CB 3.43Å; N34-H37 PolarHBondContact O-N 2.93Å; N34-H37 VanDerWaalsContact O-N 3.12Å; N34-A38 PolarHBondContact O-N 3.29Å
35	D	85.4	Confident	88.6	Confident	94 Å²	94	106.7 Å²	106.7	50%	0.503	52%	0.523	S	S	.	.	H	α-helix	trans	-60.7	-42.9	175.4	-65.2	-23.9	0	0	0	110.9	T31 H37 A38 M39	T31-D35 VanDerWaalsContact O-CG 3.27Å; T31-D35 PolarHBondContact O-N 3.21Å; D35-H37 VanDerWaalsContact C-N 3.31Å; D35-H37 PolarHBondContact O-N 3.25Å; D35-A38 PolarHBondContact O-N 3.37Å; D35-M39 WeakPolarHBondContact O-CB 3.42Å; D35-M39 WeakPolarHBondContact O-CG 3.31Å; D35-M39 PolarHBondContact O-N 2.99Å
36	R	89.4	Confident	88.2	Confident	151 Å²	151	108.2 Å²	108.2	57%	0.57	53%	0.528	S	S	*	.	H	α-helix	trans	-61.4	-40.4	175	-167.6	178.3	-173.7	175.1	1.7	111.8	K32 M33 N34 N40	K32-R36 PolarHBondContact O-N 3.45Å; K32-R36 VanDerWaalsContact O-N 3.08Å; M33-R36 PolarHBondContact O-N 2.91Å; N34-R36 VanDerWaalsContact C-N 3.31Å; N34-R36 PolarHBondContact O-N 3.44Å; R36-N40 WeakPolarHBondContact O-CB 3.44Å; R36-N40 VanDerWaalsContact O-CG 3.29Å; R36-N40 PolarHBondContact O-N 2.94Å
37	H	89.1	Confident	87.9	Confident	129 Å²	129	108.3 Å²	108.3	60%	0.597	53%	0.531	S	S	*	.	H	α-helix	trans	-65.5	-44.1	175.6	-175.3	75.8	0	0	0	111.7	M33 N34 D35 N40 K41	M33-H37 PolarHBondContact O-N 2.98Å; N34-H37 WeakPolarHBondContact O-CB 3.43Å; N34-H37 PolarHBondContact O-N 2.93Å; N34-H37 VanDerWaalsContact O-N 3.12Å; D35-H37 VanDerWaalsContact C-N 3.31Å; D35-H37 PolarHBondContact O-N 3.25Å; H37-N40 PolarHBondContact O-N 3.43Å; H37-K41 WeakPolarHBondContact O-CB 3.37Å; H37-K41 PolarHBondContact O-N 3.1Å
38	A	85	Confident	87.4	Confident	48 Å²	48	109.2 Å²	109.2	40%	0.397	53%	0.533	S	S	.	.	H	α-helix	trans	-61.3	-45.1	176.1	0	0	0	0	0	111.7	N34 D35 N40 K41 M42	N34-A38 PolarHBondContact O-N 3.29Å; D35-A38 PolarHBondContact O-N 3.37Å; A38-N40 PolarHBondContact O-N 2.94Å; A38-K41 PolarHBondContact O-N 3.12Å; A38-M42 WeakPolarHBondContact O-CG 3.42Å; A38-M42 PolarHBondContact O-N 2.96Å
39	M	86.9	Confident	87.1	Confident	98 Å²	98	105.5 Å²	105.5	48%	0.483	54%	0.535	S	S	.	.	H	α-helix	trans	-60.5	-43.4	174.2	-73.2	-168.4	-65.5	0	0	112.2	D35 K41 M42 R43	D35-M39 WeakPolarHBondContact O-CB 3.42Å; D35-M39 WeakPolarHBondContact O-CG 3.31Å; D35-M39 PolarHBondContact O-N 2.99Å; M39-K41 VanDerWaalsContact C-N 3.33Å; M39-K41 PolarHBondContact O-N 3.1Å; M39-M42 HydrophobicContact CG-CE 4.17Å; M39-M42 PolarHBondContact O-N 3.18Å; M39-R43 WeakPolarHBondContact O-CG 3.31Å; M39-R43 PolarHBondContact O-N 3.39Å
40	N	89.8	Confident	86.6	Confident	81 Å²	81	108.9 Å²	108.9	43%	0.433	55%	0.548	S	S	.	.	H	α-helix	trans	-64.3	-38.6	176.2	-77.2	-8.6	0	0	0	111.8	R36 H37 A38 R43 N44	R36-N40 WeakPolarHBondContact O-CB 3.44Å; R36-N40 VanDerWaalsContact O-CG 3.29Å; R36-N40 PolarHBondContact O-N 2.94Å; H37-N40 PolarHBondContact O-N 3.43Å; A38-N40 PolarHBondContact O-N 2.94Å; N40-R43 PolarHBondContact O-N 3.24Å; N40-N44 WeakPolarHBondContact O-CB 3.46Å; N40-N44 PolarHBondContact O-N 2.98Å
41	K	88.2	Confident	85.6	Confident	139 Å²	139	111.9 Å²	111.9	60%	0.604	57%	0.566	S	S	*	*	H	α-helix	trans	-65.5	-43.5	175.6	-174.1	172.9	179.7	177.8	0	111.7	H37 A38 M39 R43 N44 V45	H37-K41 WeakPolarHBondContact O-CB 3.37Å; H37-K41 PolarHBondContact O-N 3.1Å; A38-K41 PolarHBondContact O-N 3.12Å; M39-K41 VanDerWaalsContact C-N 3.33Å; M39-K41 PolarHBondContact O-N 3.1Å; K41-R43 VanDerWaalsContact C-N 3.33Å; K41-R43 PolarHBondContact O-N 3.4Å; K41-N44 PolarHBondContact O-N 3.39Å; K41-V45 WeakPolarHBondContact O-CG2 3.32Å; K41-V45 PolarHBondContact O-N 3.36Å
42	M	84.5	Confident	85.3	Confident	128 Å²	128	113.9 Å²	113.9	63%	0.631	57%	0.572	S	S	*	*	H	α-helix	trans	-60.8	-42.7	174	-71.8	-171.3	-65.6	0	0	111.4	A38 M39 N44 V45 H46	A38-M42 WeakPolarHBondContact O-CG 3.42Å; A38-M42 PolarHBondContact O-N 2.96Å; M39-M42 HydrophobicContact CG-CE 4.17Å; M39-M42 PolarHBondContact O-N 3.18Å; M42-N44 PolarHBondContact O-N 2.74Å; M42-V45 PolarHBondContact O-N 3.17Å; M42-H46 WeakPolarHBondContact O-CB 3.43Å; M42-H46 PolarHBondContact O-N 3.41Å
43	R	87.6	Confident	85.1	Confident	171 Å²	171	113 Å²	113	65%	0.645	57%	0.572	S	S	*	*	H	α-helix	trans	-60.5	-43.8	173.4	-76.1	177.5	174.5	-178.7	-3.2	112.1	M39 N40 K41 H46 T47	M39-R43 WeakPolarHBondContact O-CG 3.31Å; M39-R43 PolarHBondContact O-N 3.39Å; N40-R43 PolarHBondContact O-N 3.24Å; K41-R43 VanDerWaalsContact C-N 3.33Å; K41-R43 PolarHBondContact O-N 3.4Å; R43-H46 PolarHBondContact O-N 3.36Å; R43-T47 PolarHBondContact O-N 3.41Å; R43-T47 PolarHBondContact O-OG1 3.47Å; R43-T47 VanDerWaalsContact O-OG1 3.11Å
44	N	88.3	Confident	85	Confident	89 Å²	89	112.9 Å²	112.9	48%	0.476	57%	0.572	S	S	.	*	H	α-helix	trans	-62.3	-46.2	178.3	-165.4	57.1	0	0	0	111.7	N40 K41 M42 H46 T47 H48	N40-N44 WeakPolarHBondContact O-CB 3.46Å; N40-N44 PolarHBondContact O-N 2.98Å; K41-N44 PolarHBondContact O-N 3.39Å; M42-N44 PolarHBondContact O-N 2.74Å; N44-H46 VanDerWaalsContact C-N 3.3Å; N44-H46 PolarHBondContact O-N 3.02Å; N44-T47 PolarHBondContact O-N 3.19Å; N44-H48 PolarHBondContact ND2-CD2 3.11Å; N44-H48 VanDerWaalsContact ND2-CD2 3.27Å; N44-H48 PolarHBondContact ND2-NE2 3.39Å; N44-H48 VanDerWaalsContact ND2-NE2 3.19Å; N44-H48 PolarHBondContact O-CD2 3.35Å; N44-H48 PolarHBondContact O-N 3.48Å; N44-H48 PolarHBondContact OD1-NE2 3.1Å
45	V	84.2	Confident	84.9	Confident	91 Å²	91	113.1 Å²	113.1	55%	0.552	57%	0.572	S	S	*	*	H	α-helix	trans	-59.3	-43	174.3	172	0	0	0	0	110.9	K41 M42 H48 A49	K41-V45 WeakPolarHBondContact O-CG2 3.32Å; K41-V45 PolarHBondContact O-N 3.36Å; M42-V45 PolarHBondContact O-N 3.17Å; V45-H48 PolarHBondContact O-N 3.27Å; V45-A49 WeakPolarHBondContact O-CB 3.38Å; V45-A49 PolarHBondContact O-N 3.16Å
46	H	85.5	Confident	84.9	Confident	118 Å²	118	114.3 Å²	114.3	55%	0.546	58%	0.576	S	S	.	*	H	α-helix	trans	-63.9	-44.1	178.6	-172.2	59.9	0	0	0	112.2	M42 R43 N44 H48 A49 L50	M42-H46 WeakPolarHBondContact O-CB 3.43Å; M42-H46 PolarHBondContact O-N 3.41Å; R43-H46 PolarHBondContact O-N 3.36Å; N44-H46 VanDerWaalsContact C-N 3.3Å; N44-H46 PolarHBondContact O-N 3.02Å; H46-H48 PolarHBondContact O-N 3.36Å; H46-A49 PolarHBondContact O-N 3.24Å; H46-L50 WeakPolarHBondContact NE2-CD1 3.38Å; H46-L50 WeakPolarHBondContact O-CB 3.46Å; H46-L50 VanDerWaalsContact O-CG 3.28Å; H46-L50 WeakPolarHBondContact O-CG 3.49Å; H46-L50 PolarHBondContact O-N 3.29Å; H46-L50 VanDerWaalsContact O-N 3.08Å
47	T	86.5	Confident	84.6	Confident	77 Å²	77	111.9 Å²	111.9	47%	0.472	58%	0.577	S	S	.	*	H	α-helix	trans	-62.3	-42.3	174.9	-59	0	0	0	0	111.6	R43 N44 A49 L50 I51	R43-T47 PolarHBondContact O-N 3.41Å; R43-T47 PolarHBondContact O-OG1 3.47Å; R43-T47 VanDerWaalsContact O-OG1 3.11Å; N44-T47 PolarHBondContact O-N 3.19Å; T47-A49 VanDerWaalsContact C-N 3.35Å; T47-A49 PolarHBondContact O-N 3.16Å; T47-L50 PolarHBondContact O-N 3.45Å; T47-I51 HydrophobicContact CG2-CD1 4.16Å; T47-I51 WeakPolarHBondContact O-CG1 3.44Å; T47-I51 PolarHBondContact O-N 3.2Å
48	H	82.5	Confident	84.3	Confident	119 Å²	119	110.6 Å²	110.6	55%	0.551	58%	0.575	S	S	*	*	H	α-helix	trans	-68.7	-30	176.4	-75.1	-63.2	0	0	0	113.8	N44 V45 H46 L50	N44-H48 PolarHBondContact ND2-CD2 3.11Å; N44-H48 VanDerWaalsContact ND2-CD2 3.27Å; N44-H48 PolarHBondContact ND2-NE2 3.39Å; N44-H48 VanDerWaalsContact ND2-NE2 3.19Å; N44-H48 PolarHBondContact O-CD2 3.35Å; N44-H48 PolarHBondContact O-N 3.48Å; N44-H48 PolarHBondContact OD1-NE2 3.1Å; V45-H48 PolarHBondContact O-N 3.27Å; H46-H48 PolarHBondContact O-N 3.36Å; H48-L50 VanDerWaalsContact C-N 3.33Å
49	A	82.7	Confident	84.2	Confident	79 Å²	79	115.5 Å²	115.5	65%	0.653	59%	0.589	S	S	*	*	H	α-helix	trans	-78.1	-19.9	176.4	0	0	0	0	0	113	V45 H46 T47	V45-A49 WeakPolarHBondContact O-CB 3.38Å; V45-A49 PolarHBondContact O-N 3.16Å; H46-A49 PolarHBondContact O-N 3.24Å; T47-A49 VanDerWaalsContact C-N 3.35Å; T47-A49 PolarHBondContact O-N 3.16Å
50	L	78.3	Confident	84	Confident	128 Å²	128	116.9 Å²	116.9	67%	0.67	60%	0.598	S	S	*	*	H	α-helix	trans	-91.6	-11.9	177.6	-72.9	176.9	0	0	0	113.7	H46 T47 H48	H46-L50 WeakPolarHBondContact NE2-CD1 3.38Å; H46-L50 WeakPolarHBondContact O-CB 3.46Å; H46-L50 VanDerWaalsContact O-CG 3.28Å; H46-L50 WeakPolarHBondContact O-CG 3.49Å; H46-L50 PolarHBondContact O-N 3.29Å; H46-L50 VanDerWaalsContact O-N 3.08Å; T47-L50 PolarHBondContact O-N 3.45Å; H48-L50 VanDerWaalsContact C-N 3.33Å
51	I	69.7	Low	83.5	Confident	183 Å²	183	120.2 Å²	120.2	94%	0.938	61%	0.613	S	S	*	*			trans	-89.5	0	171.5	-65.9	166.8	0	0	0	108.4	T47	T47-I51 HydrophobicContact CG2-CD1 4.16Å; T47-I51 WeakPolarHBondContact O-CG1 3.44Å; T47-I51 PolarHBondContact O-N 3.2Å

Retrieved 51 of 51 residues in 40.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).