A0A3Q0KV51_SCHMA Loading...

Iso_dh domain-containing protein AlphaSync

AlphaFold DB , UniProt , Accession A0A3Q0KV51, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 59 aa.

						>A0A3Q0KV51_SCHMA|A0A3Q0KV51
MIIAGEYSGIEHVIVDGVVQSIKLIPEEIKRCVARFAFQYAKDNGQRSVIAAPENSTLH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.7	Very low	52.2	Low	222 Å²	222	120.6 Å²	120.6	100%	1.094	68%	0.682	S	S	*	*				0	94.6	0	-173.3	166.6	75.1	0	0	106.7	I3	M1-I3 PolarHBondContact O-N 3.37Å; M1-I3 VanDerWaalsContact O-N 3.15Å
2	I	44.8	Very low	53.2	Low	151 Å²	151	119.4 Å²	119.4	77%	0.774	67%	0.666	S	S	*	*			trans	-80.8	98.2	-167.7	-55.5	168.3	0	0	0	106.4	A4	I2-A4 PolarHBondContact O-N 3.08Å
3	I	46.8	Very low	54	Low	98 Å²	98	117.2 Å²	117.2	50%	0.503	66%	0.657	S	S	.	*			trans	-72.5	121	168.7	52.6	172	0	0	0	106.6	M1 G5 E6	M1-I3 PolarHBondContact O-N 3.37Å; M1-I3 VanDerWaalsContact O-N 3.15Å; I3-G5 PolarHBondContact O-N 2.95Å; I3-E6 HydrophobicContact CD1-CG 3.62Å; I3-E6 HydrophobicContact CG1-CG 3.82Å; I3-E6 PolarHBondContact O-N 3.47Å
4	A	54.6	Low	55	Low	93 Å²	93	115.4 Å²	115.4	77%	0.769	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.6	15.3	-172.7	0	0	0	0	0	115.4	I2	I2-A4 PolarHBondContact O-N 3.08Å
5	G	53.5	Low	56.4	Low	63 Å²	63	113.7 Å²	113.7	65%	0.649	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-113	-11	-176.4	0	0	0	0	0	115.5	I3	I3-G5 PolarHBondContact O-N 2.95Å
6	E	49.5	Very low	57.9	Low	116 Å²	116	116.5 Å²	116.5	54%	0.542	65%	0.65	S	S	.	*			trans	-99.3	22.8	-173.6	-61.4	-92.5	110.1	0	0	113.1	I3 S8 K23	I3-E6 HydrophobicContact CD1-CG 3.62Å; I3-E6 HydrophobicContact CG1-CG 3.82Å; I3-E6 PolarHBondContact O-N 3.47Å; E6-S8 PolarHBondContact O-N 3.38Å; E6-K23 IonicContact OE2-NZ 3.51Å; E6-K23 PolarHBondContact OE2-NZ 3.29Å
7	Y	52.2	Low	59.3	Low	164 Å²	164	114.1 Å²	114.1	64%	0.643	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.2	20.8	172.3	-82.8	-77.2	0	0	0	113.7	E11	Y7-E11 WeakPolarHBondContact CD1-OE1 3.35Å
8	S	54.7	Low	60.6	Low	119 Å²	119	112.2 Å²	112.2	83%	0.832	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.8	9.5	176.1	-168.2	0	0	0	0	112.9	E6	E6-S8 PolarHBondContact O-N 3.38Å
9	G	57.8	Low	61.7	Low	38 Å²	38	111.3 Å²	111.3	39%	0.392	65%	0.645	S	S	.	*	S	Bend	trans	-109.9	94.5	179.9	0	0	0	0	0	111.7	E11	G9-E11 PolarHBondContact O-N 3.32Å
10	I	58.4	Low	62.5	Low	158 Å²	158	110.1 Å²	110.1	81%	0.81	63%	0.632	S	S	*	*			trans	27.5	70	159.4	-31.8	172.6	0	0	0	113.5	H12	I10-H12 HydrophobicContact CG2-CB 4.44Å; I10-H12 PolarHBondContact O-N 3.35Å
11	E	59.5	Low	63.4	Low	105 Å²	105	109.7 Å²	109.7	49%	0.491	64%	0.637	S	S	.	*			trans	-67.3	82.1	171.7	-62.1	-84.8	156.4	0	0	107.4	Y7 G9 V13	Y7-E11 WeakPolarHBondContact CD1-OE1 3.35Å; G9-E11 PolarHBondContact O-N 3.32Å; E11-V13 PolarHBondContact O-N 3.5Å
12	H	63.5	Low	65.3	Low	106 Å²	106	105.8 Å²	105.8	49%	0.491	62%	0.618	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-91	102.1	176.9	-174.5	-140.5	0	0	0	107.8	I10 I14	I10-H12 HydrophobicContact CG2-CB 4.44Å; I10-H12 PolarHBondContact O-N 3.35Å; H12-I14 PolarHBondContact O-N 3.29Å
13	V	64.4	Low	67.2	Low	90 Å²	90	103.7 Å²	103.7	55%	0.545	60%	0.604	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-74.9	105.6	168.8	-176.1	0	0	0	0	107.2	E11 V15	E11-V13 PolarHBondContact O-N 3.5Å; V13-V15 WeakPolarHBondContact CG1-O 3.39Å
14	I	67	Low	69.2	Low	92 Å²	92	107.3 Å²	107.3	47%	0.472	62%	0.623	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-80.2	-38.1	-178.7	-54.7	172.5	0	0	0	110	H12 Q20	H12-I14 PolarHBondContact O-N 3.29Å; I14-Q20 HydrophobicContact CD1-CB 4Å
15	V	77.2	Confident	70.7	Confident	90 Å²	90	106.7 Å²	106.7	55%	0.545	61%	0.606	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-147.8	150.9	179.8	-175.8	0	0	0	0	107.9	V13 G17 V18	V13-V15 WeakPolarHBondContact CG1-O 3.39Å; V15-G17 PolarHBondContact O-N 2.81Å; V15-V18 HydrophobicContact CB-CB 4.39Å; V15-V18 HydrophobicContact CB-CG2 4.38Å; V15-V18 PolarHBondContact O-N 3.28Å
16	D	79.3	Confident	72.5	Confident	159 Å²	159	106.9 Å²	106.9	85%	0.85	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.1	126.9	173.9	-171	34.8	0	0	0	111	V18	D16-V18 PolarHBondContact O-N 3.32Å
17	G	82.9	Confident	74.4	Confident	76 Å²	76	105.4 Å²	105.4	78%	0.784	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	81.7	-4.4	-174.5	0	0	0	0	0	116.7	V15	V15-G17 PolarHBondContact O-N 2.81Å
18	V	82.7	Confident	76.3	Confident	79 Å²	79	103.3 Å²	103.3	48%	0.479	59%	0.585	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-113.7	110.2	176.8	-176.8	0	0	0	0	110.5	V15 D16	V15-V18 HydrophobicContact CB-CB 4.39Å; V15-V18 HydrophobicContact CB-CG2 4.38Å; V15-V18 PolarHBondContact O-N 3.28Å; D16-V18 PolarHBondContact O-N 3.32Å
19	V	80.5	Confident	78.1	Confident	96 Å²	96	101.7 Å²	101.7	58%	0.582	57%	0.566	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-103.8	127.5	173.8	-174.9	0	0	0	0	109.2
20	Q	78.9	Confident	79.5	Confident	86 Å²	86	104.9 Å²	104.9	40%	0.402	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-96.9	139.2	172.4	-171.4	179.3	36	0	0	110.1	I14 I22	I14-Q20 HydrophobicContact CD1-CB 4Å; Q20-I22 HydrophobicContact CG-CG1 4.35Å
21	S	80.1	Confident	81.1	Confident	103 Å²	103	104.7 Å²	104.7	72%	0.72	56%	0.559	S	S	*	*			trans	-132.6	132.3	168.1	-178.5	0	0	0	0	109.2
22	I	83.4	Confident	82.6	Confident	139 Å²	139	102.4 Å²	102.4	71%	0.713	55%	0.553	S	S	*	*			trans	-117.9	129.3	175.9	-59.5	173.4	0	0	0	106.9	Q20	Q20-I22 HydrophobicContact CG-CG1 4.35Å
23	K	83.7	Confident	83.9	Confident	108 Å²	108	101.7 Å²	101.7	47%	0.47	56%	0.556	S	S	.	*			trans	-125.8	129.3	177	-172.9	-179.8	-77.5	-88.4	0	110	E6 I25	E6-K23 IonicContact OE2-NZ 3.51Å; E6-K23 PolarHBondContact OE2-NZ 3.29Å; K23-I25 HydrophobicContact CB-CD1 4.32Å; K23-I25 HydrophobicContact CB-CG1 4.09Å; K23-I25 HydrophobicContact CD-CD1 3.85Å; K23-I25 HydrophobicContact CD-CG1 3.64Å; K23-I25 HydrophobicContact CG-CD1 4.16Å; K23-I25 HydrophobicContact CG-CG1 3.6Å
24	L	88.6	Confident	85	Confident	174 Å²	174	99.3 Å²	99.3	91%	0.911	55%	0.546	S	S	*	.			trans	-76.9	119.5	164.5	-176.7	64.1	0	0	0	108.5
25	I	86.5	Confident	86.1	Confident	79 Å²	79	102.4 Å²	102.4	41%	0.405	55%	0.552	S	S	.	*			trans	-128.1	136	-178.3	-53.9	175.3	0	0	0	107.8	K23 I29	K23-I25 HydrophobicContact CB-CD1 4.32Å; K23-I25 HydrophobicContact CB-CG1 4.09Å; K23-I25 HydrophobicContact CD-CD1 3.85Å; K23-I25 HydrophobicContact CD-CG1 3.64Å; K23-I25 HydrophobicContact CG-CD1 4.16Å; K23-I25 HydrophobicContact CG-CG1 3.6Å; I25-I29 HydrophobicContact CG2-CB 3.79Å; I25-I29 HydrophobicContact CG2-CG2 3.75Å
26	P	91.9	Very high	86.7	Confident	67 Å²	67	105.1 Å²	105.1	44%	0.435	56%	0.557	S	S	.	*			trans	-59.5	145.5	172.3	-22.7	33.3	0	0	0	112.3	E28 I29 K30	P26-E28 VanDerWaalsContact C-N 3.29Å; P26-E28 HydrophobicContact CB-CG 4.49Å; P26-E28 WeakPolarHBondContact CB-OE1 3.47Å; P26-E28 PolarHBondContact O-N 3.1Å; P26-I29 HydrophobicContact CB-CG1 4.22Å; P26-I29 HydrophobicContact CG-CG1 4.34Å; P26-I29 PolarHBondContact O-N 3.35Å; P26-I29 VanDerWaalsContact O-N 3.08Å; P26-K30 PolarHBondContact O-N 3.41Å
27	E	89.6	Confident	87.2	Confident	86 Å²	86	99.9 Å²	99.9	40%	0.402	54%	0.535	S	S	.	.	H	α-helix	trans	-61.9	-35.5	-176.3	176.5	59.8	-162	0	0	112.1	I29 K30 R31	E27-I29 VanDerWaalsContact C-N 3.31Å; E27-I29 PolarHBondContact O-N 2.99Å; E27-K30 PolarHBondContact O-N 2.89Å; E27-K30 WeakPolarHBondContact OE2-CD 3.17Å; E27-R31 VanDerWaalsContact CG-NH2 3.29Å; E27-R31 WeakPolarHBondContact O-CG 3.48Å; E27-R31 PolarHBondContact O-N 3.11Å; E27-R31 IonicContact OE1-CZ 3.26Å; E27-R31 IonicContact OE1-NE 2.68Å; E27-R31 PolarHBondContact OE1-NE 3.07Å; E27-R31 IonicContact OE1-NH2 2.94Å; E27-R31 PolarHBondContact OE1-NH2 2.81Å
28	E	92	Very high	87.4	Confident	119 Å²	119	100.7 Å²	100.7	56%	0.556	52%	0.517	S	S	*	.	H	α-helix	trans	-63.3	-36.6	175.3	66.4	-82.1	-179.5	0	0	113	P26 C32	P26-E28 VanDerWaalsContact C-N 3.29Å; P26-E28 HydrophobicContact CB-CG 4.49Å; P26-E28 WeakPolarHBondContact CB-OE1 3.47Å; P26-E28 PolarHBondContact O-N 3.1Å; E28-C32 PolarHBondContact O-N 2.96Å; E28-C32 PolarHBondContact O-SG 2.9Å
29	I	92.1	Very high	87.7	Confident	86 Å²	86	101.3 Å²	101.3	44%	0.441	52%	0.515	S	S	.	.	H	α-helix	trans	-72.9	-42.4	177.3	-57.3	-57.4	0	0	0	109.8	I25 P26 E27 R31 C32 V33	I25-I29 HydrophobicContact CG2-CB 3.79Å; I25-I29 HydrophobicContact CG2-CG2 3.75Å; P26-I29 HydrophobicContact CB-CG1 4.22Å; P26-I29 HydrophobicContact CG-CG1 4.34Å; P26-I29 PolarHBondContact O-N 3.35Å; P26-I29 VanDerWaalsContact O-N 3.08Å; E27-I29 VanDerWaalsContact C-N 3.31Å; E27-I29 PolarHBondContact O-N 2.99Å; I29-R31 VanDerWaalsContact C-N 3.28Å; I29-R31 PolarHBondContact O-N 3.35Å; I29-C32 WeakPolarHBondContact O-CB 3.44Å; I29-C32 PolarHBondContact O-N 2.96Å; I29-C32 VanDerWaalsContact O-N 3.07Å; I29-V33 HydrophobicContact CG2-CG2 4.45Å; I29-V33 WeakPolarHBondContact O-CG2 3.31Å; I29-V33 PolarHBondContact O-N 2.93Å
30	K	88.2	Confident	88.2	Confident	104 Å²	104	103.1 Å²	103.1	45%	0.452	51%	0.512	S	S	.	.	H	α-helix	trans	-55.5	-43.2	175.3	-174	-178.2	176.4	-176.3	0	111.6	P26 E27 V33 A34	P26-K30 PolarHBondContact O-N 3.41Å; E27-K30 PolarHBondContact O-N 2.89Å; E27-K30 WeakPolarHBondContact OE2-CD 3.17Å; K30-V33 PolarHBondContact O-N 3.14Å; K30-A34 WeakPolarHBondContact O-CB 3.28Å; K30-A34 PolarHBondContact O-N 2.92Å
31	R	90.5	Very high	88.7	Confident	155 Å²	155	99.1 Å²	99.1	59%	0.585	49%	0.494	S	S	*	.	H	α-helix	trans	-63.9	-39.6	175.8	-70.3	173	-167.4	163.9	1.9	112.9	E27 I29 R35	E27-R31 VanDerWaalsContact CG-NH2 3.29Å; E27-R31 WeakPolarHBondContact O-CG 3.48Å; E27-R31 PolarHBondContact O-N 3.11Å; E27-R31 IonicContact OE1-CZ 3.26Å; E27-R31 IonicContact OE1-NE 2.68Å; E27-R31 PolarHBondContact OE1-NE 3.07Å; E27-R31 IonicContact OE1-NH2 2.94Å; E27-R31 PolarHBondContact OE1-NH2 2.81Å; I29-R31 VanDerWaalsContact C-N 3.28Å; I29-R31 PolarHBondContact O-N 3.35Å; R31-R35 WeakPolarHBondContact O-CB 3.32Å; R31-R35 PolarHBondContact O-N 3.03Å
32	C	91.9	Very high	89	Confident	56 Å²	56	101.7 Å²	101.7	38%	0.378	49%	0.492	S	S	.	.	H	α-helix	trans	-63.8	-44.8	175.6	-74.2	0	0	0	0	112	E28 I29 R35 F36	E28-C32 PolarHBondContact O-N 2.96Å; E28-C32 PolarHBondContact O-SG 2.9Å; I29-C32 WeakPolarHBondContact O-CB 3.44Å; I29-C32 PolarHBondContact O-N 2.96Å; I29-C32 VanDerWaalsContact O-N 3.07Å; C32-R35 PolarHBondContact O-N 3.45Å; C32-R35 PolarHBondContact SG-NH2 2.94Å; C32-R35 VanDerWaalsContact SG-NH2 3.45Å; C32-F36 PolarHBondContact O-N 3.45Å
33	V	89.6	Confident	89.3	Confident	92 Å²	92	100.3 Å²	100.3	56%	0.558	49%	0.487	S	S	*	.	H	α-helix	trans	-63.3	-45.8	176.5	175.7	0	0	0	0	110.9	I29 K30 R35 F36 A37	I29-V33 HydrophobicContact CG2-CG2 4.45Å; I29-V33 WeakPolarHBondContact O-CG2 3.31Å; I29-V33 PolarHBondContact O-N 2.93Å; K30-V33 PolarHBondContact O-N 3.14Å; V33-R35 PolarHBondContact O-N 3.32Å; V33-F36 PolarHBondContact O-N 3.49Å; V33-A37 WeakPolarHBondContact O-CB 3.45Å; V33-A37 PolarHBondContact O-N 3.15Å
34	A	88.9	Confident	89.5	Confident	40 Å²	40	100 Å²	100	33%	0.331	49%	0.49	S	S	.	.	H	α-helix	trans	-58.5	-50.5	177.2	0	0	0	0	0	111.1	K30 F36 A37 F38	K30-A34 WeakPolarHBondContact O-CB 3.28Å; K30-A34 PolarHBondContact O-N 2.92Å; A34-F36 VanDerWaalsContact C-N 3.31Å; A34-F36 PolarHBondContact O-N 3.33Å; A34-A37 PolarHBondContact O-N 2.89Å; A34-A37 VanDerWaalsContact O-N 3.14Å; A34-F38 HydrophobicContact CB-CD2 4.49Å; A34-F38 HydrophobicContact CB-CE2 4.49Å; A34-F38 WeakPolarHBondContact O-CD2 3.13Å; A34-F38 PolarHBondContact O-N 3.36Å
35	R	89.9	Confident	89.3	Confident	156 Å²	156	94.4 Å²	94.4	59%	0.589	48%	0.475	S	S	*	.	H	α-helix	trans	-56.6	-44.8	178.5	-176.6	178.9	65	-101.6	-0.3	112	R31 C32 V33 Q39	R31-R35 WeakPolarHBondContact O-CB 3.32Å; R31-R35 PolarHBondContact O-N 3.03Å; C32-R35 PolarHBondContact O-N 3.45Å; C32-R35 PolarHBondContact SG-NH2 2.94Å; C32-R35 VanDerWaalsContact SG-NH2 3.45Å; V33-R35 PolarHBondContact O-N 3.32Å; R35-Q39 WeakPolarHBondContact O-CB 3.36Å; R35-Q39 PolarHBondContact O-N 2.95Å
36	F	90.3	Very high	89	Confident	148 Å²	148	96.4 Å²	96.4	65%	0.649	48%	0.482	S	S	*	.	H	α-helix	trans	-63.1	-44.6	177.4	-178.4	-97.9	0	0	0	111.8	C32 V33 A34 Q39 Y40	C32-F36 PolarHBondContact O-N 3.45Å; V33-F36 PolarHBondContact O-N 3.49Å; A34-F36 VanDerWaalsContact C-N 3.31Å; A34-F36 PolarHBondContact O-N 3.33Å; F36-Q39 PolarHBondContact O-N 3.07Å; F36-Y40 VanDerWaalsContact O-CB 3.28Å; F36-Y40 WeakPolarHBondContact O-CB 3.25Å; F36-Y40 PolarHBondContact O-N 3.32Å
37	A	88.6	Confident	88.2	Confident	48 Å²	48	105.3 Å²	105.3	40%	0.397	51%	0.507	S	S	.	.	H	α-helix	trans	-62.2	-44.2	178.4	0	0	0	0	0	112.5	V33 A34 A41	V33-A37 WeakPolarHBondContact O-CB 3.45Å; V33-A37 PolarHBondContact O-N 3.15Å; A34-A37 PolarHBondContact O-N 2.89Å; A34-A37 VanDerWaalsContact O-N 3.14Å; A37-A41 VanDerWaalsContact O-CB 3.31Å; A37-A41 WeakPolarHBondContact O-CB 3.44Å; A37-A41 PolarHBondContact O-N 3.44Å
38	F	88.2	Confident	87.5	Confident	94 Å²	94	105.1 Å²	105.1	41%	0.412	52%	0.515	S	S	.	.	H	α-helix	trans	-65.3	-42.2	176.1	-80.5	-73.2	0	0	0	112.5	A34 A41 K42 V49 A51	A34-F38 HydrophobicContact CB-CD2 4.49Å; A34-F38 HydrophobicContact CB-CE2 4.49Å; A34-F38 WeakPolarHBondContact O-CD2 3.13Å; A34-F38 PolarHBondContact O-N 3.36Å; F38-A41 PolarHBondContact O-N 3.49Å; F38-K42 WeakPolarHBondContact O-CB 3.45Å; F38-K42 PolarHBondContact O-N 3.23Å; F38-V49 HydrophobicContact CD1-CB 3.63Å; F38-V49 HydrophobicContact CD1-CG1 3.79Å; F38-V49 HydrophobicContact CD1-CG2 4.12Å; F38-V49 HydrophobicContact CE1-CB 3.49Å; F38-V49 VanDerWaalsContact CE1-CB 3.49Å; F38-V49 HydrophobicContact CE1-CG1 3.54Å; F38-V49 HydrophobicContact CE1-CG2 4.46Å; F38-V49 HydrophobicContact CG-CG1 4.49Å; F38-V49 HydrophobicContact CZ-CB 4.43Å; F38-V49 HydrophobicContact CZ-CG1 4.03Å; F38-A51 HydrophobicContact CE2-CB 4.2Å; F38-A51 HydrophobicContact CZ-CB 3.79Å
39	Q	89.4	Confident	86.9	Confident	92 Å²	92	101.9 Å²	101.9	43%	0.43	50%	0.504	S	S	.	.	H	α-helix	trans	-63.7	-48.2	178	-175.5	58.1	56.4	0	0	110.8	R35 F36 A41 K42 D43	R35-Q39 WeakPolarHBondContact O-CB 3.36Å; R35-Q39 PolarHBondContact O-N 2.95Å; F36-Q39 PolarHBondContact O-N 3.07Å; Q39-A41 VanDerWaalsContact C-N 3.3Å; Q39-A41 PolarHBondContact O-N 2.77Å; Q39-K42 WeakPolarHBondContact O-CB 3.35Å; Q39-K42 PolarHBondContact O-N 3.23Å; Q39-K42 VanDerWaalsContact O-N 3.11Å; Q39-D43 VanDerWaalsContact NE2-CG 3.25Å; Q39-D43 PolarHBondContact NE2-OD1 2.95Å; Q39-D43 PolarHBondContact NE2-OD2 3.33Å; Q39-D43 VanDerWaalsContact O-CG 3.24Å; Q39-D43 PolarHBondContact O-N 3.19Å
40	Y	90.4	Very high	86.3	Confident	133 Å²	133	105 Å²	105	52%	0.522	52%	0.52	S	S	.	.	H	α-helix	trans	-56.5	-44.1	176	179.7	-98.3	0	0	0	112.2	F36 K42 D43 N44	F36-Y40 VanDerWaalsContact O-CB 3.28Å; F36-Y40 WeakPolarHBondContact O-CB 3.25Å; F36-Y40 PolarHBondContact O-N 3.32Å; Y40-K42 PolarHBondContact O-N 3.01Å; Y40-D43 PolarHBondContact O-N 3.44Å; Y40-N44 WeakPolarHBondContact CE1-ND2 3.15Å; Y40-N44 WeakPolarHBondContact O-CB 3.14Å; Y40-N44 PolarHBondContact O-N 2.99Å; Y40-N44 PolarHBondContact O-OD1 3.26Å; Y40-N44 PolarHBondContact OH-ND2 3.31Å; Y40-N44 VanDerWaalsContact OH-ND2 3.08Å
41	A	88.8	Confident	86	Confident	3 Å²	3	103.1 Å²	103.1	3%	0.025	52%	0.523	C	S	.	.	H	α-helix	trans	-63	-41.8	176.5	0	0	0	0	0	112.6	A37 F38 Q39 N44 G45 Q46 V49	A37-A41 VanDerWaalsContact O-CB 3.31Å; A37-A41 WeakPolarHBondContact O-CB 3.44Å; A37-A41 PolarHBondContact O-N 3.44Å; F38-A41 PolarHBondContact O-N 3.49Å; Q39-A41 VanDerWaalsContact C-N 3.3Å; Q39-A41 PolarHBondContact O-N 2.77Å; A41-N44 PolarHBondContact O-N 3.41Å; A41-G45 PolarHBondContact O-N 2.94Å; A41-Q46 HydrophobicContact CB-CB 3.96Å; A41-Q46 VanDerWaalsContact CB-OE1 3.22Å; A41-Q46 WeakPolarHBondContact O-CA 3.5Å; A41-Q46 WeakPolarHBondContact O-CB 3.38Å; A41-Q46 PolarHBondContact O-N 2.94Å; A41-V49 HydrophobicContact CB-CG2 3.08Å
42	K	86.2	Confident	85.5	Confident	157 Å²	157	100.1 Å²	100.1	68%	0.683	53%	0.532	S	S	*	.	H	α-helix	trans	-62.1	-44.3	175.6	-174.9	-179.2	177.9	-177.3	0	111.4	F38 Q39 Y40 N44 G45	F38-K42 WeakPolarHBondContact O-CB 3.45Å; F38-K42 PolarHBondContact O-N 3.23Å; Q39-K42 WeakPolarHBondContact O-CB 3.35Å; Q39-K42 PolarHBondContact O-N 3.23Å; Q39-K42 VanDerWaalsContact O-N 3.11Å; Y40-K42 PolarHBondContact O-N 3.01Å; K42-N44 VanDerWaalsContact C-N 3.3Å; K42-N44 PolarHBondContact O-N 3.08Å; K42-G45 PolarHBondContact O-N 3.26Å; K42-G45 VanDerWaalsContact O-N 3.1Å
43	D	89.8	Confident	84.8	Confident	110 Å²	110	100.9 Å²	100.9	59%	0.588	54%	0.536	S	S	*	.	H	α-helix	trans	-66.9	-33.9	-179.8	-64.5	-24.5	0	0	0	111.7	Q39 Y40 G45	Q39-D43 VanDerWaalsContact NE2-CG 3.25Å; Q39-D43 PolarHBondContact NE2-OD1 2.95Å; Q39-D43 PolarHBondContact NE2-OD2 3.33Å; Q39-D43 VanDerWaalsContact O-CG 3.24Å; Q39-D43 PolarHBondContact O-N 3.19Å; Y40-D43 PolarHBondContact O-N 3.44Å; D43-G45 PolarHBondContact O-N 2.71Å
44	N	89	Confident	84.1	Confident	100 Å²	100	104.8 Å²	104.8	54%	0.535	55%	0.548	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.6	7.5	174.6	-72.7	23.9	0	0	0	113.7	Y40 A41 K42 Q46	Y40-N44 WeakPolarHBondContact CE1-ND2 3.15Å; Y40-N44 WeakPolarHBondContact O-CB 3.14Å; Y40-N44 PolarHBondContact O-N 2.99Å; Y40-N44 PolarHBondContact O-OD1 3.26Å; Y40-N44 PolarHBondContact OH-ND2 3.31Å; Y40-N44 VanDerWaalsContact OH-ND2 3.08Å; A41-N44 PolarHBondContact O-N 3.41Å; K42-N44 VanDerWaalsContact C-N 3.3Å; K42-N44 PolarHBondContact O-N 3.08Å; N44-Q46 PolarHBondContact O-N 2.86Å
45	G	84	Confident	83.2	Confident	58 Å²	58	109.2 Å²	109.2	60%	0.598	57%	0.566	S	S	*	*	T	Hydrogen-bonded Turn	trans	69.3	19.8	179	0	0	0	0	0	114.1	A41 K42 D43 R47	A41-G45 PolarHBondContact O-N 2.94Å; K42-G45 PolarHBondContact O-N 3.26Å; K42-G45 VanDerWaalsContact O-N 3.1Å; D43-G45 PolarHBondContact O-N 2.71Å; G45-R47 PolarHBondContact O-N 3.5Å
46	Q	80.3	Confident	81.9	Confident	121 Å²	121	105.1 Å²	105.1	57%	0.565	56%	0.562	S	S	*	*			trans	-71	118.8	176.8	-154.6	175	15.2	0	0	109.3	A41 N44 S48	A41-Q46 HydrophobicContact CB-CB 3.96Å; A41-Q46 VanDerWaalsContact CB-OE1 3.22Å; A41-Q46 WeakPolarHBondContact O-CA 3.5Å; A41-Q46 WeakPolarHBondContact O-CB 3.38Å; A41-Q46 PolarHBondContact O-N 2.94Å; N44-Q46 PolarHBondContact O-N 2.86Å; Q46-S48 PolarHBondContact O-N 2.68Å
47	R	73.8	Confident	80.9	Confident	254 Å²	254	103 Å²	103	96%	0.958	56%	0.561	S	S	*	*	S	Bend	trans	-68	-22.3	-173.7	-71.1	179.2	-80.3	-161.7	-4.6	114.1	G45	G45-R47 PolarHBondContact O-N 3.5Å
48	S	76.3	Confident	79.8	Confident	82 Å²	82	109 Å²	109	57%	0.573	59%	0.585	S	S	*	*			trans	-155	140.4	-177.9	-177.4	0	0	0	0	110.3	Q46	Q46-S48 PolarHBondContact O-N 2.68Å
49	V	78.6	Confident	78.6	Confident	51 Å²	51	116.4 Å²	116.4	31%	0.309	62%	0.621	S	S	.	*			trans	-123.9	130.2	168.1	176.5	0	0	0	0	106.4	F38 A41	F38-V49 HydrophobicContact CD1-CB 3.63Å; F38-V49 HydrophobicContact CD1-CG1 3.79Å; F38-V49 HydrophobicContact CD1-CG2 4.12Å; F38-V49 HydrophobicContact CE1-CB 3.49Å; F38-V49 VanDerWaalsContact CE1-CB 3.49Å; F38-V49 HydrophobicContact CE1-CG1 3.54Å; F38-V49 HydrophobicContact CE1-CG2 4.46Å; F38-V49 HydrophobicContact CG-CG1 4.49Å; F38-V49 HydrophobicContact CZ-CB 4.43Å; F38-V49 HydrophobicContact CZ-CG1 4.03Å; A41-V49 HydrophobicContact CB-CG2 3.08Å
50	I	80.3	Confident	78	Confident	152 Å²	152	117.7 Å²	117.7	78%	0.779	63%	0.63	S	S	*	*			trans	-97.6	116	177.7	-59.3	170	0	0	0	107.2
51	A	80.5	Confident	77.4	Confident	64 Å²	64	116.8 Å²	116.8	53%	0.529	64%	0.636	S	S	.	*			trans	-96.1	124.7	162	0	0	0	0	0	107.9	F38 P53	F38-A51 HydrophobicContact CE2-CB 4.2Å; F38-A51 HydrophobicContact CZ-CB 3.79Å; A51-P53 VanDerWaalsContact O-CD 3.25Å; A51-P53 WeakPolarHBondContact O-CD 3.49Å
52	A	81.3	Confident	76.7	Confident	92 Å²	92	123.2 Å²	123.2	76%	0.76	67%	0.67	S	S	*	*			trans	-91.8	110.1	173.9	0	0	0	0	0	109
53	P	77.1	Confident	76.2	Confident	71 Å²	71	121.2 Å²	121.2	46%	0.461	67%	0.669	S	S	.	*			trans	-73.9	145.9	173.2	23	-23.5	0	0	0	110.9	A51 N55 S56	A51-P53 VanDerWaalsContact O-CD 3.25Å; A51-P53 WeakPolarHBondContact O-CD 3.49Å; P53-N55 WeakPolarHBondContact CB-OD1 3.42Å; P53-N55 PolarHBondContact O-N 3.47Å; P53-S56 WeakPolarHBondContact CD-OG 3.49Å; P53-S56 WeakPolarHBondContact CG-OG 3.17Å; P53-S56 PolarHBondContact O-N 3.09Å; P53-S56 PolarHBondContact O-OG 3.05Å
54	E	74.4	Confident	75.3	Confident	175 Å²	175	121.9 Å²	121.9	82%	0.818	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.4	-32.7	-179.4	-175.9	-179.8	158.4	0	0	112.2	S56	E54-S56 PolarHBondContact O-N 3.47Å
55	N	70.2	Confident	74.4	Confident	133 Å²	133	123.3 Å²	123.3	71%	0.711	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93	21.7	-178.5	69.5	-15.5	0	0	0	114.2	P53 T57	P53-N55 WeakPolarHBondContact CB-OD1 3.42Å; P53-N55 PolarHBondContact O-N 3.47Å; N55-T57 PolarHBondContact O-N 2.75Å; N55-T57 VanDerWaalsContact O-N 3.09Å
56	S	63	Low	73.7	Confident	70 Å²	70	128 Å²	128	49%	0.49	69%	0.69	S	S	.	*			trans	-68	-4.1	177.9	-53.7	0	0	0	0	113.8	P53 E54 L58	P53-S56 WeakPolarHBondContact CD-OG 3.49Å; P53-S56 WeakPolarHBondContact CG-OG 3.17Å; P53-S56 PolarHBondContact O-N 3.09Å; P53-S56 PolarHBondContact O-OG 3.05Å; E54-S56 PolarHBondContact O-N 3.47Å; S56-L58 PolarHBondContact O-N 3.24Å
57	T	67.8	Low	73.2	Confident	104 Å²	104	128.5 Å²	128.5	64%	0.638	70%	0.699	S	S	*	*			trans	-69.2	95.5	174.1	-10.9	0	0	0	0	108.7	N55 H59	N55-T57 PolarHBondContact O-N 2.75Å; N55-T57 VanDerWaalsContact O-N 3.09Å; T57-H59 PolarHBondContact O-N 3.03Å
58	L	67.3	Low	73.2	Confident	173 Å²	173	118.1 Å²	118.1	91%	0.906	68%	0.678	S	S	*	*			trans	-53.2	109.8	165.7	-63.5	166.6	0	0	0	107.7	S56	S56-L58 PolarHBondContact O-N 3.24Å
59	H	61.4	Low	72.9	Confident	250 Å²	250	121.4 Å²	121.4	100%	1.157	69%	0.687	S	S	*	*			trans	-81.1	0	165.2	-75.3	-77.5	0	0	0	109.9	T57	T57-H59 PolarHBondContact O-N 3.03Å

Retrieved 59 of 59 residues in 62.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).