A0A3Q0KVC2_SCHMA Loading...

Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5

AlphaFold DB , UniProt , Accession A0A3Q0KVC2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 89 aa.

						>A0A3Q0KVC2_SCHMA|A0A3Q0KVC2
METKLLGNLSRVSSNPKVTAVQCIDSDGLCIASHGTVNDQTAGVLSSIYKHAAGIEESSESPVLIIEFESKSSILCEVYGVLTVVHKNQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.4	Confident	92.6	Very high	218 Å²	218	98.5 Å²	98.5	100%	1.074	50%	0.496	S	S	*	.				0	-52.4	0	-167.6	168.4	-179.8	0	0	110.1	T3 K4	M1-T3 VanDerWaalsContact C-N 3.3Å; M1-T3 PolarHBondContact O-N 3.13Å; M1-K4 PolarHBondContact O-N 3.5Å; M1-K4 VanDerWaalsContact O-N 3.11Å
2	E	86.1	Confident	93	Very high	128 Å²	128	95.8 Å²	95.8	60%	0.598	49%	0.488	S	S	*	.	H	α-helix	trans	-53.7	-38.4	175.1	-164.9	179.2	169	0	0	114.4	K4 L5 L6	E2-K4 PolarHBondContact O-N 3.48Å; E2-K4 VanDerWaalsContact O-N 3.13Å; E2-L5 WeakPolarHBondContact O-CA 3.49Å; E2-L5 WeakPolarHBondContact O-CB 3.44Å; E2-L5 PolarHBondContact O-N 3.11Å; E2-L6 HydrophobicContact CG-CD1 4.03Å; E2-L6 HydrophobicContact CG-CG 4.25Å; E2-L6 WeakPolarHBondContact O-CG 3.27Å; E2-L6 PolarHBondContact O-N 3.28Å
3	T	91.5	Very high	93.1	Very high	120 Å²	120	90.2 Å²	90.2	74%	0.736	46%	0.463	S	S	*	.	H	α-helix	trans	-54.4	-36.4	176.7	-39.4	0	0	0	0	113.2	M1 G7	M1-T3 VanDerWaalsContact C-N 3.3Å; M1-T3 PolarHBondContact O-N 3.13Å; T3-G7 PolarHBondContact O-N 2.98Å
4	K	95.7	Very high	93.3	Very high	161 Å²	161	90.1 Å²	90.1	70%	0.7	47%	0.474	S	S	*	.	H	α-helix	trans	-74.1	-37.8	178.7	-169.3	177.4	-178.7	-177.2	0	111.3	M1 E2 G7 N8	M1-K4 PolarHBondContact O-N 3.5Å; M1-K4 VanDerWaalsContact O-N 3.11Å; E2-K4 PolarHBondContact O-N 3.48Å; E2-K4 VanDerWaalsContact O-N 3.13Å; K4-G7 PolarHBondContact O-N 3.14Å; K4-N8 VanDerWaalsContact O-CG 3.31Å; K4-N8 PolarHBondContact O-N 3.34Å; K4-N8 PolarHBondContact O-ND2 3.47Å
5	L	95	Very high	93.5	Very high	55 Å²	55	89.5 Å²	89.5	29%	0.288	47%	0.472	S	S	.	.	H	α-helix	trans	-63.7	-51.9	174.8	177.5	59.4	0	0	0	110.5	E2 G7 N8 L9 I31 A32	E2-L5 WeakPolarHBondContact O-CA 3.49Å; E2-L5 WeakPolarHBondContact O-CB 3.44Å; E2-L5 PolarHBondContact O-N 3.11Å; L5-G7 VanDerWaalsContact C-N 3.28Å; L5-G7 PolarHBondContact O-N 2.65Å; L5-N8 WeakPolarHBondContact O-CA 3.5Å; L5-N8 WeakPolarHBondContact O-CB 3.44Å; L5-N8 PolarHBondContact O-N 2.98Å; L5-L9 HydrophobicContact CD1-CG 4.37Å; L5-L9 HydrophobicContact CG-CD1 4.45Å; L5-L9 WeakPolarHBondContact O-CG 3.45Å; L5-L9 PolarHBondContact O-N 3.5Å; L5-I31 HydrophobicContact CD2-CG2 4.02Å; L5-A32 HydrophobicContact CD2-CB 3.75Å; L5-A32 HydrophobicContact CG-CB 4.23Å
6	L	95.6	Very high	93.6	Very high	67 Å²	67	92.1 Å²	92.1	35%	0.351	50%	0.495	S	S	.	.	H	α-helix	trans	-59.1	-39.7	177.4	-66.3	173.6	0	0	0	112	E2 N8 L9 S10 A32	E2-L6 HydrophobicContact CG-CD1 4.03Å; E2-L6 HydrophobicContact CG-CG 4.25Å; E2-L6 WeakPolarHBondContact O-CG 3.27Å; E2-L6 PolarHBondContact O-N 3.28Å; L6-N8 VanDerWaalsContact C-N 3.32Å; L6-N8 PolarHBondContact O-N 3.33Å; L6-L9 PolarHBondContact O-N 2.88Å; L6-S10 WeakPolarHBondContact O-CB 3.48Å; L6-S10 PolarHBondContact O-N 3Å; L6-S10 PolarHBondContact O-OG 2.89Å; L6-A32 HydrophobicContact CD2-CB 4.17Å
7	G	97	Very high	93.8	Very high	28 Å²	28	92.8 Å²	92.8	29%	0.289	49%	0.493	S	S	.	.	H	α-helix	trans	-65	-31.5	173.6	0	0	0	0	0	113.9	T3 K4 L5 S10 R11	T3-G7 PolarHBondContact O-N 2.98Å; K4-G7 PolarHBondContact O-N 3.14Å; L5-G7 VanDerWaalsContact C-N 3.28Å; L5-G7 PolarHBondContact O-N 2.65Å; G7-S10 PolarHBondContact O-OG 3.39Å; G7-R11 WeakPolarHBondContact O-CD 3.49Å; G7-R11 VanDerWaalsContact O-CG 3.24Å; G7-R11 WeakPolarHBondContact O-CG 3.24Å; G7-R11 PolarHBondContact O-N 3.01Å
8	N	96.5	Very high	94	Very high	72 Å²	72	88.6 Å²	88.6	39%	0.385	47%	0.471	S	S	.	.	H	α-helix	trans	-74.9	-41.8	173	-73.3	-21	0	0	0	111.5	K4 L5 L6 S10 R11 V12	K4-N8 VanDerWaalsContact O-CG 3.31Å; K4-N8 PolarHBondContact O-N 3.34Å; K4-N8 PolarHBondContact O-ND2 3.47Å; L5-N8 WeakPolarHBondContact O-CA 3.5Å; L5-N8 WeakPolarHBondContact O-CB 3.44Å; L5-N8 PolarHBondContact O-N 2.98Å; L6-N8 VanDerWaalsContact C-N 3.32Å; L6-N8 PolarHBondContact O-N 3.33Å; N8-S10 VanDerWaalsContact C-N 3.33Å; N8-S10 PolarHBondContact O-N 2.85Å; N8-R11 WeakPolarHBondContact O-CB 3.39Å; N8-R11 PolarHBondContact O-N 2.94Å; N8-V12 WeakPolarHBondContact O-CG2 3.47Å; N8-V12 PolarHBondContact O-N 2.99Å
9	L	97	Very high	94.1	Very high	7 Å²	7	87.5 Å²	87.5	4%	0.037	47%	0.468	C	S	.	.	H	α-helix	trans	-60.4	-43.4	175.9	-66	-176.9	0	0	0	111.4	L5 L6 R11 V12 S13 V21 A32 H34	L5-L9 HydrophobicContact CD1-CG 4.37Å; L5-L9 HydrophobicContact CG-CD1 4.45Å; L5-L9 WeakPolarHBondContact O-CG 3.45Å; L5-L9 PolarHBondContact O-N 3.5Å; L6-L9 PolarHBondContact O-N 2.88Å; L9-R11 VanDerWaalsContact C-N 3.32Å; L9-R11 PolarHBondContact O-N 2.85Å; L9-V12 PolarHBondContact O-N 3.5Å; L9-S13 WeakPolarHBondContact O-CB 3.48Å; L9-S13 PolarHBondContact O-N 2.99Å; L9-S13 PolarHBondContact O-OG 3.12Å; L9-V21 HydrophobicContact CD2-CB 4.2Å; L9-V21 HydrophobicContact CD2-CG1 3.62Å; L9-A32 HydrophobicContact CD1-CB 3.7Å; L9-H34 HydrophobicContact CB-CB 3.9Å
10	S	96.2	Very high	94.2	Very high	44 Å²	44	83.2 Å²	83.2	31%	0.308	45%	0.445	S	S	.	.	H	α-helix	trans	-61.3	-41.2	177.4	72.2	0	0	0	0	111.7	L6 G7 N8 V12 S13 S14	L6-S10 WeakPolarHBondContact O-CB 3.48Å; L6-S10 PolarHBondContact O-N 3Å; L6-S10 PolarHBondContact O-OG 2.89Å; G7-S10 PolarHBondContact O-OG 3.39Å; N8-S10 VanDerWaalsContact C-N 3.33Å; N8-S10 PolarHBondContact O-N 2.85Å; S10-V12 PolarHBondContact O-N 3.09Å; S10-S13 WeakPolarHBondContact CA-OG 3.41Å; S10-S13 CarbonylContact O-C 3.57Å; S10-S13 PolarHBondContact O-N 3.47Å; S10-S13 PolarHBondContact O-OG 2.82Å; S10-S14 PolarHBondContact O-N 3.37Å
11	R	97.2	Very high	94.4	Very high	184 Å²	184	79.2 Å²	79.2	69%	0.694	42%	0.424	S	S	*	.	H	α-helix	trans	-64	-33.8	174.9	-72.6	172.8	68.6	-165.7	2.5	113.8	G7 N8 L9 S14	G7-R11 WeakPolarHBondContact O-CD 3.49Å; G7-R11 VanDerWaalsContact O-CG 3.24Å; G7-R11 WeakPolarHBondContact O-CG 3.24Å; G7-R11 PolarHBondContact O-N 3.01Å; N8-R11 WeakPolarHBondContact O-CB 3.39Å; N8-R11 PolarHBondContact O-N 2.94Å; L9-R11 VanDerWaalsContact C-N 3.32Å; L9-R11 PolarHBondContact O-N 2.85Å; R11-S14 PolarHBondContact O-OG 2.96Å
12	V	96.5	Very high	95.6	Very high	66 Å²	66	68.9 Å²	68.9	40%	0.4	37%	0.373	S	S	.	.	H	α-helix	trans	-71.8	-44.3	173.8	177.8	0	0	0	0	109.7	N8 L9 S10 S14 N15 V21 V85	N8-V12 WeakPolarHBondContact O-CG2 3.47Å; N8-V12 PolarHBondContact O-N 2.99Å; L9-V12 PolarHBondContact O-N 3.5Å; S10-V12 PolarHBondContact O-N 3.09Å; V12-S14 PolarHBondContact O-N 2.9Å; V12-N15 WeakPolarHBondContact O-CB 3.3Å; V12-N15 PolarHBondContact O-N 3.15Å; V12-V21 HydrophobicContact CB-CG2 4Å; V12-V21 HydrophobicContact CG1-CG1 4.43Å; V12-V21 HydrophobicContact CG1-CG2 3.6Å; V12-V85 HydrophobicContact CG1-CG1 4.48Å; V12-V85 HydrophobicContact CG1-CG2 4.27Å
13	S	95.2	Very high	96.1	Very high	22 Å²	22	63.1 Å²	63.1	15%	0.154	35%	0.347	C	S	.	.	H	α-helix	trans	-68.5	-16.1	179.8	76.5	0	0	0	0	114.3	L9 S10 N15 H34	L9-S13 WeakPolarHBondContact O-CB 3.48Å; L9-S13 PolarHBondContact O-N 2.99Å; L9-S13 PolarHBondContact O-OG 3.12Å; S10-S13 WeakPolarHBondContact CA-OG 3.41Å; S10-S13 CarbonylContact O-C 3.57Å; S10-S13 PolarHBondContact O-N 3.47Å; S10-S13 PolarHBondContact O-OG 2.82Å; S13-N15 PolarHBondContact O-N 3.25Å; S13-H34 WeakPolarHBondContact CB-ND1 3.43Å; S13-H34 PolarHBondContact OG-CE1 2.83Å; S13-H34 PolarHBondContact OG-ND1 2.82Å
14	S	95.8	Very high	96.4	Very high	90 Å²	90	57.4 Å²	57.4	63%	0.629	31%	0.312	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.6	-8.1	175.4	65.5	0	0	0	0	113.3	S10 R11 V12	S10-S14 PolarHBondContact O-N 3.37Å; R11-S14 PolarHBondContact O-OG 2.96Å; V12-S14 PolarHBondContact O-N 2.9Å
15	N	96.3	Very high	96.4	Very high	81 Å²	81	51.7 Å²	51.7	43%	0.433	29%	0.289	S	S	.	.	S	Bend	trans	-68	127.1	169.6	-174.9	-57.4	0	0	0	109.5	V12 S13 K17 V18	V12-N15 WeakPolarHBondContact O-CB 3.3Å; V12-N15 PolarHBondContact O-N 3.15Å; S13-N15 PolarHBondContact O-N 3.25Å; N15-K17 PolarHBondContact O-N 2.69Å; N15-K17 PolarHBondContact OD1-N 2.91Å; N15-K17 VanDerWaalsContact OD1-N 3.1Å; N15-V18 HydrophobicContact CB-CB 4.21Å; N15-V18 HydrophobicContact CB-CG2 3.74Å; N15-V18 PolarHBondContact O-N 3.49Å
16	P	95.2	Very high	96.4	Very high	131 Å²	131	52.4 Å²	52.4	85%	0.851	30%	0.298	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.1	-24.9	-173.3	-27.3	34.3	0	0	0	115.8
17	K	96.1	Very high	96.4	Very high	104 Å²	104	55.4 Å²	55.4	45%	0.452	32%	0.315	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.6	-14.7	178.4	-68.3	-165.1	175.1	-160.8	0	113.4	N15 K87 N88 Q89	N15-K17 PolarHBondContact O-N 2.69Å; N15-K17 PolarHBondContact OD1-N 2.91Å; N15-K17 VanDerWaalsContact OD1-N 3.1Å; K17-K87 CarbonylContact O-C 3.39Å; K17-K87 WeakPolarHBondContact O-CA 3.47Å; K17-N88 PolarHBondContact O-N 3.46Å; K17-Q89 PolarHBondContact NZ-OXT 3.35Å
18	V	97.5	Very high	96.4	Very high	17 Å²	17	54.4 Å²	54.4	10%	0.103	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	121.1	-179.4	176.5	0	0	0	0	108.8	N15 V21 V85 H86 K87	N15-V18 HydrophobicContact CB-CB 4.21Å; N15-V18 HydrophobicContact CB-CG2 3.74Å; N15-V18 PolarHBondContact O-N 3.49Å; V18-V21 HydrophobicContact CG1-CG2 3.64Å; V18-V85 HydrophobicContact CG1-CG1 3.89Å; V18-V85 HydrophobicContact CG2-CG1 3.81Å; V18-H86 CarbonylContact C-O 3.55Å; V18-H86 WeakPolarHBondContact CA-O 3.21Å; V18-K87 HydrophobicContact CG2-CD 4.42Å; V18-K87 HydrophobicContact CG2-CG 3.99Å
19	T	96.3	Very high	96.3	Very high	67 Å²	67	56.2 Å²	56.2	41%	0.411	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.7	-30.4	-179.3	52.4	0	0	0	0	112.3	H86 N88	T19-H86 PolarHBondContact N-O 2.85Å; T19-H86 PolarHBondContact OG1-O 2.83Å; T19-N88 WeakPolarHBondContact CG2-ND2 3.45Å
20	A	97	Very high	96.3	Very high	1 Å²	1	57.8 Å²	57.8	1%	0.008	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-160.2	158	174.7	0	0	0	0	0	112.1	H34 V37 H86	A20-H34 CarbonylContact C-O 3.57Å; A20-H34 VanDerWaalsContact CA-O 3.23Å; A20-H34 WeakPolarHBondContact CA-O 3.49Å; A20-V37 HydrophobicContact CB-CG1 3.65Å; A20-H86 HydrophobicContact CB-CB 4.34Å; A20-H86 PolarHBondContact O-N 2.8Å
21	V	97.5	Very high	96.2	Very high	1 Å²	1	59.4 Å²	59.4	1%	0.006	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.4	139.5	172.5	-169.2	0	0	0	0	108.5	L9 V12 V18 S33 H34 T83 V84 V85	L9-V21 HydrophobicContact CD2-CB 4.2Å; L9-V21 HydrophobicContact CD2-CG1 3.62Å; V12-V21 HydrophobicContact CB-CG2 4Å; V12-V21 HydrophobicContact CG1-CG1 4.43Å; V12-V21 HydrophobicContact CG1-CG2 3.6Å; V18-V21 HydrophobicContact CG1-CG2 3.64Å; V21-S33 CarbonylContact O-C 3.59Å; V21-S33 VanDerWaalsContact O-CA 3.22Å; V21-S33 WeakPolarHBondContact O-CA 3.49Å; V21-H34 PolarHBondContact N-O 2.65Å; V21-H34 PolarHBondContact O-N 3.36Å; V21-T83 HydrophobicContact CG1-CG2 4.19Å; V21-V84 CarbonylContact C-O 3.59Å; V21-V84 VanDerWaalsContact CA-O 3.29Å; V21-V84 WeakPolarHBondContact CA-O 3.42Å; V21-V85 HydrophobicContact CG1-CG2 4.2Å; V21-V85 HydrophobicContact CG2-CG1 4.49Å
22	Q	96.7	Very high	96.1	Very high	0 Å²	0	51 Å²	51	0%	0	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.2	147.3	173	56.6	-179.2	-38	0	0	111.5	I24 A32 V37 V84 H86	Q22-I24 HydrophobicContact CG-CD1 4.39Å; Q22-I24 HydrophobicContact CG-CG1 4.45Å; Q22-A32 CarbonylContact C-O 3.58Å; Q22-A32 WeakPolarHBondContact CA-O 3.47Å; Q22-V37 HydrophobicContact CB-CG1 4.31Å; Q22-V37 HydrophobicContact CG-CG1 4.3Å; Q22-V84 HydrophobicContact CG-CB 3.79Å; Q22-V84 HydrophobicContact CG-CG2 4.21Å; Q22-V84 PolarHBondContact N-O 2.84Å; Q22-V84 PolarHBondContact O-N 3.41Å; Q22-H86 PolarHBondContact NE2-NE2 3.25Å
23	C	96.9	Very high	96.1	Very high	8 Å²	8	49.9 Å²	49.9	5%	0.054	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	131.5	170.5	-69.2	0	0	0	0	108.8	I31 A32 V81 L82	C23-I31 HydrophobicContact CB-CB 4.32Å; C23-I31 PolarHBondContact O-N 3.07Å; C23-A32 PolarHBondContact N-O 2.95Å; C23-V81 HydrophobicContact CB-CG1 3.87Å; C23-L82 CarbonylContact C-O 3.58Å; C23-L82 WeakPolarHBondContact CA-O 3.5Å
24	I	97.6	Very high	96.1	Very high	0 Å²	0	52.7 Å²	52.7	0%	0	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	136.1	-175.2	-55.3	165.9	0	0	0	107.8	Q22 L29 A42 L45 L82 V84	Q22-I24 HydrophobicContact CG-CD1 4.39Å; Q22-I24 HydrophobicContact CG-CG1 4.45Å; I24-L29 CarbonylContact C-O 3.59Å; I24-L29 VanDerWaalsContact CA-O 3.3Å; I24-L29 WeakPolarHBondContact CA-O 3.38Å; I24-A42 HydrophobicContact CD1-CB 3.94Å; I24-A42 HydrophobicContact CG1-CB 3.94Å; I24-A42 HydrophobicContact CG2-CB 4.12Å; I24-L45 HydrophobicContact CD1-CB 4.07Å; I24-L45 HydrophobicContact CD1-CD1 4.31Å; I24-L82 HydrophobicContact CB-CB 4.26Å; I24-L82 HydrophobicContact CD1-CD2 4.35Å; I24-L82 PolarHBondContact N-O 3.1Å; I24-L82 PolarHBondContact O-N 2.89Å; I24-V84 HydrophobicContact CD1-CG2 3.68Å
25	D	96.2	Very high	96	Very high	40 Å²	40	50.5 Å²	50.5	21%	0.214	30%	0.297	C	S	.	.			trans	-80.3	179.9	176.8	68.3	19.4	0	0	0	113.1	D27 G28 L29 I31	D25-D27 PolarHBondContact O-N 3.46Å; D25-D27 WeakPolarHBondContact OD1-CA 3.43Å; D25-D27 PolarHBondContact OD1-N 2.79Å; D25-G28 PolarHBondContact O-N 2.91Å; D25-G28 VanDerWaalsContact O-N 3.15Å; D25-G28 PolarHBondContact OD1-N 2.92Å; D25-L29 PolarHBondContact N-O 3.4Å; D25-L29 PolarHBondContact OD1-N 3.17Å; D25-L29 WeakPolarHBondContact OD2-CB 3.29Å; D25-I31 HydrophobicContact CB-CD1 3.94Å; D25-I31 HydrophobicContact CB-CG1 4.01Å
26	S	94.9	Very high	95.7	Very high	70 Å²	70	53.3 Å²	53.3	49%	0.49	32%	0.317	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.3	-19.7	178.3	55	0	0	0	0	114	K50 G80	S26-K50 WeakPolarHBondContact O-CE 3.37Å; S26-K50 PolarHBondContact O-NZ 3.44Å; S26-G80 PolarHBondContact N-O 3.24Å
27	D	95.3	Very high	95.4	Very high	131 Å²	131	48.5 Å²	48.5	70%	0.701	29%	0.285	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.8	-4	178.8	-63.6	-38	0	0	0	112.1	D25 L29	D25-D27 PolarHBondContact O-N 3.46Å; D25-D27 WeakPolarHBondContact OD1-CA 3.43Å; D25-D27 PolarHBondContact OD1-N 2.79Å; D27-L29 HydrophobicContact CB-CG 4.49Å
28	G	96	Very high	95.1	Very high	7 Å²	7	47.6 Å²	47.6	7%	0.072	29%	0.285	C	S	.	.	S	Bend	trans	86.6	18.2	179.4	0	0	0	0	0	113.5	D25 A42 G43	D25-G28 PolarHBondContact O-N 2.91Å; D25-G28 VanDerWaalsContact O-N 3.15Å; D25-G28 PolarHBondContact OD1-N 2.92Å; G28-A42 CarbonylContact O-C 3.56Å; G28-A42 WeakPolarHBondContact O-CB 3.37Å; G28-G43 PolarHBondContact O-N 2.82Å; G28-G43 VanDerWaalsContact O-N 3.15Å
29	L	95.6	Very high	94.4	Very high	109 Å²	109	51.8 Å²	51.8	57%	0.571	31%	0.307	S	S	*	.			trans	-93	141.4	176.5	-54.7	173.8	0	0	0	110.6	I24 D25 D27 I31	I24-L29 CarbonylContact C-O 3.59Å; I24-L29 VanDerWaalsContact CA-O 3.3Å; I24-L29 WeakPolarHBondContact CA-O 3.38Å; D25-L29 PolarHBondContact N-O 3.4Å; D25-L29 PolarHBondContact OD1-N 3.17Å; D25-L29 WeakPolarHBondContact OD2-CB 3.29Å; D27-L29 HydrophobicContact CB-CG 4.49Å; L29-I31 PolarHBondContact O-N 2.78Å
30	C	95.4	Very high	94	Very high	41 Å²	41	56.4 Å²	56.4	28%	0.277	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.7	122	175.1	-168.2	0	0	0	0	109.9	A42	C30-A42 HydrophobicContact CB-CB 4.38Å
31	I	94.9	Very high	93.8	Very high	77 Å²	77	58.8 Å²	58.8	40%	0.395	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.5	-48.1	174.4	-58.9	168.8	0	0	0	109.8	L5 C23 D25 L29 V81	L5-I31 HydrophobicContact CD2-CG2 4.02Å; C23-I31 HydrophobicContact CB-CB 4.32Å; C23-I31 PolarHBondContact O-N 3.07Å; D25-I31 HydrophobicContact CB-CD1 3.94Å; D25-I31 HydrophobicContact CB-CG1 4.01Å; L29-I31 PolarHBondContact O-N 2.78Å; I31-V81 HydrophobicContact CD1-CG1 3.98Å; I31-V81 HydrophobicContact CD1-CG2 4.04Å
32	A	95.3	Very high	93.7	Very high	9 Å²	9	58.8 Å²	58.8	7%	0.074	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.7	150.7	-178.4	0	0	0	0	0	110.2	L5 L6 L9 Q22 C23	L5-A32 HydrophobicContact CD2-CB 3.75Å; L5-A32 HydrophobicContact CG-CB 4.23Å; L6-A32 HydrophobicContact CD2-CB 4.17Å; L9-A32 HydrophobicContact CD1-CB 3.7Å; Q22-A32 CarbonylContact C-O 3.58Å; Q22-A32 WeakPolarHBondContact CA-O 3.47Å; C23-A32 PolarHBondContact N-O 2.95Å
33	S	95.8	Very high	93.7	Very high	42 Å²	42	60.6 Å²	60.6	29%	0.294	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	160.2	176.2	63.1	0	0	0	0	111.9	V21 V37	V21-S33 CarbonylContact O-C 3.59Å; V21-S33 VanDerWaalsContact O-CA 3.22Å; V21-S33 WeakPolarHBondContact O-CA 3.49Å; S33-V37 WeakPolarHBondContact OG-CG2 3.26Å
34	H	96.2	Very high	93.7	Very high	81 Å²	81	64.3 Å²	64.3	38%	0.375	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.2	128.3	170.8	-167.1	-78.2	0	0	0	109.3	L9 S13 A20 V21	L9-H34 HydrophobicContact CB-CB 3.9Å; S13-H34 WeakPolarHBondContact CB-ND1 3.43Å; S13-H34 PolarHBondContact OG-CE1 2.83Å; S13-H34 PolarHBondContact OG-ND1 2.82Å; A20-H34 CarbonylContact C-O 3.57Å; A20-H34 VanDerWaalsContact CA-O 3.23Å; A20-H34 WeakPolarHBondContact CA-O 3.49Å; V21-H34 PolarHBondContact N-O 2.65Å; V21-H34 PolarHBondContact O-N 3.36Å
35	G	94.2	Very high	93.7	Very high	44 Å²	44	65.1 Å²	65.1	45%	0.454	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	95.6	-173.7	-168.6	0	0	0	0	0	112.4	V37	G35-V37 PolarHBondContact O-N 3.17Å
36	T	88.5	Confident	93.7	Very high	139 Å²	139	63.5 Å²	63.5	85%	0.853	38%	0.376	S	S	*	.	S	Bend	trans	-86.8	103.3	-177.4	-51.4	0	0	0	0	110.3
37	V	90.3	Very high	93.8	Very high	31 Å²	31	62.7 Å²	62.7	19%	0.188	37%	0.37	C	S	.	.			trans	-117.9	153.1	170.8	-68.9	0	0	0	0	110.7	A20 Q22 S33 G35	A20-V37 HydrophobicContact CB-CG1 3.65Å; Q22-V37 HydrophobicContact CB-CG1 4.31Å; Q22-V37 HydrophobicContact CG-CG1 4.3Å; S33-V37 WeakPolarHBondContact OG-CG2 3.26Å; G35-V37 PolarHBondContact O-N 3.17Å
38	N	88.5	Confident	93.9	Very high	85 Å²	85	59.9 Å²	59.9	46%	0.455	35%	0.354	S	S	.	.			trans	-99.7	111.7	167.1	177.6	-2.8	0	0	0	108.2	Q40 T41	N38-Q40 PolarHBondContact O-N 3.23Å; N38-Q40 VanDerWaalsContact O-N 3.08Å; N38-Q40 VanDerWaalsContact OD1-CB 3.3Å; N38-Q40 WeakPolarHBondContact OD1-CB 3.38Å; N38-Q40 WeakPolarHBondContact OD1-CG 3.37Å; N38-Q40 PolarHBondContact OD1-N 3.43Å; N38-T41 HydrophobicContact CB-CG2 4.01Å; N38-T41 WeakPolarHBondContact O-CB 3.44Å; N38-T41 PolarHBondContact O-N 3.16Å; N38-T41 PolarHBondContact O-OG1 3.15Å
39	D	83.7	Confident	94	Very high	105 Å²	105	60.1 Å²	60.1	56%	0.561	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.8	-25.8	-177.5	-61	-19.1	0	0	0	113	T41 A42	D39-T41 PolarHBondContact O-N 3.36Å; D39-T41 VanDerWaalsContact O-N 3.16Å; D39-A42 WeakPolarHBondContact O-CB 3.34Å; D39-A42 PolarHBondContact O-N 2.97Å
40	Q	86.4	Confident	94	Very high	163 Å²	163	60.2 Å²	60.2	76%	0.762	35%	0.349	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.6	-18.4	175.4	-60.4	-178.6	-30.2	0	0	113	N38	N38-Q40 PolarHBondContact O-N 3.23Å; N38-Q40 VanDerWaalsContact O-N 3.08Å; N38-Q40 VanDerWaalsContact OD1-CB 3.3Å; N38-Q40 WeakPolarHBondContact OD1-CB 3.38Å; N38-Q40 WeakPolarHBondContact OD1-CG 3.37Å; N38-Q40 PolarHBondContact OD1-N 3.43Å
41	T	93.7	Very high	94	Very high	51 Å²	51	64.8 Å²	64.8	31%	0.313	37%	0.366	S	S	.	.	H	α-helix	trans	-81.7	-17	178.7	66.2	0	0	0	0	113	N38 D39 G43 V44 L45	N38-T41 HydrophobicContact CB-CG2 4.01Å; N38-T41 WeakPolarHBondContact O-CB 3.44Å; N38-T41 PolarHBondContact O-N 3.16Å; N38-T41 PolarHBondContact O-OG1 3.15Å; D39-T41 PolarHBondContact O-N 3.36Å; D39-T41 VanDerWaalsContact O-N 3.16Å; T41-G43 PolarHBondContact O-N 3Å; T41-V44 PolarHBondContact O-N 3.37Å; T41-V44 VanDerWaalsContact O-N 3.1Å; T41-L45 WeakPolarHBondContact O-CG 3.37Å; T41-L45 PolarHBondContact O-N 2.92Å
42	A	96.4	Very high	94	Very high	1 Å²	1	62.1 Å²	62.1	1%	0.008	36%	0.356	C	S	.	.	H	α-helix	trans	-58.3	-45.9	-175.6	0	0	0	0	0	112.3	I24 G28 C30 D39 V44 L45 S46	I24-A42 HydrophobicContact CD1-CB 3.94Å; I24-A42 HydrophobicContact CG1-CB 3.94Å; I24-A42 HydrophobicContact CG2-CB 4.12Å; G28-A42 CarbonylContact O-C 3.56Å; G28-A42 WeakPolarHBondContact O-CB 3.37Å; C30-A42 HydrophobicContact CB-CB 4.38Å; D39-A42 WeakPolarHBondContact O-CB 3.34Å; D39-A42 PolarHBondContact O-N 2.97Å; A42-V44 VanDerWaalsContact C-N 3.34Å; A42-V44 PolarHBondContact O-N 3.49Å; A42-L45 PolarHBondContact O-N 2.87Å; A42-S46 WeakPolarHBondContact O-CB 3.22Å; A42-S46 PolarHBondContact O-N 2.87Å
43	G	96	Very high	93.9	Very high	38 Å²	38	63.7 Å²	63.7	39%	0.392	37%	0.368	S	S	.	.	H	α-helix	trans	-63.6	-38.1	176.7	0	0	0	0	0	113	G28 T41 S47	G28-G43 PolarHBondContact O-N 2.82Å; G28-G43 VanDerWaalsContact O-N 3.15Å; T41-G43 PolarHBondContact O-N 3Å; G43-S47 WeakPolarHBondContact O-CB 3.48Å; G43-S47 PolarHBondContact O-N 3.43Å
44	V	96.6	Very high	93.8	Very high	87 Å²	87	64.6 Å²	64.6	53%	0.527	39%	0.385	S	S	.	.	H	α-helix	trans	-66.2	-48	177	178.7	0	0	0	0	110.5	T41 A42 S46 S47 I48	T41-V44 PolarHBondContact O-N 3.37Å; T41-V44 VanDerWaalsContact O-N 3.1Å; A42-V44 VanDerWaalsContact C-N 3.34Å; A42-V44 PolarHBondContact O-N 3.49Å; V44-S46 PolarHBondContact O-N 2.97Å; V44-S47 PolarHBondContact O-N 3.34Å; V44-I48 HydrophobicContact CG1-CD1 3.86Å; V44-I48 HydrophobicContact CG1-CG1 4.42Å; V44-I48 VanDerWaalsContact O-CG1 3.3Å; V44-I48 WeakPolarHBondContact O-CG1 3.23Å; V44-I48 PolarHBondContact O-N 3.3Å
45	L	97.5	Very high	93.6	Very high	16 Å²	16	67.2 Å²	67.2	8%	0.084	40%	0.4	C	S	.	.	H	α-helix	trans	-62.4	-43	179.3	-69.2	165.8	0	0	0	111.7	I24 T41 A42 I48 Y49 I66 L75 V84	I24-L45 HydrophobicContact CD1-CB 4.07Å; I24-L45 HydrophobicContact CD1-CD1 4.31Å; T41-L45 WeakPolarHBondContact O-CG 3.37Å; T41-L45 PolarHBondContact O-N 2.92Å; A42-L45 PolarHBondContact O-N 2.87Å; L45-I48 PolarHBondContact O-N 2.96Å; L45-Y49 WeakPolarHBondContact O-CB 3.49Å; L45-Y49 PolarHBondContact O-N 3.49Å; L45-I66 HydrophobicContact CD2-CD1 4.15Å; L45-L75 HydrophobicContact CB-CD2 4.13Å; L45-L75 HydrophobicContact CD2-CD1 4.39Å; L45-L75 HydrophobicContact CD2-CD2 4.07Å; L45-V84 HydrophobicContact CD1-CG1 4.25Å; L45-V84 HydrophobicContact CD1-CG2 4.28Å
46	S	97	Very high	93.4	Very high	6 Å²	6	72.1 Å²	72.1	4%	0.042	41%	0.411	C	S	.	.	H	α-helix	trans	-60.8	-44.3	174.1	-178.8	0	0	0	0	111.7	A42 V44 Y49 K50	A42-S46 WeakPolarHBondContact O-CB 3.22Å; A42-S46 PolarHBondContact O-N 2.87Å; V44-S46 PolarHBondContact O-N 2.97Å; S46-Y49 PolarHBondContact O-N 3.4Å; S46-K50 WeakPolarHBondContact O-CB 3.33Å; S46-K50 VanDerWaalsContact O-CG 3.29Å; S46-K50 WeakPolarHBondContact O-CG 3.45Å; S46-K50 PolarHBondContact O-N 2.91Å; S46-K50 WeakPolarHBondContact OG-CE 3.44Å
47	S	96.9	Very high	93.1	Very high	54 Å²	54	75.7 Å²	75.7	38%	0.378	42%	0.418	S	S	.	.	H	α-helix	trans	-62.9	-47.5	177.2	-173.7	0	0	0	0	112.2	G43 V44 Y49 K50 H51	G43-S47 WeakPolarHBondContact O-CB 3.48Å; G43-S47 PolarHBondContact O-N 3.43Å; V44-S47 PolarHBondContact O-N 3.34Å; S47-Y49 VanDerWaalsContact C-N 3.31Å; S47-Y49 PolarHBondContact O-N 3.38Å; S47-K50 PolarHBondContact O-N 2.78Å; S47-H51 PolarHBondContact O-N 3.2Å; S47-H51 PolarHBondContact O-ND1 3.02Å; S47-H51 PolarHBondContact OG-CE1 3.38Å
48	I	97	Very high	92.9	Very high	72 Å²	72	77.3 Å²	77.3	37%	0.369	43%	0.43	S	S	.	.	H	α-helix	trans	-58.3	-46.5	177.4	-66.5	167.7	0	0	0	110.1	V44 L45 H51 A52 L64 I66	V44-I48 HydrophobicContact CG1-CD1 3.86Å; V44-I48 HydrophobicContact CG1-CG1 4.42Å; V44-I48 VanDerWaalsContact O-CG1 3.3Å; V44-I48 WeakPolarHBondContact O-CG1 3.23Å; V44-I48 PolarHBondContact O-N 3.3Å; L45-I48 PolarHBondContact O-N 2.96Å; I48-H51 PolarHBondContact O-N 2.85Å; I48-A52 WeakPolarHBondContact O-CB 3.49Å; I48-A52 PolarHBondContact O-N 2.95Å; I48-L64 HydrophobicContact CG2-CD2 3.59Å; I48-I66 HydrophobicContact CD1-CD1 4.29Å; I48-I66 HydrophobicContact CG2-CD1 4.28Å
49	Y	97.5	Very high	92.6	Very high	11 Å²	11	79.4 Å²	79.4	4%	0.043	45%	0.452	C	S	.	.	H	α-helix	trans	-60.8	-46.9	179.1	-173.1	-92.5	0	0	0	112.2	L45 S46 S47 H51 A52 A53 S61 P62 L64 L75 E77 L82	L45-Y49 WeakPolarHBondContact O-CB 3.49Å; L45-Y49 PolarHBondContact O-N 3.49Å; S46-Y49 PolarHBondContact O-N 3.4Å; S47-Y49 VanDerWaalsContact C-N 3.31Å; S47-Y49 PolarHBondContact O-N 3.38Å; Y49-H51 VanDerWaalsContact C-N 3.31Å; Y49-H51 PolarHBondContact O-N 2.85Å; Y49-A52 PolarHBondContact O-N 2.79Å; Y49-A52 VanDerWaalsContact O-N 3.14Å; Y49-A53 HydrophobicContact CE1-CB 4.43Å; Y49-A53 WeakPolarHBondContact O-CB 3.38Å; Y49-A53 PolarHBondContact O-N 2.94Å; Y49-S61 WeakPolarHBondContact OH-CB 3.46Å; Y49-P62 HydrophobicContact CE2-CG 4.4Å; Y49-P62 VanDerWaalsContact CE2-O 3.26Å; Y49-P62 WeakPolarHBondContact CE2-O 3.29Å; Y49-P62 PolarHBondContact OH-O 2.96Å; Y49-L64 HydrophobicContact CD2-CB 4.17Å; Y49-L64 HydrophobicContact CE2-CB 4.48Å; Y49-L75 HydrophobicContact CD2-CB 3.89Å; Y49-L75 HydrophobicContact CE2-CB 4.45Å; Y49-E77 HydrophobicContact CD1-CB 4.11Å; Y49-E77 HydrophobicContact CE1-CB 3.27Å; Y49-E77 HydrophobicContact CE1-CG 4.11Å; Y49-E77 HydrophobicContact CE2-CB 4.43Å; Y49-E77 VanDerWaalsContact CZ-CB 3.47Å; Y49-E77 WeakPolarHBondContact OH-CB 3.3Å; Y49-E77 PolarHBondContact OH-N 3.3Å; Y49-L82 HydrophobicContact CD1-CD1 4.06Å; Y49-L82 HydrophobicContact CD2-CD1 3.65Å; Y49-L82 HydrophobicContact CE1-CD1 4.41Å; Y49-L82 HydrophobicContact CE2-CD1 4.02Å; Y49-L82 HydrophobicContact CG-CD1 3.67Å; Y49-L82 HydrophobicContact CG-CD2 4.21Å
50	K	95.1	Very high	92.8	Very high	112 Å²	112	81.9 Å²	81.9	49%	0.487	46%	0.46	S	S	.	.	H	α-helix	trans	-59.6	-40.7	178.1	-73.9	171.3	-178.3	175.9	0	112.4	S26 S46 S47 G54	S26-K50 WeakPolarHBondContact O-CE 3.37Å; S26-K50 PolarHBondContact O-NZ 3.44Å; S46-K50 WeakPolarHBondContact O-CB 3.33Å; S46-K50 VanDerWaalsContact O-CG 3.29Å; S46-K50 WeakPolarHBondContact O-CG 3.45Å; S46-K50 PolarHBondContact O-N 2.91Å; S46-K50 WeakPolarHBondContact OG-CE 3.44Å; S47-K50 PolarHBondContact O-N 2.78Å; K50-G54 PolarHBondContact O-N 3.32Å
51	H	95.4	Very high	93	Very high	137 Å²	137	77.2 Å²	77.2	63%	0.634	45%	0.445	S	S	*	.	H	α-helix	trans	-67	-40.7	175.6	-73.9	83.8	0	0	0	111.6	S47 I48 Y49 G54	S47-H51 PolarHBondContact O-N 3.2Å; S47-H51 PolarHBondContact O-ND1 3.02Å; S47-H51 PolarHBondContact OG-CE1 3.38Å; I48-H51 PolarHBondContact O-N 2.85Å; Y49-H51 VanDerWaalsContact C-N 3.31Å; Y49-H51 PolarHBondContact O-N 2.85Å; H51-G54 PolarHBondContact O-N 2.84Å
52	A	95.4	Very high	93.1	Very high	21 Å²	21	76.9 Å²	76.9	17%	0.174	44%	0.444	C	S	.	.	H	α-helix	trans	-65.1	-39.7	176.7	0	0	0	0	0	112.5	I48 Y49 G54 I55 L64	I48-A52 WeakPolarHBondContact O-CB 3.49Å; I48-A52 PolarHBondContact O-N 2.95Å; Y49-A52 PolarHBondContact O-N 2.79Å; Y49-A52 VanDerWaalsContact O-N 3.14Å; A52-G54 PolarHBondContact O-N 3.14Å; A52-I55 HydrophobicContact CB-CD1 4.48Å; A52-I55 WeakPolarHBondContact O-CB 3.43Å; A52-I55 WeakPolarHBondContact O-CG1 3.5Å; A52-I55 PolarHBondContact O-N 3.19Å; A52-L64 HydrophobicContact CB-CD1 4.24Å; A52-L64 HydrophobicContact CB-CD2 4.21Å
53	A	93.9	Very high	93.1	Very high	41 Å²	41	81.4 Å²	81.4	34%	0.339	47%	0.471	S	S	.	.	H	α-helix	trans	-64.2	-21.5	175.9	0	0	0	0	0	113.5	Y49 P62	Y49-A53 HydrophobicContact CE1-CB 4.43Å; Y49-A53 WeakPolarHBondContact O-CB 3.38Å; Y49-A53 PolarHBondContact O-N 2.94Å; A53-P62 HydrophobicContact CB-CG 4.07Å
54	G	92.8	Very high	93.2	Very high	62 Å²	62	81.4 Å²	81.4	64%	0.639	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.3	2.9	175.9	0	0	0	0	0	115.3	K50 H51 A52	K50-G54 PolarHBondContact O-N 3.32Å; H51-G54 PolarHBondContact O-N 2.84Å; A52-G54 PolarHBondContact O-N 3.14Å
55	I	93.5	Very high	93.2	Very high	135 Å²	135	81.7 Å²	81.7	69%	0.692	46%	0.46	S	S	*	.	S	Bend	trans	-70.5	-41.6	-178.6	-67.5	173.5	0	0	0	111.3	A52	A52-I55 HydrophobicContact CB-CD1 4.48Å; A52-I55 WeakPolarHBondContact O-CB 3.43Å; A52-I55 WeakPolarHBondContact O-CG1 3.5Å; A52-I55 PolarHBondContact O-N 3.19Å
56	E	89	Confident	93.2	Very high	147 Å²	147	83.7 Å²	83.7	69%	0.687	47%	0.47	S	S	*	.	S	Bend	trans	-117.5	138	176.3	-64.9	-170.8	172.1	0	0	109.4	S58	E56-S58 PolarHBondContact O-N 3.26Å
57	E	82.9	Confident	93.2	Very high	215 Å²	215	89.7 Å²	89.7	100%	1.005	50%	0.497	S	S	*	.			trans	-74.4	70.2	170	-69.3	-173.6	178.1	0	0	109.8
58	S	86.4	Confident	93.1	Very high	64 Å²	64	93.9 Å²	93.9	45%	0.448	51%	0.509	S	S	.	.			trans	-110.6	146.2	174.3	-178.9	0	0	0	0	110.2	E56 E60	E56-S58 PolarHBondContact O-N 3.26Å; S58-E60 PolarHBondContact O-N 3.25Å; S58-E60 PolarHBondContact OG-N 3.24Å; S58-E60 VanDerWaalsContact OG-N 3.09Å
59	S	81.1	Confident	93.1	Very high	129 Å²	129	97.7 Å²	97.7	90%	0.902	53%	0.525	S	S	*	.	S	Bend	trans	-78.3	-4.8	169.2	59.6	0	0	0	0	113.1
60	E	88.4	Confident	93	Very high	158 Å²	158	100.6 Å²	100.6	74%	0.738	55%	0.547	S	S	*	.	S	Bend	trans	-93.1	126.3	-179.5	-60.4	-170.5	167.2	0	0	111.4	S58	S58-E60 PolarHBondContact O-N 3.25Å; S58-E60 PolarHBondContact OG-N 3.24Å; S58-E60 VanDerWaalsContact OG-N 3.09Å
61	S	91.1	Very high	93.1	Very high	64 Å²	64	100.9 Å²	100.9	45%	0.448	55%	0.548	S	S	.	.	P	Polyproline II helix	trans	-65.6	123	173.1	-64.6	0	0	0	0	110	Y49 E77	Y49-S61 WeakPolarHBondContact OH-CB 3.46Å; S61-E77 PolarHBondContact OG-OE2 2.89Å
62	P	95.2	Very high	93.1	Very high	45 Å²	45	94.9 Å²	94.9	29%	0.292	52%	0.522	S	S	.	.	P	Polyproline II helix	trans	-73	161.6	-176.9	31.1	-37.2	0	0	0	111.9	Y49 A53	Y49-P62 HydrophobicContact CE2-CG 4.4Å; Y49-P62 VanDerWaalsContact CE2-O 3.26Å; Y49-P62 WeakPolarHBondContact CE2-O 3.29Å; Y49-P62 PolarHBondContact OH-O 2.96Å; A53-P62 HydrophobicContact CB-CG 4.07Å
63	V	96.8	Very high	93.2	Very high	95 Å²	95	95 Å²	95	58%	0.576	52%	0.521	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-97.8	120.1	161.6	178.8	0	0	0	0	108.1	I74	V63-I74 HydrophobicContact CG1-CG2 3.8Å
64	L	97.6	Very high	93.4	Very high	38 Å²	38	95.3 Å²	95.3	20%	0.199	52%	0.517	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	136.5	178	176.2	70.3	0	0	0	110.2	I48 Y49 A52 I66 I74 L75	I48-L64 HydrophobicContact CG2-CD2 3.59Å; Y49-L64 HydrophobicContact CD2-CB 4.17Å; Y49-L64 HydrophobicContact CE2-CB 4.48Å; A52-L64 HydrophobicContact CB-CD1 4.24Å; A52-L64 HydrophobicContact CB-CD2 4.21Å; L64-I66 HydrophobicContact CD2-CD1 4.48Å; L64-I66 HydrophobicContact CD2-CG1 4.35Å; L64-I66 HydrophobicContact CG-CG1 4.41Å; L64-I74 CarbonylContact O-C 3.48Å; L64-I74 WeakPolarHBondContact O-CA 3.36Å; L64-L75 HydrophobicContact CB-CB 4.07Å; L64-L75 HydrophobicContact CD2-CD2 4.25Å; L64-L75 PolarHBondContact N-O 3.1Å; L64-L75 PolarHBondContact O-N 2.9Å
65	I	97.7	Very high	93.7	Very high	93 Å²	93	92.3 Å²	92.3	48%	0.477	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	125.1	174.6	-53.2	177.5	0	0	0	108.2	E67 S73 I74	I65-E67 HydrophobicContact CG2-CG 3.77Å; I65-S73 WeakPolarHBondContact CA-O 3.37Å; I65-I74 HydrophobicContact CG1-CG1 4.49Å
66	I	96.9	Very high	93.9	Very high	59 Å²	59	88 Å²	88	30%	0.303	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	116.4	172.5	-55.3	173.6	0	0	0	107.3	L45 I48 L64 S72 S73 L75	L45-I66 HydrophobicContact CD2-CD1 4.15Å; I48-I66 HydrophobicContact CD1-CD1 4.29Å; I48-I66 HydrophobicContact CG2-CD1 4.28Å; L64-I66 HydrophobicContact CD2-CD1 4.48Å; L64-I66 HydrophobicContact CD2-CG1 4.35Å; L64-I66 HydrophobicContact CG-CG1 4.41Å; I66-S72 CarbonylContact O-C 3.52Å; I66-S72 WeakPolarHBondContact O-CA 3.45Å; I66-S73 PolarHBondContact N-O 2.89Å; I66-S73 PolarHBondContact O-N 2.65Å; I66-L75 HydrophobicContact CD1-CD1 3.99Å; I66-L75 HydrophobicContact CG1-CD1 4.26Å
67	E	97.1	Very high	94.3	Very high	132 Å²	132	83.1 Å²	83.1	62%	0.617	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-108.9	136.9	-179.9	-58	-171.6	128.7	0	0	110.8	I65 Q89	I65-E67 HydrophobicContact CG2-CG 3.77Å; E67-Q89 PolarHBondContact OE1-NE2 3.27Å
68	F	95.3	Very high	94.8	Very high	141 Å²	141	76.6 Å²	76.6	62%	0.618	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-150.5	116.9	174	-176.6	-98.5	0	0	0	109.8	S70 K71	F68-S70 PolarHBondContact O-N 3.25Å; F68-K71 PolarHBondContact N-O 3.02Å; F68-K71 WeakPolarHBondContact O-CB 3.3Å; F68-K71 PolarHBondContact O-N 3.26Å
69	E	95.9	Very high	95.2	Very high	153 Å²	153	84.2 Å²	84.2	72%	0.715	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.5	-122.4	-174.8	-59.1	178.1	169	0	0	111.7	K71	E69-K71 VanDerWaalsContact C-N 3.3Å
70	S	95.9	Very high	95.8	Very high	72 Å²	72	80 Å²	80	50%	0.503	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.2	20.9	177.6	57	0	0	0	0	113.3	F68 N88 Q89	F68-S70 PolarHBondContact O-N 3.25Å; S70-N88 CarbonylContact O-C 3.59Å; S70-N88 WeakPolarHBondContact O-CA 3.32Å; S70-Q89 PolarHBondContact O-N 2.94Å
71	K	96	Very high	96.2	Very high	117 Å²	117	74.7 Å²	74.7	51%	0.509	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.9	146.5	-177.5	-60.7	177.8	-175.9	171.5	0	111.1	F68 E69 K87	F68-K71 PolarHBondContact N-O 3.02Å; F68-K71 WeakPolarHBondContact O-CB 3.3Å; F68-K71 PolarHBondContact O-N 3.26Å; E69-K71 VanDerWaalsContact C-N 3.3Å; K71-K87 CarbonylContact C-O 3.49Å; K71-K87 WeakPolarHBondContact CA-O 3.39Å
72	S	97.1	Very high	96.6	Very high	12 Å²	12	71.9 Å²	71.9	8%	0.084	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	150.6	168.4	65.4	0	0	0	0	112.4	I66 K87	I66-S72 CarbonylContact O-C 3.52Å; I66-S72 WeakPolarHBondContact O-CA 3.45Å; S72-K87 PolarHBondContact N-O 2.82Å; S72-K87 PolarHBondContact O-N 3.08Å
73	S	97.1	Very high	96.7	Very high	23 Å²	23	72 Å²	72	16%	0.161	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	123.8	169.8	-54.5	0	0	0	0	108.5	I65 I66 V85 H86	I65-S73 WeakPolarHBondContact CA-O 3.37Å; I66-S73 PolarHBondContact N-O 2.89Å; I66-S73 PolarHBondContact O-N 2.65Å; S73-V85 WeakPolarHBondContact CA-O 3.46Å; S73-H86 PolarHBondContact OG-ND1 2.69Å
74	I	98.1	Very high	96.8	Very high	47 Å²	47	67.5 Å²	67.5	24%	0.241	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	123.8	177.8	-54.4	171.7	0	0	0	107.6	V63 L64 I65 V84 V85 K87	V63-I74 HydrophobicContact CG1-CG2 3.8Å; L64-I74 CarbonylContact O-C 3.48Å; L64-I74 WeakPolarHBondContact O-CA 3.36Å; I65-I74 HydrophobicContact CG1-CG1 4.49Å; I74-V84 CarbonylContact O-C 3.51Å; I74-V84 WeakPolarHBondContact O-CA 3.15Å; I74-V85 PolarHBondContact N-O 2.9Å; I74-V85 PolarHBondContact O-N 2.89Å; I74-K87 HydrophobicContact CD1-CD 3.83Å
75	L	98.3	Very high	96.8	Very high	0 Å²	0	67 Å²	67	0%	0	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	125.6	-175.4	-76.9	81.1	0	0	0	108.7	L45 Y49 L64 I66 L82 T83 V84	L45-L75 HydrophobicContact CB-CD2 4.13Å; L45-L75 HydrophobicContact CD2-CD1 4.39Å; L45-L75 HydrophobicContact CD2-CD2 4.07Å; Y49-L75 HydrophobicContact CD2-CB 3.89Å; Y49-L75 HydrophobicContact CE2-CB 4.45Å; L64-L75 HydrophobicContact CB-CB 4.07Å; L64-L75 HydrophobicContact CD2-CD2 4.25Å; L64-L75 PolarHBondContact N-O 3.1Å; L64-L75 PolarHBondContact O-N 2.9Å; I66-L75 HydrophobicContact CD1-CD1 3.99Å; I66-L75 HydrophobicContact CG1-CD1 4.26Å; L75-L82 HydrophobicContact CB-CD1 4.05Å; L75-L82 HydrophobicContact CD2-CD2 4.24Å; L75-T83 WeakPolarHBondContact CA-O 3.41Å; L75-V84 HydrophobicContact CD1-CG1 3.95Å; L75-V84 HydrophobicContact CD2-CG2 4.42Å; L75-V84 HydrophobicContact CG-CB 4.48Å; L75-V84 HydrophobicContact CG-CG1 4.01Å; L75-V84 HydrophobicContact CG-CG2 3.99Å
76	C	97.8	Very high	96.8	Very high	45 Å²	45	64.1 Å²	64.1	30%	0.304	33%	0.33	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.7	124.7	179.2	-178.6	0	0	0	0	109.7	T83	C76-T83 PolarHBondContact N-O 3.35Å; C76-T83 PolarHBondContact O-N 2.8Å
77	E	96.9	Very high	96.7	Very high	43 Å²	43	64.3 Å²	64.3	20%	0.201	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	134.1	178.1	-176.7	-76.9	133	0	0	110.6	Y49 S61 Y79 G80 V81 L82	Y49-E77 HydrophobicContact CD1-CB 4.11Å; Y49-E77 HydrophobicContact CE1-CB 3.27Å; Y49-E77 HydrophobicContact CE1-CG 4.11Å; Y49-E77 HydrophobicContact CE2-CB 4.43Å; Y49-E77 VanDerWaalsContact CZ-CB 3.47Å; Y49-E77 WeakPolarHBondContact OH-CB 3.3Å; Y49-E77 PolarHBondContact OH-N 3.3Å; S61-E77 PolarHBondContact OG-OE2 2.89Å; E77-Y79 PolarHBondContact OE1-N 2.87Å; E77-Y79 VanDerWaalsContact OE1-N 3.12Å; E77-G80 VanDerWaalsContact OE1-CA 3.27Å; E77-G80 WeakPolarHBondContact OE1-CA 3.37Å; E77-G80 PolarHBondContact OE1-N 2.8Å; E77-V81 WeakPolarHBondContact CA-O 3.39Å; E77-L82 HydrophobicContact CB-CD1 4.18Å
78	V	95.3	Very high	96.6	Very high	78 Å²	78	61.5 Å²	61.5	47%	0.473	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.7	126.7	172.9	-174.2	0	0	0	0	109.2	G80 V81	V78-G80 PolarHBondContact O-N 2.87Å; V78-V81 PolarHBondContact N-O 2.89Å; V78-V81 PolarHBondContact O-N 2.82Å; V78-V81 VanDerWaalsContact O-N 3.14Å
79	Y	93.6	Very high	96	Very high	225 Å²	225	60.6 Å²	60.6	88%	0.882	32%	0.316	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.4	42.9	176.8	-54.9	-52.7	0	0	0	114.8	E77 V81	E77-Y79 PolarHBondContact OE1-N 2.87Å; E77-Y79 VanDerWaalsContact OE1-N 3.12Å; Y79-V81 VanDerWaalsContact C-N 3.3Å; Y79-V81 PolarHBondContact O-N 2.87Å
80	G	94.5	Very high	96	Very high	39 Å²	39	56 Å²	56	40%	0.402	30%	0.296	S	S	.	.	T	Hydrogen-bonded Turn	trans	80.2	3.9	-179.4	0	0	0	0	0	114.7	S26 E77 V78	S26-G80 PolarHBondContact N-O 3.24Å; E77-G80 VanDerWaalsContact OE1-CA 3.27Å; E77-G80 WeakPolarHBondContact OE1-CA 3.37Å; E77-G80 PolarHBondContact OE1-N 2.8Å; V78-G80 PolarHBondContact O-N 2.87Å
81	V	97.1	Very high	96	Very high	47 Å²	47	55.2 Å²	55.2	29%	0.285	29%	0.285	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	115.5	-178.3	-179.4	0	0	0	0	110.1	C23 I31 E77 V78 Y79 T83	C23-V81 HydrophobicContact CB-CG1 3.87Å; I31-V81 HydrophobicContact CD1-CG1 3.98Å; I31-V81 HydrophobicContact CD1-CG2 4.04Å; E77-V81 WeakPolarHBondContact CA-O 3.39Å; V78-V81 PolarHBondContact N-O 2.89Å; V78-V81 PolarHBondContact O-N 2.82Å; V78-V81 VanDerWaalsContact O-N 3.14Å; Y79-V81 VanDerWaalsContact C-N 3.3Å; Y79-V81 PolarHBondContact O-N 2.87Å; V81-T83 PolarHBondContact O-N 2.99Å
82	L	98.1	Very high	96	Very high	6 Å²	6	51.7 Å²	51.7	3%	0.031	27%	0.273	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82	115.2	172.9	177.2	62.8	0	0	0	109.8	C23 I24 Y49 L75 E77 V84	C23-L82 CarbonylContact C-O 3.58Å; C23-L82 WeakPolarHBondContact CA-O 3.5Å; I24-L82 HydrophobicContact CB-CB 4.26Å; I24-L82 HydrophobicContact CD1-CD2 4.35Å; I24-L82 PolarHBondContact N-O 3.1Å; I24-L82 PolarHBondContact O-N 2.89Å; Y49-L82 HydrophobicContact CD1-CD1 4.06Å; Y49-L82 HydrophobicContact CD2-CD1 3.65Å; Y49-L82 HydrophobicContact CE1-CD1 4.41Å; Y49-L82 HydrophobicContact CE2-CD1 4.02Å; Y49-L82 HydrophobicContact CG-CD1 3.67Å; Y49-L82 HydrophobicContact CG-CD2 4.21Å; L75-L82 HydrophobicContact CB-CD1 4.05Å; L75-L82 HydrophobicContact CD2-CD2 4.24Å; E77-L82 HydrophobicContact CB-CD1 4.18Å; L82-V84 HydrophobicContact CD2-CG2 4.42Å; L82-V84 HydrophobicContact CG-CG2 4.14Å
83	T	97.9	Very high	96	Very high	48 Å²	48	54.1 Å²	54.1	29%	0.294	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.4	128.8	171.3	-58.4	0	0	0	0	109.7	V21 L75 C76 V81 V85	V21-T83 HydrophobicContact CG1-CG2 4.19Å; L75-T83 WeakPolarHBondContact CA-O 3.41Å; C76-T83 PolarHBondContact N-O 3.35Å; C76-T83 PolarHBondContact O-N 2.8Å; V81-T83 PolarHBondContact O-N 2.99Å; T83-V85 HydrophobicContact CG2-CG2 4.38Å
84	V	98.1	Very high	95.9	Very high	0 Å²	0	56 Å²	56	0%	0	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	124.6	176.3	-168.4	0	0	0	0	109.5	V21 Q22 I24 L45 I74 L75 L82	V21-V84 CarbonylContact C-O 3.59Å; V21-V84 VanDerWaalsContact CA-O 3.29Å; V21-V84 WeakPolarHBondContact CA-O 3.42Å; Q22-V84 HydrophobicContact CG-CB 3.79Å; Q22-V84 HydrophobicContact CG-CG2 4.21Å; Q22-V84 PolarHBondContact N-O 2.84Å; Q22-V84 PolarHBondContact O-N 3.41Å; I24-V84 HydrophobicContact CD1-CG2 3.68Å; L45-V84 HydrophobicContact CD1-CG1 4.25Å; L45-V84 HydrophobicContact CD1-CG2 4.28Å; I74-V84 CarbonylContact O-C 3.51Å; I74-V84 WeakPolarHBondContact O-CA 3.15Å; L75-V84 HydrophobicContact CD1-CG1 3.95Å; L75-V84 HydrophobicContact CD2-CG2 4.42Å; L75-V84 HydrophobicContact CG-CB 4.48Å; L75-V84 HydrophobicContact CG-CG1 4.01Å; L75-V84 HydrophobicContact CG-CG2 3.99Å; L82-V84 HydrophobicContact CD2-CG2 4.42Å; L82-V84 HydrophobicContact CG-CG2 4.14Å
85	V	97.9	Very high	95.7	Very high	26 Å²	26	56.6 Å²	56.6	16%	0.158	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	115.2	175.8	-176.8	0	0	0	0	108.7	V12 V18 V21 S73 I74 T83 K87	V12-V85 HydrophobicContact CG1-CG1 4.48Å; V12-V85 HydrophobicContact CG1-CG2 4.27Å; V18-V85 HydrophobicContact CG1-CG1 3.89Å; V18-V85 HydrophobicContact CG2-CG1 3.81Å; V21-V85 HydrophobicContact CG1-CG2 4.2Å; V21-V85 HydrophobicContact CG2-CG1 4.49Å; S73-V85 WeakPolarHBondContact CA-O 3.46Å; I74-V85 PolarHBondContact N-O 2.9Å; I74-V85 PolarHBondContact O-N 2.89Å; T83-V85 HydrophobicContact CG2-CG2 4.38Å; V85-K87 HydrophobicContact CG1-CD 4.23Å; V85-K87 HydrophobicContact CG1-CG 3.97Å
86	H	97.2	Very high	95.6	Very high	33 Å²	33	60.6 Å²	60.6	15%	0.153	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	132.7	175.3	-57	-74.7	0	0	0	110	V18 T19 A20 Q22 S73	V18-H86 CarbonylContact C-O 3.55Å; V18-H86 WeakPolarHBondContact CA-O 3.21Å; T19-H86 PolarHBondContact N-O 2.85Å; T19-H86 PolarHBondContact OG1-O 2.83Å; A20-H86 HydrophobicContact CB-CB 4.34Å; A20-H86 PolarHBondContact O-N 2.8Å; Q22-H86 PolarHBondContact NE2-NE2 3.25Å; S73-H86 PolarHBondContact OG-ND1 2.69Å
87	K	96.4	Very high	95.4	Very high	63 Å²	63	61.8 Å²	61.8	27%	0.274	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.6	147.8	-175.6	-61.8	176.6	68	-178.3	0	111.9	K17 V18 K71 S72 I74 V85	K17-K87 CarbonylContact O-C 3.39Å; K17-K87 WeakPolarHBondContact O-CA 3.47Å; V18-K87 HydrophobicContact CG2-CD 4.42Å; V18-K87 HydrophobicContact CG2-CG 3.99Å; K71-K87 CarbonylContact C-O 3.49Å; K71-K87 WeakPolarHBondContact CA-O 3.39Å; S72-K87 PolarHBondContact N-O 2.82Å; S72-K87 PolarHBondContact O-N 3.08Å; I74-K87 HydrophobicContact CD1-CD 3.83Å; V85-K87 HydrophobicContact CG1-CD 4.23Å; V85-K87 HydrophobicContact CG1-CG 3.97Å
88	N	94.8	Very high	95.3	Very high	74 Å²	74	63.4 Å²	63.4	40%	0.396	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.3	138.8	156.9	-63	-23.2	0	0	0	108.3	K17 T19 S70	K17-N88 PolarHBondContact O-N 3.46Å; T19-N88 WeakPolarHBondContact CG2-ND2 3.45Å; S70-N88 CarbonylContact O-C 3.59Å; S70-N88 WeakPolarHBondContact O-CA 3.32Å
89	Q	82.1	Confident	95.3	Very high	122 Å²	122	62.1 Å²	62.1	57%	0.57	31%	0.313	S	S	*	.			trans	-77	0	178	-66.4	-162.4	-23.2	0	0	111.8	K17 E67 S70	K17-Q89 PolarHBondContact NZ-OXT 3.35Å; E67-Q89 PolarHBondContact OE1-NE2 3.27Å; S70-Q89 PolarHBondContact O-N 2.94Å

Retrieved 89 of 89 residues in 64.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).