A0A3Q0KV36_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession A0A3Q0KV36, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 74 aa.

						>A0A3Q0KV36_SCHMA|A0A3Q0KV36
MLKSILILSILSIVFSFVNVKCAVATPESDIDRFPYELTYAHDELDPYYFPTLRDSLIRRLMKRKYYISQRLGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.9	Low	84.4	Confident	202 Å²	202	116.2 Å²	116.2	100%	0.995	60%	0.604	S	S	*	*				0	-42.8	0	-62.8	-165.7	125.9	0	0	113.1	K3 S4 I5	M1-K3 VanDerWaalsContact C-N 3.32Å; M1-K3 PolarHBondContact O-N 3.4Å; M1-S4 PolarHBondContact O-N 3.47Å; M1-S4 PolarHBondContact O-OG 2.98Å; M1-I5 PolarHBondContact O-N 3.25Å
2	L	79.8	Confident	84.4	Confident	134 Å²	134	113.2 Å²	113.2	70%	0.702	60%	0.601	S	S	*	*	H	α-helix	trans	-59.1	-38.6	-179.8	-148.5	114.3	0	0	0	114	S4 I5 L6	L2-S4 PolarHBondContact O-N 2.98Å; L2-I5 PolarHBondContact O-N 3.16Å; L2-L6 HydrophobicContact CD2-CD1 4.2Å; L2-L6 PolarHBondContact O-N 3.33Å; L2-L6 VanDerWaalsContact O-N 3.16Å
3	K	83	Confident	84.4	Confident	178 Å²	178	111.9 Å²	111.9	77%	0.774	59%	0.593	S	S	*	*	H	α-helix	trans	-59.6	-40	178.7	-64.6	-178.4	177.7	178.7	0	113.2	M1 I7	M1-K3 VanDerWaalsContact C-N 3.32Å; M1-K3 PolarHBondContact O-N 3.4Å; K3-I7 WeakPolarHBondContact O-CD1 3.21Å; K3-I7 WeakPolarHBondContact O-CG1 3.34Å; K3-I7 PolarHBondContact O-N 3.1Å
4	S	83.1	Confident	84.2	Confident	65 Å²	65	109.8 Å²	109.8	46%	0.455	59%	0.586	S	S	.	*	H	α-helix	trans	-72.5	-36.4	-179.4	51.2	0	0	0	0	112	M1 L2 L6 I7 L8	M1-S4 PolarHBondContact O-N 3.47Å; M1-S4 PolarHBondContact O-OG 2.98Å; L2-S4 PolarHBondContact O-N 2.98Å; S4-L6 VanDerWaalsContact C-N 3.35Å; S4-I7 PolarHBondContact O-N 3.41Å; S4-L8 PolarHBondContact O-N 3.23Å
5	I	86.2	Confident	83.8	Confident	115 Å²	115	111.9 Å²	111.9	59%	0.59	59%	0.588	S	S	*	*	H	α-helix	trans	-63.7	-41.5	176.6	-61.9	168.6	0	0	0	110.8	M1 L2 I7 L8 S9	M1-I5 PolarHBondContact O-N 3.25Å; L2-I5 PolarHBondContact O-N 3.16Å; I5-I7 PolarHBondContact O-N 3.43Å; I5-L8 PolarHBondContact O-N 2.95Å; I5-S9 PolarHBondContact O-N 3.49Å
6	L	88.3	Confident	83.3	Confident	96 Å²	96	109.4 Å²	109.4	50%	0.503	58%	0.583	S	S	.	*	H	α-helix	trans	-62	-40.2	175.3	-84.4	167.9	0	0	0	112.8	L2 S4 S9 I10	L2-L6 HydrophobicContact CD2-CD1 4.2Å; L2-L6 PolarHBondContact O-N 3.33Å; L2-L6 VanDerWaalsContact O-N 3.16Å; S4-L6 VanDerWaalsContact C-N 3.35Å; L6-S9 PolarHBondContact O-OG 3.13Å; L6-I10 WeakPolarHBondContact O-CD1 3.28Å; L6-I10 WeakPolarHBondContact O-CG1 3.45Å; L6-I10 PolarHBondContact O-N 3.32Å
7	I	88.4	Confident	82.7	Confident	105 Å²	105	111.1 Å²	111.1	54%	0.538	58%	0.584	S	S	.	*	H	α-helix	trans	-67.5	-42.4	178.4	-65.2	164.1	0	0	0	110.6	K3 S4 I5 S9 I10 L11	K3-I7 WeakPolarHBondContact O-CD1 3.21Å; K3-I7 WeakPolarHBondContact O-CG1 3.34Å; K3-I7 PolarHBondContact O-N 3.1Å; S4-I7 PolarHBondContact O-N 3.41Å; I5-I7 PolarHBondContact O-N 3.43Å; I7-S9 PolarHBondContact O-N 3.26Å; I7-I10 PolarHBondContact O-N 3.41Å; I7-L11 HydrophobicContact CG2-CD1 4.02Å; I7-L11 WeakPolarHBondContact O-CG 3.49Å; I7-L11 PolarHBondContact O-N 3.34Å
8	L	88	Confident	82	Confident	121 Å²	121	109.2 Å²	109.2	63%	0.634	58%	0.577	S	S	*	*	H	α-helix	trans	-62.1	-39.3	177.4	-93.4	144.1	0	0	0	112.7	S4 I5 S12	S4-L8 PolarHBondContact O-N 3.23Å; I5-L8 PolarHBondContact O-N 2.95Å; L8-S12 PolarHBondContact O-N 3.07Å
9	S	88.1	Confident	80.8	Confident	55 Å²	55	108.4 Å²	108.4	39%	0.385	57%	0.574	S	S	.	*	H	α-helix	trans	-67.5	-41.7	178.7	69.6	0	0	0	0	112.2	I5 L6 I7 S12 I13	I5-S9 PolarHBondContact O-N 3.49Å; L6-S9 PolarHBondContact O-OG 3.13Å; I7-S9 PolarHBondContact O-N 3.26Å; S9-S12 PolarHBondContact O-N 3.07Å; S9-I13 WeakPolarHBondContact O-CG1 3.42Å; S9-I13 PolarHBondContact O-N 3.47Å; S9-I13 VanDerWaalsContact O-N 3.13Å
10	I	87.9	Confident	79.8	Confident	102 Å²	102	107.2 Å²	107.2	52%	0.523	57%	0.57	S	S	.	*	H	α-helix	trans	-63.2	-45.3	177	-64.5	165.6	0	0	0	110.6	L6 I7 S12 I13 V14	L6-I10 WeakPolarHBondContact O-CD1 3.28Å; L6-I10 WeakPolarHBondContact O-CG1 3.45Å; L6-I10 PolarHBondContact O-N 3.32Å; I7-I10 PolarHBondContact O-N 3.41Å; I10-S12 VanDerWaalsContact C-N 3.31Å; I10-S12 PolarHBondContact O-N 3.42Å; I10-I13 PolarHBondContact O-N 3.03Å; I10-V14 WeakPolarHBondContact O-CG2 3.32Å; I10-V14 PolarHBondContact O-N 3.05Å; I10-V14 VanDerWaalsContact O-N 3.07Å
11	L	86.5	Confident	78.8	Confident	105 Å²	105	109.7 Å²	109.7	55%	0.55	58%	0.576	S	S	.	*	H	α-helix	trans	-60.4	-41.3	177.8	-75.5	171.1	0	0	0	112	I7 I13 V14 F15	I7-L11 HydrophobicContact CG2-CD1 4.02Å; I7-L11 WeakPolarHBondContact O-CG 3.49Å; I7-L11 PolarHBondContact O-N 3.34Å; L11-I13 PolarHBondContact O-N 3.37Å; L11-V14 PolarHBondContact O-N 3.07Å; L11-F15 WeakPolarHBondContact O-CB 3.41Å; L11-F15 PolarHBondContact O-N 3.48Å
12	S	84.5	Confident	78.2	Confident	80 Å²	80	103.8 Å²	103.8	56%	0.559	55%	0.554	S	S	*	*	H	α-helix	trans	-60.9	-43.8	176.9	-175.5	0	0	0	0	112.3	L8 S9 I10 F15 S16	L8-S12 PolarHBondContact O-N 3.07Å; S9-S12 PolarHBondContact O-N 3.07Å; I10-S12 VanDerWaalsContact C-N 3.31Å; I10-S12 PolarHBondContact O-N 3.42Å; S12-F15 PolarHBondContact O-N 3.28Å; S12-S16 PolarHBondContact O-N 3.27Å
13	I	84.2	Confident	77	Confident	97 Å²	97	100.9 Å²	100.9	50%	0.497	55%	0.549	S	S	.	.	H	α-helix	trans	-62.4	-47.3	178.1	-65.9	163.6	0	0	0	110.5	S9 I10 L11 F15 S16 F17	S9-I13 WeakPolarHBondContact O-CG1 3.42Å; S9-I13 PolarHBondContact O-N 3.47Å; S9-I13 VanDerWaalsContact O-N 3.13Å; I10-I13 PolarHBondContact O-N 3.03Å; L11-I13 PolarHBondContact O-N 3.37Å; I13-F15 VanDerWaalsContact C-N 3.32Å; I13-F15 PolarHBondContact O-N 3.29Å; I13-S16 WeakPolarHBondContact O-CB 3.47Å; I13-S16 PolarHBondContact O-N 3.45Å; I13-F17 HydrophobicContact CG2-CD2 3.91Å; I13-F17 HydrophobicContact CG2-CE2 3.8Å; I13-F17 VanDerWaalsContact O-CD2 3.32Å; I13-F17 WeakPolarHBondContact O-CD2 3.32Å; I13-F17 PolarHBondContact O-N 3.29Å; I13-F17 VanDerWaalsContact O-N 3.1Å
14	V	82.1	Confident	75.7	Confident	82 Å²	82	97.9 Å²	97.9	50%	0.497	55%	0.545	S	S	.	.	H	α-helix	trans	-60.8	-43.1	178.1	175.8	0	0	0	0	110.9	I10 L11 S16 F17 V18	I10-V14 WeakPolarHBondContact O-CG2 3.32Å; I10-V14 PolarHBondContact O-N 3.05Å; I10-V14 VanDerWaalsContact O-N 3.07Å; L11-V14 PolarHBondContact O-N 3.07Å; V14-S16 VanDerWaalsContact C-N 3.32Å; V14-S16 PolarHBondContact O-N 2.83Å; V14-F17 PolarHBondContact O-N 3.35Å; V14-V18 WeakPolarHBondContact O-CG2 3.49Å; V14-V18 PolarHBondContact O-N 3.16Å
15	F	77.6	Confident	74.2	Confident	142 Å²	142	98.3 Å²	98.3	62%	0.623	55%	0.553	S	S	*	*	H	α-helix	trans	-63	-39.1	178	-129.4	-86.3	0	0	0	112.4	L11 S12 I13 V18 N19	L11-F15 WeakPolarHBondContact O-CB 3.41Å; L11-F15 PolarHBondContact O-N 3.48Å; S12-F15 PolarHBondContact O-N 3.28Å; I13-F15 VanDerWaalsContact C-N 3.32Å; I13-F15 PolarHBondContact O-N 3.29Å; F15-V18 PolarHBondContact O-N 3.22Å; F15-N19 PolarHBondContact O-N 2.93Å
16	S	76.7	Confident	72.4	Confident	71 Å²	71	96.9 Å²	96.9	50%	0.497	55%	0.55	S	S	.	*	H	α-helix	trans	-62.6	-42.7	175.7	-165.8	0	0	0	0	111.7	S12 I13 V14 N19 V20	S12-S16 PolarHBondContact O-N 3.27Å; I13-S16 WeakPolarHBondContact O-CB 3.47Å; I13-S16 PolarHBondContact O-N 3.45Å; V14-S16 VanDerWaalsContact C-N 3.32Å; V14-S16 PolarHBondContact O-N 2.83Å; S16-N19 PolarHBondContact O-N 3.28Å; S16-V20 VanDerWaalsContact O-CG2 3.28Å; S16-V20 WeakPolarHBondContact O-CG2 3.29Å; S16-V20 PolarHBondContact O-N 3.36Å
17	F	73.4	Confident	70.5	Confident	138 Å²	138	95.4 Å²	95.4	61%	0.605	55%	0.546	S	S	*	.	H	α-helix	trans	-66.4	-37.6	176.9	-84.9	-72.4	0	0	0	113	I13 V14 K21	I13-F17 HydrophobicContact CG2-CD2 3.91Å; I13-F17 HydrophobicContact CG2-CE2 3.8Å; I13-F17 VanDerWaalsContact O-CD2 3.32Å; I13-F17 WeakPolarHBondContact O-CD2 3.32Å; I13-F17 PolarHBondContact O-N 3.29Å; I13-F17 VanDerWaalsContact O-N 3.1Å; V14-F17 PolarHBondContact O-N 3.35Å; F17-K21 PolarHBondContact O-N 3.39Å
18	V	68.9	Low	68.8	Low	77 Å²	77	97.6 Å²	97.6	47%	0.467	55%	0.554	S	S	.	*	H	α-helix	trans	-65.7	-44.5	175.4	175.1	0	0	0	0	110.5	V14 F15 V20 K21 C22	V14-V18 WeakPolarHBondContact O-CG2 3.49Å; V14-V18 PolarHBondContact O-N 3.16Å; F15-V18 PolarHBondContact O-N 3.22Å; V18-V20 PolarHBondContact O-N 2.97Å; V18-K21 PolarHBondContact O-N 2.84Å; V18-C22 WeakPolarHBondContact O-CB 3.15Å; V18-C22 PolarHBondContact O-N 3.38Å; V18-C22 PolarHBondContact O-SG 2.92Å; V18-C22 VanDerWaalsContact O-SG 3.38Å
19	N	60.4	Low	67	Low	95 Å²	95	95.7 Å²	95.7	51%	0.508	55%	0.551	S	S	.	*	H	α-helix	trans	-62.9	-41.1	176.7	-85.4	-25.9	0	0	0	112.6	F15 S16 C22 A23	F15-N19 PolarHBondContact O-N 2.93Å; S16-N19 PolarHBondContact O-N 3.28Å; N19-C22 PolarHBondContact O-N 3.35Å; N19-A23 VanDerWaalsContact O-CB 3.29Å; N19-A23 WeakPolarHBondContact O-CB 3.4Å; N19-A23 PolarHBondContact O-N 2.88Å
20	V	60.3	Low	64.9	Low	84 Å²	84	98.1 Å²	98.1	51%	0.509	56%	0.559	S	S	.	*	H	α-helix	trans	-63.9	-43.3	176	173.6	0	0	0	0	110.5	S16 V18 A23 V24	S16-V20 VanDerWaalsContact O-CG2 3.28Å; S16-V20 WeakPolarHBondContact O-CG2 3.29Å; S16-V20 PolarHBondContact O-N 3.36Å; V18-V20 PolarHBondContact O-N 2.97Å; V20-A23 PolarHBondContact O-N 2.8Å; V20-V24 HydrophobicContact CG1-CG2 4.44Å; V20-V24 WeakPolarHBondContact O-CB 3.34Å; V20-V24 WeakPolarHBondContact O-CG2 3.46Å; V20-V24 PolarHBondContact O-N 3.27Å
21	K	59	Low	63	Low	160 Å²	160	99 Å²	99	70%	0.696	56%	0.564	S	S	*	*	H	α-helix	trans	-66.6	-39.5	176	-79.5	-172.1	170.3	-174.4	0	112.8	F17 V18 V24 A25	F17-K21 PolarHBondContact O-N 3.39Å; V18-K21 PolarHBondContact O-N 2.84Å; K21-V24 PolarHBondContact O-N 3Å; K21-A25 WeakPolarHBondContact O-CB 3.37Å; K21-A25 PolarHBondContact O-N 2.95Å
22	C	56.2	Low	61.2	Low	78 Å²	78	100.3 Å²	100.3	53%	0.527	57%	0.572	S	S	.	*	H	α-helix	trans	-66.7	-36.5	175.8	-75	0	0	0	0	112.1	V18 N19	V18-C22 WeakPolarHBondContact O-CB 3.15Å; V18-C22 PolarHBondContact O-N 3.38Å; V18-C22 PolarHBondContact O-SG 2.92Å; V18-C22 VanDerWaalsContact O-SG 3.38Å; N19-C22 PolarHBondContact O-N 3.35Å
23	A	55.2	Low	59.6	Low	73 Å²	73	105.9 Å²	105.9	60%	0.603	58%	0.58	S	S	*	*	H	α-helix	trans	-69	-35.5	174.5	0	0	0	0	0	112.2	N19 V20	N19-A23 VanDerWaalsContact O-CB 3.29Å; N19-A23 WeakPolarHBondContact O-CB 3.4Å; N19-A23 PolarHBondContact O-N 2.88Å; V20-A23 PolarHBondContact O-N 2.8Å
24	V	54.4	Low	57.5	Low	114 Å²	114	108.4 Å²	108.4	69%	0.691	59%	0.588	S	S	*	*	H	α-helix	trans	-78.1	-25.5	177	174.3	0	0	0	0	112.5	V20 K21 T26	V20-V24 HydrophobicContact CG1-CG2 4.44Å; V20-V24 WeakPolarHBondContact O-CB 3.34Å; V20-V24 WeakPolarHBondContact O-CG2 3.46Å; V20-V24 PolarHBondContact O-N 3.27Å; K21-V24 PolarHBondContact O-N 3Å; V24-T26 VanDerWaalsContact C-N 3.29Å; V24-T26 PolarHBondContact O-N 3.38Å
25	A	51.4	Low	55.8	Low	74 Å²	74	109.1 Å²	109.1	61%	0.612	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.9	-0.6	-174.1	0	0	0	0	0	114.8	K21 P27	K21-A25 WeakPolarHBondContact O-CB 3.37Å; K21-A25 PolarHBondContact O-N 2.95Å; A25-P27 VanDerWaalsContact C-CD 3.45Å; A25-P27 WeakPolarHBondContact O-CD 3.33Å
26	T	49.1	Very low	54.2	Low	86 Å²	86	111.9 Å²	111.9	53%	0.528	60%	0.602	S	S	.	*	S	Bend	trans	-100.2	87.9	163.9	50.9	0	0	0	0	108	V24 E28	V24-T26 VanDerWaalsContact C-N 3.29Å; V24-T26 PolarHBondContact O-N 3.38Å; T26-E28 PolarHBondContact O-N 3.36Å
27	P	48.6	Very low	52.5	Low	65 Å²	65	116.5 Å²	116.5	42%	0.422	62%	0.616	S	S	.	*			trans	-63.3	108.3	168.9	29.5	-33.7	0	0	0	106.4	A25 S29 D30	A25-P27 VanDerWaalsContact C-CD 3.45Å; A25-P27 WeakPolarHBondContact O-CD 3.33Å; P27-S29 PolarHBondContact O-N 3.38Å; P27-D30 PolarHBondContact O-N 2.99Å
28	E	52.3	Low	51.2	Low	151 Å²	151	113.2 Å²	113.2	71%	0.706	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.8	-16.7	177.1	-53.1	-154.1	164.5	0	0	111.5	T26 D30 I31 D32	T26-E28 PolarHBondContact O-N 3.36Å; E28-D30 PolarHBondContact O-N 3.04Å; E28-I31 PolarHBondContact O-N 3.42Å; E28-I31 VanDerWaalsContact O-N 3.16Å; E28-D32 PolarHBondContact O-N 2.96Å
29	S	50	Low	50	Low	81 Å²	81	114.4 Å²	114.4	57%	0.566	61%	0.612	S	S	*	*	H	α-helix	trans	-58.2	-25.4	171.2	66	0	0	0	0	115.4	P27	P27-S29 PolarHBondContact O-N 3.38Å
30	D	44.9	Very low	49.3	Very low	105 Å²	105	118.2 Å²	118.2	56%	0.561	62%	0.62	S	S	*	*	H	α-helix	trans	-83.6	-24.9	177.5	-80.3	-16.2	0	0	0	112.8	P27 E28	P27-D30 PolarHBondContact O-N 2.99Å; E28-D30 PolarHBondContact O-N 3.04Å
31	I	48.2	Very low	48.6	Very low	120 Å²	120	117.1 Å²	117.1	62%	0.615	62%	0.62	S	S	*	*	H	α-helix	trans	-76.6	-38.2	179.1	-61.7	177.5	0	0	0	110.1	E28 R33	E28-I31 PolarHBondContact O-N 3.42Å; E28-I31 VanDerWaalsContact O-N 3.16Å; I31-R33 VanDerWaalsContact C-N 3.35Å
32	D	48.1	Very low	48	Very low	134 Å²	134	115.7 Å²	115.7	72%	0.717	62%	0.615	S	S	*	*	H	α-helix	trans	-75.6	-20.5	177.7	-78.7	-20.4	0	0	0	113.8	E28 F34 P35	E28-D32 PolarHBondContact O-N 2.96Å; D32-F34 VanDerWaalsContact C-N 3.34Å; D32-P35 WeakPolarHBondContact O-CD 3.46Å
33	R	50.3	Low	48	Very low	197 Å²	197	119.7 Å²	119.7	74%	0.743	63%	0.632	S	S	*	*	H	α-helix	trans	-76.8	-23.1	-180	-167.4	165.8	-173.9	162.3	2.3	113.2	I31 P35	I31-R33 VanDerWaalsContact C-N 3.35Å; R33-P35 VanDerWaalsContact C-CD 3.44Å; R33-P35 WeakPolarHBondContact O-CD 3.41Å
34	F	41.5	Very low	48	Very low	150 Å²	150	124.2 Å²	124.2	66%	0.658	64%	0.64	S	S	*	*	S	Bend	trans	-122.4	72	172.4	-62.2	-79	0	0	0	108.6	D32 Y36	D32-F34 VanDerWaalsContact C-N 3.34Å; F34-Y36 PolarHBondContact O-N 3.49Å
35	P	46	Very low	48.4	Very low	97 Å²	97	126.7 Å²	126.7	63%	0.63	65%	0.649	S	S	*	*			trans	-55.4	124.4	163.7	28	-30.6	0	0	0	105	D32 R33 E37	D32-P35 WeakPolarHBondContact O-CD 3.46Å; R33-P35 VanDerWaalsContact C-CD 3.44Å; R33-P35 WeakPolarHBondContact O-CD 3.41Å; P35-E37 PolarHBondContact O-N 3.46Å
36	Y	44.6	Very low	49.1	Very low	200 Å²	200	126.9 Å²	126.9	78%	0.784	64%	0.639	S	S	*	*			trans	-64.1	64.7	-179.6	-90.6	-104.1	0	0	0	110.7	F34 L38	F34-Y36 PolarHBondContact O-N 3.49Å; Y36-L38 PolarHBondContact O-N 3.35Å
37	E	39	Very low	50	Low	168 Å²	168	127.9 Å²	127.9	79%	0.785	65%	0.647	S	S	*	*			trans	-72.4	49.7	151.1	-136.4	177.7	-162	0	0	107.8	P35 T39	P35-E37 PolarHBondContact O-N 3.46Å; E37-T39 PolarHBondContact O-N 2.94Å; E37-T39 VanDerWaalsContact O-N 3.08Å
38	L	47	Very low	51.2	Low	68 Å²	68	133.4 Å²	133.4	36%	0.356	66%	0.661	S	S	.	*			trans	-79.8	72.8	150.9	-160.6	77.7	0	0	0	104.4	Y36 Y40 I58	Y36-L38 PolarHBondContact O-N 3.35Å; L38-Y40 PolarHBondContact O-N 3.19Å; L38-I58 HydrophobicContact CD2-CD1 3.82Å; L38-I58 HydrophobicContact CD2-CG2 4.44Å
39	T	43.8	Very low	52.2	Low	102 Å²	102	131.3 Å²	131.3	63%	0.626	65%	0.648	S	S	*	*			trans	-49.1	101.8	157.7	-12.2	0	0	0	0	104.1	E37 A41	E37-T39 PolarHBondContact O-N 2.94Å; E37-T39 VanDerWaalsContact O-N 3.08Å; T39-A41 HydrophobicContact CG2-CB 4.3Å; T39-A41 PolarHBondContact O-N 3.09Å
40	Y	46	Very low	53.3	Low	175 Å²	175	135.3 Å²	135.3	69%	0.686	66%	0.655	S	S	*	*			trans	-72.5	62.1	173.3	-166.3	-95	0	0	0	106.5	L38	L38-Y40 PolarHBondContact O-N 3.19Å
41	A	44.8	Very low	54.7	Low	61 Å²	61	135.3 Å²	135.3	50%	0.504	66%	0.661	S	S	.	*			trans	-113.4	64.2	179.5	0	0	0	0	0	106.2	T39 D43	T39-A41 HydrophobicContact CG2-CB 4.3Å; T39-A41 PolarHBondContact O-N 3.09Å; A41-D43 VanDerWaalsContact C-N 3.28Å
42	H	47.5	Very low	56.3	Low	130 Å²	130	133.2 Å²	133.2	60%	0.602	65%	0.654	S	S	*	*			trans	-100.1	64.6	152.1	-82.1	-68.3	0	0	0	106.5
43	D	56.2	Low	57.8	Low	162 Å²	162	133.8 Å²	133.8	87%	0.866	66%	0.656	S	S	*	*			trans	-71.2	-21.7	162.9	-77.8	-27.7	0	0	0	110.2	A41	A41-D43 VanDerWaalsContact C-N 3.28Å
44	E	55.3	Low	59.3	Low	169 Å²	169	131 Å²	131	79%	0.79	65%	0.645	S	S	*	*	S	Bend	trans	-96.1	110.8	167.4	-66.1	-174.1	176.7	0	0	109.5	D46	E44-D46 VanDerWaalsContact C-N 3.28Å; E44-D46 PolarHBondContact O-N 3.28Å
45	L	62.4	Low	61	Low	165 Å²	165	125.2 Å²	125.2	86%	0.864	62%	0.621	S	S	*	*			trans	-65.5	89.5	172.3	-160.8	95.2	0	0	0	107.7	P47	L45-P47 WeakPolarHBondContact O-CD 3.09Å; L45-P47 VanDerWaalsContact O-N 3.07Å
46	D	65.9	Low	62.7	Low	78 Å²	78	122.8 Å²	122.8	42%	0.417	61%	0.606	S	S	.	*			trans	-59.1	114.1	175	-177.9	-3.1	0	0	0	108.3	E44 Y48 Y49	E44-D46 VanDerWaalsContact C-N 3.28Å; E44-D46 PolarHBondContact O-N 3.28Å; D46-Y48 PolarHBondContact O-N 2.89Å; D46-Y48 VanDerWaalsContact O-N 3.11Å; D46-Y48 PolarHBondContact OD1-N 2.66Å; D46-Y48 VanDerWaalsContact OD1-N 3.12Å; D46-Y49 VanDerWaalsContact O-CB 3.3Å; D46-Y49 WeakPolarHBondContact O-CB 3.42Å; D46-Y49 PolarHBondContact O-N 3.41Å
47	P	68.7	Low	64.7	Low	107 Å²	107	118 Å²	118	70%	0.695	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.2	-13.8	-175.3	25.8	-33	0	0	0	112.7	L45	L45-P47 WeakPolarHBondContact O-CD 3.09Å; L45-P47 VanDerWaalsContact O-N 3.07Å
48	Y	72.1	Confident	66.9	Low	181 Å²	181	111.3 Å²	111.3	71%	0.71	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.4	8.1	176.6	-58.7	-74.8	0	0	0	113.4	D46 F50	D46-Y48 PolarHBondContact O-N 2.89Å; D46-Y48 VanDerWaalsContact O-N 3.11Å; D46-Y48 PolarHBondContact OD1-N 2.66Å; D46-Y48 VanDerWaalsContact OD1-N 3.12Å; Y48-F50 WeakPolarHBondContact O-CD2 3.47Å; Y48-F50 WeakPolarHBondContact O-CE2 3.32Å; Y48-F50 PolarHBondContact O-N 2.93Å
49	Y	73.6	Confident	68.6	Low	108 Å²	108	116.8 Å²	116.8	42%	0.424	58%	0.579	S	S	.	*			trans	-73.5	115.3	178.3	180	-99.4	0	0	0	111.6	D46 D55	D46-Y49 VanDerWaalsContact O-CB 3.3Å; D46-Y49 WeakPolarHBondContact O-CB 3.42Å; D46-Y49 PolarHBondContact O-N 3.41Å; Y49-D55 PolarHBondContact OH-OD1 2.89Å; Y49-D55 PolarHBondContact OH-OD2 3.41Å
50	F	73.8	Confident	70.6	Confident	164 Å²	164	120.5 Å²	120.5	72%	0.719	58%	0.582	S	S	*	*	P	Polyproline II helix	trans	-97.3	121.6	172.1	-63.8	-79.4	0	0	0	109.9	Y48 T52	Y48-F50 WeakPolarHBondContact O-CD2 3.47Å; Y48-F50 WeakPolarHBondContact O-CE2 3.32Å; Y48-F50 PolarHBondContact O-N 2.93Å; F50-T52 PolarHBondContact O-N 3.03Å
51	P	74.3	Confident	72.6	Confident	106 Å²	106	117.3 Å²	117.3	69%	0.688	58%	0.576	S	S	*	*	P	Polyproline II helix	trans	-63.2	123.8	179	25	-32.4	0	0	0	110.2
52	T	81.9	Confident	74.5	Confident	75 Å²	75	118.6 Å²	118.6	46%	0.46	57%	0.573	S	S	.	*	P	Polyproline II helix	trans	-92.6	168.5	176.2	69.9	0	0	0	0	111.4	F50 R54 D55 S56	F50-T52 PolarHBondContact O-N 3.03Å; T52-R54 PolarHBondContact O-N 2.96Å; T52-R54 WeakPolarHBondContact OG1-CB 3.27Å; T52-R54 PolarHBondContact OG1-N 2.85Å; T52-D55 WeakPolarHBondContact CA-OD2 3.43Å; T52-D55 WeakPolarHBondContact CB-OD2 3.42Å; T52-D55 PolarHBondContact N-OD2 3.44Å; T52-D55 WeakPolarHBondContact O-CB 3.48Å; T52-D55 PolarHBondContact O-N 3.4Å; T52-D55 VanDerWaalsContact OG1-CG 3.29Å; T52-D55 PolarHBondContact OG1-N 2.95Å; T52-D55 PolarHBondContact OG1-OD2 3.3Å; T52-S56 PolarHBondContact O-N 3.25Å
53	L	79.4	Confident	76.3	Confident	146 Å²	146	118.5 Å²	118.5	76%	0.764	57%	0.57	S	S	*	*	H	α-helix	trans	-57.1	-33.9	171.9	-70.5	173.3	0	0	0	111.9	D55 S56 L57	L53-D55 VanDerWaalsContact C-N 3.3Å; L53-D55 PolarHBondContact O-N 2.82Å; L53-S56 WeakPolarHBondContact O-CB 3.35Å; L53-S56 PolarHBondContact O-N 2.81Å; L53-S56 PolarHBondContact O-OG 3.41Å; L53-L57 PolarHBondContact O-N 2.94Å; L53-L57 VanDerWaalsContact O-N 3.11Å
54	R	81.2	Confident	77.7	Confident	139 Å²	139	118.9 Å²	118.9	53%	0.525	56%	0.56	S	S	.	*	H	α-helix	trans	-60.3	-41	175.1	-173.9	-176.3	178.3	-117.8	5.2	111.2	T52 S56 L57 I58	T52-R54 PolarHBondContact O-N 2.96Å; T52-R54 WeakPolarHBondContact OG1-CB 3.27Å; T52-R54 PolarHBondContact OG1-N 2.85Å; R54-S56 VanDerWaalsContact C-N 3.33Å; R54-S56 PolarHBondContact O-N 3.35Å; R54-L57 WeakPolarHBondContact O-CB 3.44Å; R54-L57 PolarHBondContact O-N 3.24Å; R54-L57 VanDerWaalsContact O-N 3.16Å; R54-I58 HydrophobicContact CG-CD1 3.85Å; R54-I58 HydrophobicContact CG-CG1 4.46Å; R54-I58 VanDerWaalsContact O-CG1 3.31Å; R54-I58 WeakPolarHBondContact O-CG1 3.45Å; R54-I58 PolarHBondContact O-N 3.27Å
55	D	78.8	Confident	79.2	Confident	29 Å²	29	117.8 Å²	117.8	16%	0.155	55%	0.552	C	S	.	*	H	α-helix	trans	-70.2	-34.6	-179.4	-52.7	-47.8	0	0	0	111.8	Y49 T52 L53 L57 I58 R59	Y49-D55 PolarHBondContact OH-OD1 2.89Å; Y49-D55 PolarHBondContact OH-OD2 3.41Å; T52-D55 WeakPolarHBondContact CA-OD2 3.43Å; T52-D55 WeakPolarHBondContact CB-OD2 3.42Å; T52-D55 PolarHBondContact N-OD2 3.44Å; T52-D55 WeakPolarHBondContact O-CB 3.48Å; T52-D55 PolarHBondContact O-N 3.4Å; T52-D55 VanDerWaalsContact OG1-CG 3.29Å; T52-D55 PolarHBondContact OG1-N 2.95Å; T52-D55 PolarHBondContact OG1-OD2 3.3Å; L53-D55 VanDerWaalsContact C-N 3.3Å; L53-D55 PolarHBondContact O-N 2.82Å; D55-L57 VanDerWaalsContact C-N 3.3Å; D55-L57 PolarHBondContact O-N 2.97Å; D55-I58 PolarHBondContact O-N 3.03Å; D55-R59 VanDerWaalsContact O-CB 3.23Å; D55-R59 WeakPolarHBondContact O-CB 3.09Å; D55-R59 PolarHBondContact O-N 2.74Å
56	S	80.5	Confident	80.2	Confident	45 Å²	45	116.4 Å²	116.4	32%	0.315	54%	0.537	S	S	.	.	H	α-helix	trans	-61.8	-40	171.7	86	0	0	0	0	111.7	T52 L53 R54 R60	T52-S56 PolarHBondContact O-N 3.25Å; L53-S56 WeakPolarHBondContact O-CB 3.35Å; L53-S56 PolarHBondContact O-N 2.81Å; L53-S56 PolarHBondContact O-OG 3.41Å; R54-S56 VanDerWaalsContact C-N 3.33Å; R54-S56 PolarHBondContact O-N 3.35Å; S56-R60 VanDerWaalsContact O-CG 3.29Å; S56-R60 WeakPolarHBondContact O-CG 3.26Å; S56-R60 PolarHBondContact O-N 2.94Å
57	L	86.8	Confident	81.2	Confident	99 Å²	99	119 Å²	119	52%	0.518	54%	0.541	S	S	.	.	H	α-helix	trans	-68.7	-48.1	176	-73.2	168	0	0	0	111.2	L53 R54 D55 R59 R60 L61	L53-L57 PolarHBondContact O-N 2.94Å; L53-L57 VanDerWaalsContact O-N 3.11Å; R54-L57 WeakPolarHBondContact O-CB 3.44Å; R54-L57 PolarHBondContact O-N 3.24Å; R54-L57 VanDerWaalsContact O-N 3.16Å; D55-L57 VanDerWaalsContact C-N 3.3Å; D55-L57 PolarHBondContact O-N 2.97Å; L57-R59 VanDerWaalsContact C-N 3.31Å; L57-R59 PolarHBondContact O-N 3.49Å; L57-R60 PolarHBondContact O-N 2.85Å; L57-R60 VanDerWaalsContact O-N 3.14Å; L57-L61 WeakPolarHBondContact O-CG 3.38Å; L57-L61 PolarHBondContact O-N 3.38Å
58	I	84.3	Confident	81.9	Confident	28 Å²	28	117.9 Å²	117.9	14%	0.144	53%	0.529	C	S	.	.	H	α-helix	trans	-57.6	-45.9	177.4	-68.1	164	0	0	0	110.1	L38 R54 D55 R60 L61 M62	L38-I58 HydrophobicContact CD2-CD1 3.82Å; L38-I58 HydrophobicContact CD2-CG2 4.44Å; R54-I58 HydrophobicContact CG-CD1 3.85Å; R54-I58 HydrophobicContact CG-CG1 4.46Å; R54-I58 VanDerWaalsContact O-CG1 3.31Å; R54-I58 WeakPolarHBondContact O-CG1 3.45Å; R54-I58 PolarHBondContact O-N 3.27Å; D55-I58 PolarHBondContact O-N 3.03Å; I58-R60 PolarHBondContact O-N 3.08Å; I58-L61 PolarHBondContact O-N 2.83Å; I58-M62 HydrophobicContact CG2-CG 4.28Å; I58-M62 WeakPolarHBondContact O-CB 3.31Å; I58-M62 WeakPolarHBondContact O-CG 3.42Å; I58-M62 PolarHBondContact O-N 3.23Å
59	R	83.5	Confident	82.5	Confident	184 Å²	184	111.3 Å²	111.3	69%	0.694	51%	0.509	S	S	*	.	H	α-helix	trans	-60.3	-42.7	176.9	-174.3	-178.6	-68.3	-99.8	1.8	112.1	D55 L57 K63	D55-R59 VanDerWaalsContact O-CB 3.23Å; D55-R59 WeakPolarHBondContact O-CB 3.09Å; D55-R59 PolarHBondContact O-N 2.74Å; L57-R59 VanDerWaalsContact C-N 3.31Å; L57-R59 PolarHBondContact O-N 3.49Å; R59-K63 VanDerWaalsContact O-CB 3.26Å; R59-K63 WeakPolarHBondContact O-CB 3.29Å; R59-K63 PolarHBondContact O-N 3.42Å
60	R	85.8	Confident	82.9	Confident	179 Å²	179	111.2 Å²	111.2	68%	0.675	51%	0.513	S	S	*	.	H	α-helix	trans	-64.1	-43	176.1	-75.6	175.2	-173.9	-173.9	3.9	111.7	S56 L57 I58 K63 R64	S56-R60 VanDerWaalsContact O-CG 3.29Å; S56-R60 WeakPolarHBondContact O-CG 3.26Å; S56-R60 PolarHBondContact O-N 2.94Å; L57-R60 PolarHBondContact O-N 2.85Å; L57-R60 VanDerWaalsContact O-N 3.14Å; I58-R60 PolarHBondContact O-N 3.08Å; R60-K63 PolarHBondContact O-N 2.88Å; R60-R64 WeakPolarHBondContact O-CB 3.23Å; R60-R64 PolarHBondContact O-N 3.14Å
61	L	88.7	Confident	83.3	Confident	109 Å²	109	114.3 Å²	114.3	57%	0.571	52%	0.52	S	S	*	.	H	α-helix	trans	-66.4	-44.2	178.5	-70.2	172.9	0	0	0	111.7	L57 I58 R64 K65	L57-L61 WeakPolarHBondContact O-CG 3.38Å; L57-L61 PolarHBondContact O-N 3.38Å; I58-L61 PolarHBondContact O-N 2.83Å; L61-R64 PolarHBondContact O-N 3.07Å; L61-K65 WeakPolarHBondContact O-CB 3.38Å; L61-K65 PolarHBondContact O-N 3.43Å
62	M	84.8	Confident	83.7	Confident	87 Å²	87	115.8 Å²	115.8	43%	0.429	52%	0.521	S	S	.	.	H	α-helix	trans	-63.3	-43.6	175.5	-72.8	-61.2	-173.8	0	0	111.7	I58 R64 K65 Y66	I58-M62 HydrophobicContact CG2-CG 4.28Å; I58-M62 WeakPolarHBondContact O-CB 3.31Å; I58-M62 WeakPolarHBondContact O-CG 3.42Å; I58-M62 PolarHBondContact O-N 3.23Å; M62-R64 VanDerWaalsContact C-N 3.31Å; M62-R64 PolarHBondContact O-N 2.86Å; M62-K65 PolarHBondContact O-N 3.16Å; M62-K65 HydrophobicContact SD-CD 4.39Å; M62-Y66 WeakPolarHBondContact O-CB 3.47Å; M62-Y66 PolarHBondContact O-N 3.11Å
63	K	85.2	Confident	83	Confident	128 Å²	128	115.3 Å²	115.3	56%	0.557	53%	0.531	S	S	*	.	H	α-helix	trans	-58.2	-44.9	173.7	-176.4	170.7	-177.2	174.2	0	111	R59 R60 Y66 Y67	R59-K63 VanDerWaalsContact O-CB 3.26Å; R59-K63 WeakPolarHBondContact O-CB 3.29Å; R59-K63 PolarHBondContact O-N 3.42Å; R60-K63 PolarHBondContact O-N 2.88Å; K63-Y66 PolarHBondContact O-N 3.48Å; K63-Y67 HydrophobicContact CD-CE2 4.13Å; K63-Y67 HydrophobicContact CG-CD2 3.89Å; K63-Y67 HydrophobicContact CG-CE2 3.52Å; K63-Y67 WeakPolarHBondContact O-CD2 3.47Å; K63-Y67 PolarHBondContact O-N 2.64Å
64	R	84.8	Confident	81.8	Confident	171 Å²	171	120.2 Å²	120.2	65%	0.645	55%	0.546	S	S	*	.	H	α-helix	trans	-63.5	-45.4	176.3	-173.4	178.1	-179.1	-180	0.4	112	R60 L61 M62 Y66 Y67 I68	R60-R64 WeakPolarHBondContact O-CB 3.23Å; R60-R64 PolarHBondContact O-N 3.14Å; L61-R64 PolarHBondContact O-N 3.07Å; M62-R64 VanDerWaalsContact C-N 3.31Å; M62-R64 PolarHBondContact O-N 2.86Å; R64-Y66 VanDerWaalsContact C-N 3.31Å; R64-Y66 PolarHBondContact O-N 2.88Å; R64-Y67 PolarHBondContact O-N 2.88Å; R64-I68 HydrophobicContact CG-CD1 3.94Å; R64-I68 VanDerWaalsContact O-CG1 3.32Å; R64-I68 WeakPolarHBondContact O-CG1 3.2Å; R64-I68 PolarHBondContact O-N 3.21Å
65	K	87.5	Confident	81.9	Confident	145 Å²	145	119.3 Å²	119.3	63%	0.63	55%	0.547	S	S	*	.	H	α-helix	trans	-57.2	-45.6	176.4	-176.3	-175.9	176.8	-176	0	110.8	L61 M62 I68 S69	L61-K65 WeakPolarHBondContact O-CB 3.38Å; L61-K65 PolarHBondContact O-N 3.43Å; M62-K65 PolarHBondContact O-N 3.16Å; M62-K65 HydrophobicContact SD-CD 4.39Å; K65-I68 PolarHBondContact O-N 3.46Å; K65-S69 PolarHBondContact O-N 3.28Å; K65-S69 PolarHBondContact O-OG 3.43Å
66	Y	82.8	Confident	82	Confident	136 Å²	136	124 Å²	124	53%	0.533	57%	0.568	S	S	.	*	H	α-helix	trans	-61.7	-45.6	176.8	179.2	-98.7	0	0	0	112.4	M62 K63 R64 I68 S69 Q70	M62-Y66 WeakPolarHBondContact O-CB 3.47Å; M62-Y66 PolarHBondContact O-N 3.11Å; K63-Y66 PolarHBondContact O-N 3.48Å; R64-Y66 VanDerWaalsContact C-N 3.31Å; R64-Y66 PolarHBondContact O-N 2.88Å; Y66-I68 VanDerWaalsContact C-N 3.31Å; Y66-I68 PolarHBondContact O-N 2.74Å; Y66-S69 WeakPolarHBondContact CA-OG 3.3Å; Y66-S69 PolarHBondContact O-N 3.03Å; Y66-S69 PolarHBondContact O-OG 3.44Å; Y66-Q70 HydrophobicContact CD1-CG 4.19Å; Y66-Q70 HydrophobicContact CE1-CG 3.83Å; Y66-Q70 HydrophobicContact CE2-CG 4.27Å; Y66-Q70 VanDerWaalsContact CZ-NE2 3.26Å; Y66-Q70 VanDerWaalsContact O-CG 3.27Å; Y66-Q70 WeakPolarHBondContact O-CG 3.48Å; Y66-Q70 PolarHBondContact O-N 2.91Å; Y66-Q70 PolarHBondContact OH-NE2 3.24Å
67	Y	86.3	Confident	82.1	Confident	132 Å²	132	128.4 Å²	128.4	52%	0.518	58%	0.582	S	S	.	*	H	α-helix	trans	-63.1	-38	176.1	-80.8	-64.4	0	0	0	113	K63 R64 R71	K63-Y67 HydrophobicContact CD-CE2 4.13Å; K63-Y67 HydrophobicContact CG-CD2 3.89Å; K63-Y67 HydrophobicContact CG-CE2 3.52Å; K63-Y67 WeakPolarHBondContact O-CD2 3.47Å; K63-Y67 PolarHBondContact O-N 2.64Å; R64-Y67 PolarHBondContact O-N 2.88Å; Y67-R71 WeakPolarHBondContact O-CG 3.48Å; Y67-R71 PolarHBondContact O-N 2.67Å; Y67-R71 VanDerWaalsContact O-N 3.09Å
68	I	84.9	Confident	81.8	Confident	84 Å²	84	130.1 Å²	130.1	43%	0.431	59%	0.585	S	S	.	*	H	α-helix	trans	-66.2	-44.5	176.1	-68.7	167.5	0	0	0	110	R64 K65 Y66 Q70 R71 L72	R64-I68 HydrophobicContact CG-CD1 3.94Å; R64-I68 VanDerWaalsContact O-CG1 3.32Å; R64-I68 WeakPolarHBondContact O-CG1 3.2Å; R64-I68 PolarHBondContact O-N 3.21Å; K65-I68 PolarHBondContact O-N 3.46Å; Y66-I68 VanDerWaalsContact C-N 3.31Å; Y66-I68 PolarHBondContact O-N 2.74Å; I68-Q70 VanDerWaalsContact C-N 3.32Å; I68-Q70 PolarHBondContact O-N 3.19Å; I68-R71 PolarHBondContact O-N 3.39Å; I68-L72 HydrophobicContact CG2-CD1 3.59Å; I68-L72 HydrophobicContact CG2-CG 4.24Å; I68-L72 WeakPolarHBondContact O-CB 3.32Å; I68-L72 WeakPolarHBondContact O-CG 3.14Å; I68-L72 PolarHBondContact O-N 3.12Å
69	S	83.7	Confident	81.7	Confident	43 Å²	43	136.5 Å²	136.5	30%	0.301	61%	0.613	S	S	.	*	H	α-helix	trans	-63.9	-36.1	177.9	60.5	0	0	0	0	112.8	K65 Y66 L72	K65-S69 PolarHBondContact O-N 3.28Å; K65-S69 PolarHBondContact O-OG 3.43Å; Y66-S69 WeakPolarHBondContact CA-OG 3.3Å; Y66-S69 PolarHBondContact O-N 3.03Å; Y66-S69 PolarHBondContact O-OG 3.44Å; S69-L72 PolarHBondContact O-N 3.11Å
70	Q	81.6	Confident	81.6	Confident	106 Å²	106	133.3 Å²	133.3	50%	0.495	61%	0.608	S	S	.	*	H	α-helix	trans	-64.9	-39.2	174	-71.9	-68.5	-10.2	0	0	112.2	Y66 I68 G73	Y66-Q70 HydrophobicContact CD1-CG 4.19Å; Y66-Q70 HydrophobicContact CE1-CG 3.83Å; Y66-Q70 HydrophobicContact CE2-CG 4.27Å; Y66-Q70 VanDerWaalsContact CZ-NE2 3.26Å; Y66-Q70 VanDerWaalsContact O-CG 3.27Å; Y66-Q70 WeakPolarHBondContact O-CG 3.48Å; Y66-Q70 PolarHBondContact O-N 2.91Å; Y66-Q70 PolarHBondContact OH-NE2 3.24Å; I68-Q70 VanDerWaalsContact C-N 3.32Å; I68-Q70 PolarHBondContact O-N 3.19Å; Q70-G73 PolarHBondContact O-N 3.04Å
71	R	82.5	Confident	81.3	Confident	229 Å²	229	130.1 Å²	130.1	86%	0.864	60%	0.603	S	S	*	*	H	α-helix	trans	-74.3	-29.1	177.6	-75.3	-174.4	177.3	-168.6	-0.9	113.7	Y67 I68 G73	Y67-R71 WeakPolarHBondContact O-CG 3.48Å; Y67-R71 PolarHBondContact O-N 2.67Å; Y67-R71 VanDerWaalsContact O-N 3.09Å; I68-R71 PolarHBondContact O-N 3.39Å; R71-G73 PolarHBondContact O-N 3.26Å
72	L	82.2	Confident	80.7	Confident	138 Å²	138	131.7 Å²	131.7	72%	0.723	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.6	-1.3	177.7	-72.5	169.8	0	0	0	113	I68 S69	I68-L72 HydrophobicContact CG2-CD1 3.59Å; I68-L72 HydrophobicContact CG2-CG 4.24Å; I68-L72 WeakPolarHBondContact O-CB 3.32Å; I68-L72 WeakPolarHBondContact O-CG 3.14Å; I68-L72 PolarHBondContact O-N 3.12Å; S69-L72 PolarHBondContact O-N 3.11Å
73	G	68.9	Low	80.3	Confident	64 Å²	64	135.4 Å²	135.4	66%	0.66	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	65.7	43.5	172	0	0	0	0	0	113.8	Q70 R71	Q70-G73 PolarHBondContact O-N 3.04Å; R71-G73 PolarHBondContact O-N 3.26Å
74	K	53.7	Low	79.9	Confident	249 Å²	249	136.1 Å²	136.1	100%	1.083	63%	0.626	S	S	*	*			trans	-70.3	0	162.4	-78.3	-165.7	175.9	-170.6	0	111.1

Retrieved 74 of 74 residues in 58.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).