A0A3Q0KVF8_SCHMA Loading...

NADH-ubiquinone oxidoreductase chain 3

AlphaFold DB , UniProt , Accession A0A3Q0KVF8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 95 aa.

						>A0A3Q0KVF8_SCHMA|A0A3Q0KVF8
MSSSLLALLMVAFFFTLIMGSMTFYVLGFSFSLDHYISLKEWYSSFECGFLSHGYKENFFSFSYLNLLVLFVVFDLEVSLLLKVVFDGIWFYTYW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.7	Low	84.9	Confident	219 Å²	219	105.6 Å²	105.6	100%	1.079	61%	0.605	S	S	*	*				0	117.8	0	-75.6	153.6	80.2	0	106.8
2	S	70.6	Confident	85.7	Confident	62 Å²	62	101 Å²	101	43%	0.434	59%	0.589	S	S	.	*			trans	-62	141.8	-160.4	51.8	0	0	0	112	S4 L5 L6	S2-S4 WeakPolarHBondContact CB-OG 3.14Å; S2-S4 PolarHBondContact O-N 2.85Å; S2-S4 PolarHBondContact OG-OG 3.42Å; S2-L5 WeakPolarHBondContact O-CB 3.49Å; S2-L5 PolarHBondContact O-N 3.34Å; S2-L6 PolarHBondContact O-N 3.48Å
3	S	82.4	Confident	86.4	Confident	105 Å²	105	102.5 Å²	102.5	73%	0.734	58%	0.584	S	S	*	*	H	α-helix	trans	-45.6	-29.9	173.7	42.9	0	0	0	113.7	L6 A7	S3-L6 PolarHBondContact O-N 3.33Å; S3-A7 PolarHBondContact O-N 3.14Å
4	S	85.5	Confident	86.9	Confident	72 Å²	72	103.5 Å²	103.5	50%	0.503	58%	0.579	S	S	.	*	H	α-helix	trans	-62.4	-39.5	172.7	55.1	0	0	0	114.5	S2 A7 L8	S2-S4 WeakPolarHBondContact CB-OG 3.14Å; S2-S4 PolarHBondContact O-N 2.85Å; S2-S4 PolarHBondContact OG-OG 3.42Å; S4-A7 PolarHBondContact O-N 3.44Å; S4-L8 PolarHBondContact O-N 2.65Å
5	L	89.6	Confident	87.4	Confident	92 Å²	92	105.4 Å²	105.4	48%	0.482	58%	0.579	S	S	.	*	H	α-helix	trans	-68.9	-38.6	177.2	-103.8	161.1	0	0	111.3	S2 L8 L9	S2-L5 WeakPolarHBondContact O-CB 3.49Å; S2-L5 PolarHBondContact O-N 3.34Å; L5-L8 PolarHBondContact O-N 3.21Å; L5-L9 WeakPolarHBondContact O-CG 3.44Å; L5-L9 PolarHBondContact O-N 3.08Å
6	L	88.6	Confident	87.8	Confident	114 Å²	114	104.4 Å²	104.4	60%	0.597	58%	0.577	S	S	*	*	H	α-helix	trans	-63.7	-44.7	173	-88	166.3	0	0	111.4	S2 S3 L8 L9 M10	S2-L6 PolarHBondContact O-N 3.48Å; S3-L6 PolarHBondContact O-N 3.33Å; L6-L8 VanDerWaalsContact C-N 3.33Å; L6-L8 PolarHBondContact O-N 3.3Å; L6-L9 PolarHBondContact O-N 3.33Å; L6-M10 VanDerWaalsContact O-CG 3.27Å; L6-M10 WeakPolarHBondContact O-CG 2.93Å; L6-M10 PolarHBondContact O-N 3.03Å
7	A	90	Very high	88.1	Confident	56 Å²	56	103.7 Å²	103.7	46%	0.463	57%	0.572	S	S	.	*	H	α-helix	trans	-60.2	-42.6	176.6	0	0	0	0	112.1	S3 S4 M10 V11	S3-A7 PolarHBondContact O-N 3.14Å; S4-A7 PolarHBondContact O-N 3.44Å; A7-M10 PolarHBondContact O-N 2.95Å; A7-V11 WeakPolarHBondContact O-CG2 3.43Å; A7-V11 PolarHBondContact O-N 3.28Å
8	L	92.3	Very high	88.4	Confident	122 Å²	122	103.1 Å²	103.1	64%	0.639	57%	0.566	S	S	*	*	H	α-helix	trans	-62.6	-43.2	177	-114.6	159.2	0	0	112.5	S4 L5 L6 V11 A12	S4-L8 PolarHBondContact O-N 2.65Å; L5-L8 PolarHBondContact O-N 3.21Å; L6-L8 VanDerWaalsContact C-N 3.33Å; L6-L8 PolarHBondContact O-N 3.3Å; L8-V11 PolarHBondContact O-N 3.2Å; L8-A12 WeakPolarHBondContact O-CB 3.17Å; L8-A12 PolarHBondContact O-N 3.02Å
9	L	92.4	Very high	88.6	Confident	116 Å²	116	102.9 Å²	102.9	61%	0.607	56%	0.562	S	S	*	*	H	α-helix	trans	-63.7	-40.1	176.2	-77.5	170.3	0	0	112.2	L5 L6 A12 F13	L5-L9 WeakPolarHBondContact O-CG 3.44Å; L5-L9 PolarHBondContact O-N 3.08Å; L6-L9 PolarHBondContact O-N 3.33Å; L9-A12 PolarHBondContact O-N 3.46Å; L9-F13 WeakPolarHBondContact O-CB 3.33Å; L9-F13 PolarHBondContact O-N 3.45Å
10	M	91.3	Very high	88.8	Confident	105 Å²	105	99.5 Å²	99.5	52%	0.517	55%	0.552	S	S	.	*	H	α-helix	trans	-63.9	-44.7	176.6	-66.9	-65.4	-73.7	0	111.4	L6 A7 F13 F14	L6-M10 VanDerWaalsContact O-CG 3.27Å; L6-M10 WeakPolarHBondContact O-CG 2.93Å; L6-M10 PolarHBondContact O-N 3.03Å; A7-M10 PolarHBondContact O-N 2.95Å; M10-F13 PolarHBondContact O-N 3.31Å; M10-F14 HydrophobicContact CE-CE2 4.2Å; M10-F14 WeakPolarHBondContact O-CD2 3.38Å; M10-F14 PolarHBondContact O-N 3.06Å
11	V	93.7	Very high	88.8	Confident	99 Å²	99	97.8 Å²	97.8	60%	0.6	55%	0.547	S	S	*	.	H	α-helix	trans	-63.1	-44.9	177.2	173.5	0	0	0	111.1	A7 L8 F13 F14 F15	A7-V11 WeakPolarHBondContact O-CG2 3.43Å; A7-V11 PolarHBondContact O-N 3.28Å; L8-V11 PolarHBondContact O-N 3.2Å; V11-F13 VanDerWaalsContact C-N 3.3Å; V11-F13 PolarHBondContact O-N 2.89Å; V11-F14 PolarHBondContact O-N 3.48Å; V11-F15 WeakPolarHBondContact O-CB 3.45Å; V11-F15 PolarHBondContact O-N 3.17Å
12	A	94.5	Very high	90.3	Very high	50 Å²	50	93.1 Å²	93.1	41%	0.413	52%	0.524	S	S	.	.	H	α-helix	trans	-60.6	-41	176.9	0	0	0	0	111.7	L8 L9 F15 T16	L8-A12 WeakPolarHBondContact O-CB 3.17Å; L8-A12 PolarHBondContact O-N 3.02Å; L9-A12 PolarHBondContact O-N 3.46Å; A12-F15 PolarHBondContact O-N 2.9Å; A12-T16 WeakPolarHBondContact O-CG2 3.15Å; A12-T16 PolarHBondContact O-N 3.2Å; A12-T16 PolarHBondContact O-OG1 3.19Å
13	F	94.5	Very high	91.2	Very high	120 Å²	120	94.2 Å²	94.2	53%	0.526	53%	0.528	S	S	.	.	H	α-helix	trans	-63.5	-44.8	176.5	180	-98.9	0	0	112.6	L9 M10 V11 F15 T16 L17	L9-F13 WeakPolarHBondContact O-CB 3.33Å; L9-F13 PolarHBondContact O-N 3.45Å; M10-F13 PolarHBondContact O-N 3.31Å; V11-F13 VanDerWaalsContact C-N 3.3Å; V11-F13 PolarHBondContact O-N 2.89Å; F13-F15 VanDerWaalsContact C-N 3.31Å; F13-F15 PolarHBondContact O-N 3.45Å; F13-T16 PolarHBondContact O-N 3.37Å; F13-T16 PolarHBondContact O-OG1 3.24Å; F13-L17 HydrophobicContact CE1-CD1 3.88Å; F13-L17 HydrophobicContact CZ-CD1 4.14Å; F13-L17 WeakPolarHBondContact O-CB 3.44Å; F13-L17 PolarHBondContact O-N 3.16Å
14	F	94	Very high	91.4	Very high	117 Å²	117	97 Å²	97	51%	0.513	53%	0.528	S	S	.	.	H	α-helix	trans	-64.7	-38.1	175.5	-76.5	-65.3	0	0	111.9	M10 V11 L17 I18	M10-F14 HydrophobicContact CE-CE2 4.2Å; M10-F14 WeakPolarHBondContact O-CD2 3.38Å; M10-F14 PolarHBondContact O-N 3.06Å; V11-F14 PolarHBondContact O-N 3.48Å; F14-L17 PolarHBondContact O-N 2.71Å; F14-I18 WeakPolarHBondContact O-CD1 3.44Å; F14-I18 VanDerWaalsContact O-CG1 3.27Å; F14-I18 WeakPolarHBondContact O-CG1 3.09Å; F14-I18 PolarHBondContact O-N 3.06Å
15	F	94.2	Very high	91.4	Very high	132 Å²	132	101.9 Å²	101.9	58%	0.579	54%	0.536	S	S	*	.	H	α-helix	trans	-64.9	-44	178.2	-164.2	-94	0	0	112	V11 A12 F13 L17 I18 M19	V11-F15 WeakPolarHBondContact O-CB 3.45Å; V11-F15 PolarHBondContact O-N 3.17Å; A12-F15 PolarHBondContact O-N 2.9Å; F13-F15 VanDerWaalsContact C-N 3.31Å; F13-F15 PolarHBondContact O-N 3.45Å; F15-L17 VanDerWaalsContact C-N 3.31Å; F15-L17 PolarHBondContact O-N 2.89Å; F15-I18 PolarHBondContact O-N 3.02Å; F15-M19 HydrophobicContact CD1-CG 4.02Å; F15-M19 HydrophobicContact CE1-CG 3.75Å; F15-M19 HydrophobicContact CE1-SD 4.38Å; F15-M19 HydrophobicContact CZ-CG 4.3Å; F15-M19 HydrophobicContact CZ-SD 4.44Å; F15-M19 WeakPolarHBondContact O-CG 3.4Å; F15-M19 PolarHBondContact O-N 3.43Å
16	T	93.3	Very high	91.1	Very high	89 Å²	89	102 Å²	102	55%	0.546	54%	0.54	S	S	.	.	H	α-helix	trans	-65.8	-35.2	175.8	55.2	0	0	0	112	A12 F13 M19 G20	A12-T16 WeakPolarHBondContact O-CG2 3.15Å; A12-T16 PolarHBondContact O-N 3.2Å; A12-T16 PolarHBondContact O-OG1 3.19Å; F13-T16 PolarHBondContact O-N 3.37Å; F13-T16 PolarHBondContact O-OG1 3.24Å; T16-M19 PolarHBondContact O-N 2.97Å; T16-G20 PolarHBondContact O-N 3.47Å
17	L	93.7	Very high	90.7	Very high	93 Å²	93	102 Å²	102	49%	0.487	54%	0.54	S	S	.	.	H	α-helix	trans	-65.3	-43.5	176.5	-153.3	163.5	0	0	111.3	F13 F14 F15 G20 S21	F13-L17 HydrophobicContact CE1-CD1 3.88Å; F13-L17 HydrophobicContact CZ-CD1 4.14Å; F13-L17 WeakPolarHBondContact O-CB 3.44Å; F13-L17 PolarHBondContact O-N 3.16Å; F14-L17 PolarHBondContact O-N 2.71Å; F15-L17 VanDerWaalsContact C-N 3.31Å; F15-L17 PolarHBondContact O-N 2.89Å; L17-G20 PolarHBondContact O-N 2.95Å; L17-S21 PolarHBondContact O-N 3.45Å; L17-S21 PolarHBondContact O-OG 3.47Å
18	I	93.5	Very high	90	Very high	92 Å²	92	101 Å²	101	47%	0.472	54%	0.536	S	S	.	.	H	α-helix	trans	-64.9	-45.3	176.2	-66.1	162.5	0	0	111.1	F14 F15 G20 S21 M22	F14-I18 WeakPolarHBondContact O-CD1 3.44Å; F14-I18 VanDerWaalsContact O-CG1 3.27Å; F14-I18 WeakPolarHBondContact O-CG1 3.09Å; F14-I18 PolarHBondContact O-N 3.06Å; F15-I18 PolarHBondContact O-N 3.02Å; I18-G20 VanDerWaalsContact C-N 3.31Å; I18-G20 PolarHBondContact O-N 3.24Å; I18-S21 PolarHBondContact O-N 3.35Å; I18-S21 PolarHBondContact O-OG 3.31Å; I18-M22 VanDerWaalsContact O-CG 3.3Å; I18-M22 WeakPolarHBondContact O-CG 3.32Å; I18-M22 PolarHBondContact O-N 2.85Å
19	M	92.6	Very high	89	Confident	100 Å²	100	100.7 Å²	100.7	49%	0.493	53%	0.53	S	S	.	.	H	α-helix	trans	-65.2	-37.5	177.3	-68.2	-60	-66.7	0	111.7	F15 T16 T23	F15-M19 HydrophobicContact CD1-CG 4.02Å; F15-M19 HydrophobicContact CE1-CG 3.75Å; F15-M19 HydrophobicContact CE1-SD 4.38Å; F15-M19 HydrophobicContact CZ-CG 4.3Å; F15-M19 HydrophobicContact CZ-SD 4.44Å; F15-M19 WeakPolarHBondContact O-CG 3.4Å; F15-M19 PolarHBondContact O-N 3.43Å; T16-M19 PolarHBondContact O-N 2.97Å; M19-T23 WeakPolarHBondContact O-CG2 3.4Å; M19-T23 PolarHBondContact O-N 3.41Å; M19-T23 PolarHBondContact O-OG1 3.45Å
20	G	91.7	Very high	88	Confident	35 Å²	35	98.3 Å²	98.3	36%	0.361	52%	0.523	S	S	.	.	H	α-helix	trans	-64.1	-42.8	175	0	0	0	0	112.7	T16 L17 I18 T23 F24	T16-G20 PolarHBondContact O-N 3.47Å; L17-G20 PolarHBondContact O-N 2.95Å; I18-G20 VanDerWaalsContact C-N 3.31Å; I18-G20 PolarHBondContact O-N 3.24Å; G20-T23 WeakPolarHBondContact CA-OG1 3.44Å; G20-T23 PolarHBondContact O-OG1 3.3Å; G20-F24 WeakPolarHBondContact O-CB 3.32Å; G20-F24 PolarHBondContact O-N 3.29Å
21	S	89	Confident	86.8	Confident	64 Å²	64	101.3 Å²	101.3	45%	0.448	53%	0.533	S	S	.	.	H	α-helix	trans	-68.6	-39.8	178.4	67.1	0	0	0	112.2	L17 I18 F24 Y25	L17-S21 PolarHBondContact O-N 3.45Å; L17-S21 PolarHBondContact O-OG 3.47Å; I18-S21 PolarHBondContact O-N 3.35Å; I18-S21 PolarHBondContact O-OG 3.31Å; S21-F24 PolarHBondContact O-N 3.49Å; S21-Y25 WeakPolarHBondContact O-CB 3.49Å; S21-Y25 PolarHBondContact O-N 3.32Å
22	M	90.1	Very high	85.6	Confident	121 Å²	121	98.4 Å²	98.4	60%	0.596	52%	0.518	S	S	*	.	H	α-helix	trans	-64.1	-44.5	176.2	-71.1	-62.7	-167	0	111.9	I18 Y25 V26	I18-M22 VanDerWaalsContact O-CG 3.3Å; I18-M22 WeakPolarHBondContact O-CG 3.32Å; I18-M22 PolarHBondContact O-N 2.85Å; M22-Y25 PolarHBondContact O-N 3.07Å; M22-V26 WeakPolarHBondContact O-CG2 3.48Å; M22-V26 PolarHBondContact O-N 2.98Å
23	T	87.7	Confident	84.1	Confident	84 Å²	84	99.5 Å²	99.5	52%	0.515	52%	0.516	S	S	.	.	H	α-helix	trans	-65.1	-40.2	176.5	48.5	0	0	0	111.6	M19 G20 Y25 V26 L27	M19-T23 WeakPolarHBondContact O-CG2 3.4Å; M19-T23 PolarHBondContact O-N 3.41Å; M19-T23 PolarHBondContact O-OG1 3.45Å; G20-T23 WeakPolarHBondContact CA-OG1 3.44Å; G20-T23 PolarHBondContact O-OG1 3.3Å; T23-Y25 VanDerWaalsContact C-N 3.35Å; T23-Y25 PolarHBondContact O-N 3.25Å; T23-V26 PolarHBondContact O-N 2.94Å; T23-L27 VanDerWaalsContact O-CB 3.28Å; T23-L27 WeakPolarHBondContact O-CB 3.49Å; T23-L27 PolarHBondContact O-N 3.27Å
24	F	86.6	Confident	82.7	Confident	165 Å²	165	99.6 Å²	99.6	72%	0.724	52%	0.522	S	S	*	.	H	α-helix	trans	-63.6	-39.6	174.9	-159.9	-92.4	0	0	112.3	G20 S21 G28	G20-F24 WeakPolarHBondContact O-CB 3.32Å; G20-F24 PolarHBondContact O-N 3.29Å; S21-F24 PolarHBondContact O-N 3.49Å; F24-G28 PolarHBondContact O-N 3.06Å
25	Y	85.4	Confident	81.3	Confident	173 Å²	173	99.9 Å²	99.9	68%	0.678	53%	0.525	S	S	*	.	H	α-helix	trans	-64.2	-46.7	176.9	-166.6	-89.6	0	0	111.6	S21 M22 T23 F29	S21-Y25 WeakPolarHBondContact O-CB 3.49Å; S21-Y25 PolarHBondContact O-N 3.32Å; M22-Y25 PolarHBondContact O-N 3.07Å; T23-Y25 VanDerWaalsContact C-N 3.35Å; T23-Y25 PolarHBondContact O-N 3.25Å; Y25-F29 WeakPolarHBondContact O-CB 3.27Å; Y25-F29 PolarHBondContact O-N 3.44Å
26	V	83.2	Confident	79.8	Confident	94 Å²	94	101.1 Å²	101.1	57%	0.57	53%	0.527	S	S	*	.	H	α-helix	trans	-64.8	-43.5	177.9	174.5	0	0	0	111.1	M22 T23 F29 S30	M22-V26 WeakPolarHBondContact O-CG2 3.48Å; M22-V26 PolarHBondContact O-N 2.98Å; T23-V26 PolarHBondContact O-N 2.94Å; V26-F29 PolarHBondContact O-N 3.4Å; V26-S30 PolarHBondContact O-N 3.2Å; V26-S30 PolarHBondContact O-OG 2.91Å; V26-S30 VanDerWaalsContact O-OG 3.08Å
27	L	80.6	Confident	78.4	Confident	114 Å²	114	100.5 Å²	100.5	60%	0.597	52%	0.519	S	S	*	.	H	α-helix	trans	-69.2	-41.2	-178.8	-149.6	113	0	0	111.8	T23 S30 F31	T23-L27 VanDerWaalsContact O-CB 3.28Å; T23-L27 WeakPolarHBondContact O-CB 3.49Å; T23-L27 PolarHBondContact O-N 3.27Å; L27-S30 PolarHBondContact O-N 3.45Å; L27-F31 PolarHBondContact O-N 3.1Å
28	G	76.8	Confident	77.2	Confident	37 Å²	37	99.6 Å²	99.6	38%	0.381	52%	0.521	S	S	.	.	H	α-helix	trans	-65.7	-39.4	174.9	0	0	0	0	112.4	F24 F31 S32	F24-G28 PolarHBondContact O-N 3.06Å; G28-F31 PolarHBondContact O-N 3.33Å; G28-S32 WeakPolarHBondContact O-CB 3.42Å; G28-S32 PolarHBondContact O-N 2.95Å; G28-S32 PolarHBondContact O-OG 3.38Å
29	F	71	Confident	76	Confident	115 Å²	115	99.3 Å²	99.3	50%	0.504	52%	0.52	S	S	.	.	H	α-helix	trans	-62.4	-47.5	173.4	-173.8	-105.6	0	0	111.3	Y25 V26 F31 S32 L33	Y25-F29 WeakPolarHBondContact O-CB 3.27Å; Y25-F29 PolarHBondContact O-N 3.44Å; V26-F29 PolarHBondContact O-N 3.4Å; F29-F31 VanDerWaalsContact C-N 3.34Å; F29-F31 PolarHBondContact O-N 3.15Å; F29-S32 PolarHBondContact O-N 3.1Å; F29-S32 VanDerWaalsContact O-N 3.17Å; F29-S32 PolarHBondContact O-OG 3Å; F29-L33 HydrophobicContact CD1-CD1 4.19Å; F29-L33 HydrophobicContact CE1-CD1 3.48Å; F29-L33 VanDerWaalsContact CE1-CD1 3.48Å; F29-L33 HydrophobicContact CE2-CD1 4.37Å; F29-L33 HydrophobicContact CZ-CD1 3.58Å; F29-L33 WeakPolarHBondContact O-CB 3.44Å; F29-L33 PolarHBondContact O-N 3.32Å
30	S	70.5	Confident	74.9	Confident	66 Å²	66	100.4 Å²	100.4	46%	0.462	52%	0.522	S	S	.	.	H	α-helix	trans	-58.7	-42.4	176.4	-64.2	0	0	0	112.6	V26 L27 L33	V26-S30 PolarHBondContact O-N 3.2Å; V26-S30 PolarHBondContact O-OG 2.91Å; V26-S30 VanDerWaalsContact O-OG 3.08Å; L27-S30 PolarHBondContact O-N 3.45Å; S30-L33 WeakPolarHBondContact O-CB 3.46Å; S30-L33 PolarHBondContact O-N 3.46Å
31	F	66.4	Low	73.8	Confident	167 Å²	167	105.5 Å²	105.5	73%	0.732	54%	0.536	S	S	*	.	H	α-helix	trans	-66.9	-38	176.2	-109.7	-81.8	0	0	112.6	L27 G28 F29 L33	L27-F31 PolarHBondContact O-N 3.1Å; G28-F31 PolarHBondContact O-N 3.33Å; F29-F31 VanDerWaalsContact C-N 3.34Å; F29-F31 PolarHBondContact O-N 3.15Å; F31-L33 VanDerWaalsContact C-N 3.28Å
32	S	68.4	Low	73.2	Confident	39 Å²	39	114.1 Å²	114.1	27%	0.273	56%	0.559	S	S	.	*	H	α-helix	trans	-69.9	-29.1	175.2	74.6	0	0	0	112.2	G28 F29 D34 H35 Y36	G28-S32 WeakPolarHBondContact O-CB 3.42Å; G28-S32 PolarHBondContact O-N 2.95Å; G28-S32 PolarHBondContact O-OG 3.38Å; F29-S32 PolarHBondContact O-N 3.1Å; F29-S32 VanDerWaalsContact O-N 3.17Å; F29-S32 PolarHBondContact O-OG 3Å; S32-D34 VanDerWaalsContact C-N 3.34Å; S32-D34 PolarHBondContact O-N 2.98Å; S32-H35 PolarHBondContact O-N 2.96Å; S32-H35 VanDerWaalsContact O-N 3.15Å; S32-Y36 VanDerWaalsContact O-CD2 3.26Å; S32-Y36 WeakPolarHBondContact O-CD2 3.48Å; S32-Y36 PolarHBondContact O-N 2.77Å
33	L	63.5	Low	72.5	Confident	73 Å²	73	116.4 Å²	116.4	38%	0.382	56%	0.562	S	S	.	*	H	α-helix	trans	-59.6	-44.7	-174.5	-153.2	86.3	0	0	111	F29 S30 F31 H35 Y36 I37	F29-L33 HydrophobicContact CD1-CD1 4.19Å; F29-L33 HydrophobicContact CE1-CD1 3.48Å; F29-L33 VanDerWaalsContact CE1-CD1 3.48Å; F29-L33 HydrophobicContact CE2-CD1 4.37Å; F29-L33 HydrophobicContact CZ-CD1 3.58Å; F29-L33 WeakPolarHBondContact O-CB 3.44Å; F29-L33 PolarHBondContact O-N 3.32Å; S30-L33 WeakPolarHBondContact O-CB 3.46Å; S30-L33 PolarHBondContact O-N 3.46Å; F31-L33 VanDerWaalsContact C-N 3.28Å; L33-H35 VanDerWaalsContact C-N 3.34Å; L33-H35 PolarHBondContact O-N 3.28Å; L33-Y36 PolarHBondContact O-N 3.03Å; L33-I37 HydrophobicContact CD2-CD1 3.97Å; L33-I37 HydrophobicContact CG-CD1 3.95Å; L33-I37 HydrophobicContact CG-CG1 4.48Å; L33-I37 WeakPolarHBondContact O-CB 3.27Å; L33-I37 WeakPolarHBondContact O-CD1 3.07Å; L33-I37 WeakPolarHBondContact O-CG1 3.17Å; L33-I37 PolarHBondContact O-N 2.95Å
34	D	65.7	Low	71.9	Confident	122 Å²	122	115.6 Å²	115.6	65%	0.652	56%	0.56	S	S	*	*	H	α-helix	trans	-61.8	-40.8	178.3	-84.1	-9.9	0	0	112.4	S32 I37 S38	S32-D34 VanDerWaalsContact C-N 3.34Å; S32-D34 PolarHBondContact O-N 2.98Å; D34-I37 PolarHBondContact O-N 2.81Å; D34-S38 PolarHBondContact O-N 3.27Å; D34-S38 VanDerWaalsContact O-N 3.14Å
35	H	63.2	Low	71.5	Confident	123 Å²	123	111.9 Å²	111.9	57%	0.569	55%	0.554	S	S	*	*	H	α-helix	trans	-68.5	-41.4	176.8	-167.3	66.9	0	0	111.7	S32 L33 S38 L39	S32-H35 PolarHBondContact O-N 2.96Å; S32-H35 VanDerWaalsContact O-N 3.15Å; L33-H35 VanDerWaalsContact C-N 3.34Å; L33-H35 PolarHBondContact O-N 3.28Å; H35-S38 PolarHBondContact O-N 3.46Å; H35-L39 WeakPolarHBondContact O-CG 3.35Å; H35-L39 PolarHBondContact O-N 2.94Å; H35-L39 VanDerWaalsContact O-N 3.12Å
36	Y	62.3	Low	71.1	Confident	158 Å²	158	112.1 Å²	112.1	62%	0.62	56%	0.559	S	S	*	*	H	α-helix	trans	-65.7	-37.2	175.9	-88.1	-76.2	0	0	112.3	S32 L33 L39 K40	S32-Y36 VanDerWaalsContact O-CD2 3.26Å; S32-Y36 WeakPolarHBondContact O-CD2 3.48Å; S32-Y36 PolarHBondContact O-N 2.77Å; L33-Y36 PolarHBondContact O-N 3.03Å; Y36-L39 PolarHBondContact O-N 2.61Å; Y36-K40 VanDerWaalsContact O-CB 3.29Å; Y36-K40 WeakPolarHBondContact O-CB 3.41Å; Y36-K40 PolarHBondContact O-N 3.45Å
37	I	65.1	Low	70.9	Confident	76 Å²	76	111.7 Å²	111.7	39%	0.39	55%	0.551	S	S	.	*	H	α-helix	trans	-63.2	-45.6	176.6	-69.5	159.2	0	0	110.1	L33 D34 L39 K40 E41	L33-I37 HydrophobicContact CD2-CD1 3.97Å; L33-I37 HydrophobicContact CG-CD1 3.95Å; L33-I37 HydrophobicContact CG-CG1 4.48Å; L33-I37 WeakPolarHBondContact O-CB 3.27Å; L33-I37 WeakPolarHBondContact O-CD1 3.07Å; L33-I37 WeakPolarHBondContact O-CG1 3.17Å; L33-I37 PolarHBondContact O-N 2.95Å; D34-I37 PolarHBondContact O-N 2.81Å; I37-L39 PolarHBondContact O-N 2.99Å; I37-K40 VanDerWaalsContact O-CB 3.29Å; I37-K40 WeakPolarHBondContact O-CB 3.28Å; I37-K40 PolarHBondContact O-N 3.06Å; I37-K40 VanDerWaalsContact O-N 3.09Å; I37-E41 PolarHBondContact O-N 3.38Å
38	S	67.2	Low	70.8	Confident	74 Å²	74	110.8 Å²	110.8	52%	0.517	55%	0.553	S	S	.	*	H	α-helix	trans	-61.3	-42.1	177.2	174.4	0	0	0	112.7	D34 H35 K40	D34-S38 PolarHBondContact O-N 3.27Å; D34-S38 VanDerWaalsContact O-N 3.14Å; H35-S38 PolarHBondContact O-N 3.46Å; S38-K40 VanDerWaalsContact C-N 3.29Å; S38-K40 PolarHBondContact O-N 3.16Å
39	L	69	Low	70.9	Confident	85 Å²	85	112.7 Å²	112.7	45%	0.445	57%	0.572	S	S	.	*	H	α-helix	trans	-68.3	-32.5	175.1	-69	174.8	0	0	111.9	H35 Y36 I37 E41 W42 Y43	H35-L39 WeakPolarHBondContact O-CG 3.35Å; H35-L39 PolarHBondContact O-N 2.94Å; H35-L39 VanDerWaalsContact O-N 3.12Å; Y36-L39 PolarHBondContact O-N 2.61Å; I37-L39 PolarHBondContact O-N 2.99Å; L39-E41 VanDerWaalsContact C-N 3.3Å; L39-E41 PolarHBondContact O-N 3.12Å; L39-W42 PolarHBondContact O-N 3.27Å; L39-W42 VanDerWaalsContact O-N 3.12Å; L39-Y43 WeakPolarHBondContact O-CD1 3.2Å; L39-Y43 PolarHBondContact O-N 3.44Å
40	K	69.4	Low	71.1	Confident	123 Å²	123	115.1 Å²	115.1	54%	0.535	58%	0.583	S	S	.	*	H	α-helix	trans	-60.4	-39.6	179.9	-157.4	177.5	-172.2	-168.8	112.8	Y36 I37 S38 W42 Y43 S44	Y36-K40 VanDerWaalsContact O-CB 3.29Å; Y36-K40 WeakPolarHBondContact O-CB 3.41Å; Y36-K40 PolarHBondContact O-N 3.45Å; I37-K40 VanDerWaalsContact O-CB 3.29Å; I37-K40 WeakPolarHBondContact O-CB 3.28Å; I37-K40 PolarHBondContact O-N 3.06Å; I37-K40 VanDerWaalsContact O-N 3.09Å; S38-K40 VanDerWaalsContact C-N 3.29Å; S38-K40 PolarHBondContact O-N 3.16Å; K40-W42 VanDerWaalsContact C-N 3.26Å; K40-W42 PolarHBondContact O-N 3.4Å; K40-Y43 HydrophobicContact CB-CE1 3.96Å; K40-Y43 HydrophobicContact CG-CE1 3.81Å; K40-Y43 PolarHBondContact O-N 3.42Å; K40-S44 WeakPolarHBondContact O-CB 3.29Å; K40-S44 PolarHBondContact O-N 3.12Å; K40-S44 PolarHBondContact O-OG 3.26Å
41	E	69.2	Low	71.2	Confident	142 Å²	142	118.5 Å²	118.5	66%	0.664	60%	0.595	S	S	*	*	H	α-helix	trans	-61.5	-37.1	176.6	-66.8	179.3	176.1	0	111.7	I37 L39 S44	I37-E41 PolarHBondContact O-N 3.38Å; L39-E41 VanDerWaalsContact C-N 3.3Å; L39-E41 PolarHBondContact O-N 3.12Å; E41-S44 PolarHBondContact O-OG 3.26Å
42	W	76.1	Confident	71.2	Confident	245 Å²	245	114.6 Å²	114.6	93%	0.928	59%	0.589	S	S	*	*	H	α-helix	trans	-74.5	-32.4	-177.7	-126	61.8	0	0	114.1	L39 K40	L39-W42 PolarHBondContact O-N 3.27Å; L39-W42 VanDerWaalsContact O-N 3.12Å; K40-W42 VanDerWaalsContact C-N 3.26Å; K40-W42 PolarHBondContact O-N 3.4Å
43	Y	76.4	Confident	70.9	Confident	170 Å²	170	120.8 Å²	120.8	67%	0.667	61%	0.613	S	S	*	*	H	α-helix	trans	-97.7	-10.3	179.5	82.6	-103.7	0	0	114.2	L39 K40	L39-Y43 WeakPolarHBondContact O-CD1 3.2Å; L39-Y43 PolarHBondContact O-N 3.44Å; K40-Y43 HydrophobicContact CB-CE1 3.96Å; K40-Y43 HydrophobicContact CG-CE1 3.81Å; K40-Y43 PolarHBondContact O-N 3.42Å
44	S	75.1	Confident	70.8	Confident	67 Å²	67	120.5 Å²	120.5	47%	0.469	63%	0.628	S	S	.	*	S	Bend	trans	-70.5	150.9	-177.6	70.1	0	0	0	113	K40 E41 F46	K40-S44 WeakPolarHBondContact O-CB 3.29Å; K40-S44 PolarHBondContact O-N 3.12Å; K40-S44 PolarHBondContact O-OG 3.26Å; E41-S44 PolarHBondContact O-OG 3.26Å; S44-F46 PolarHBondContact O-N 3.48Å
45	S	76.6	Confident	70.5	Confident	86 Å²	86	125.1 Å²	125.1	60%	0.601	64%	0.637	S	S	*	*			trans	-61.1	131.8	173	-43.4	0	0	0	110	E47	S45-E47 PolarHBondContact O-N 3.43Å
46	F	77.2	Confident	70.4	Confident	178 Å²	178	128 Å²	128	78%	0.781	65%	0.648	S	S	*	*			trans	-72.5	115	175.6	179.7	-98.4	0	0	110.8	S44 C48	S44-F46 PolarHBondContact O-N 3.48Å; F46-C48 HydrophobicContact CE1-CB 4.25Å
47	E	79.9	Confident	70.1	Confident	86 Å²	86	127 Å²	127	40%	0.402	65%	0.65	S	S	.	*			trans	-113.3	43.4	175.7	-67.4	-158.5	-168	0	112.4	S45 G49 F50 S52	S45-E47 PolarHBondContact O-N 3.43Å; E47-G49 PolarHBondContact O-N 3.09Å; E47-F50 PolarHBondContact O-N 3.14Å; E47-S52 VanDerWaalsContact CD-CB 3.47Å; E47-S52 WeakPolarHBondContact OE1-CB 3.29Å; E47-S52 WeakPolarHBondContact OE2-CA 3.17Å
48	C	78.4	Confident	70.2	Confident	95 Å²	95	129.1 Å²	129.1	64%	0.642	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.6	26.3	177.4	-62.6	0	0	0	114.5	F46 F50	F46-C48 HydrophobicContact CE1-CB 4.25Å; C48-F50 HydrophobicContact CB-CD2 4.46Å
49	G	78	Confident	70.2	Confident	76 Å²	76	134.1 Å²	134.1	78%	0.784	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	86.5	1.9	-178.3	0	0	0	0	115.1	E47	E47-G49 PolarHBondContact O-N 3.09Å
50	F	74.8	Confident	70.2	Confident	166 Å²	166	136.9 Å²	136.9	73%	0.728	68%	0.683	S	S	*	*	S	Bend	trans	-89.8	156.7	171.4	-65.6	-82.6	0	0	111.5	E47 C48	E47-F50 PolarHBondContact O-N 3.14Å; C48-F50 HydrophobicContact CB-CD2 4.46Å
51	L	72.5	Confident	70.9	Confident	137 Å²	137	133.8 Å²	133.8	72%	0.717	68%	0.677	S	S	*	*			trans	-74.6	133.6	171.5	-85.3	147.8	0	0	109.4	H53	L51-H53 PolarHBondContact O-CD2 2.89Å; L51-H53 PolarHBondContact O-N 3.38Å
52	S	67.5	Low	71.7	Confident	85 Å²	85	133.6 Å²	133.6	59%	0.594	67%	0.674	S	S	*	*			trans	-61.7	104.6	174.9	67.5	0	0	0	110.7	E47	E47-S52 VanDerWaalsContact CD-CB 3.47Å; E47-S52 WeakPolarHBondContact OE1-CB 3.29Å; E47-S52 WeakPolarHBondContact OE2-CA 3.17Å
53	H	61.8	Low	72.5	Confident	170 Å²	170	125.3 Å²	125.3	79%	0.787	65%	0.654	S	S	*	*			trans	-107.4	111.3	175.7	-75.9	-66.7	0	0	109.3	L51	L51-H53 PolarHBondContact O-CD2 2.89Å; L51-H53 PolarHBondContact O-N 3.38Å
54	G	62.1	Low	73.2	Confident	67 Å²	67	123.9 Å²	123.9	69%	0.691	65%	0.648	S	S	*	*	S	Bend	trans	118.6	150.5	173.8	0	0	0	0	113.4
55	Y	59	Low	74	Confident	218 Å²	218	125.3 Å²	125.3	86%	0.855	65%	0.65	S	S	*	*	S	Bend	trans	-56	140.3	156.2	-65.1	-83.7	0	0	106.9	E57	Y55-E57 PolarHBondContact O-N 3.45Å
56	K	59.8	Low	74.9	Confident	183 Å²	183	125 Å²	125	80%	0.796	64%	0.641	S	S	*	*			trans	-49.9	85.9	176.2	-92.3	-177	170.4	178.1	110.4	N58	K56-N58 VanDerWaalsContact C-N 3.32Å; K56-N58 PolarHBondContact O-N 2.8Å
57	E	57.2	Low	75.7	Confident	139 Å²	139	121.8 Å²	121.8	65%	0.65	63%	0.631	S	S	*	*			trans	-82	92.3	173.4	-89.1	-179	155.8	0	105.2	Y55 F59	Y55-E57 PolarHBondContact O-N 3.45Å; E57-F59 HydrophobicContact CB-CD2 3.96Å; E57-F59 HydrophobicContact CB-CE2 3.51Å; E57-F59 HydrophobicContact CB-CZ 3.93Å; E57-F59 HydrophobicContact CG-CE2 4.49Å; E57-F59 HydrophobicContact CG-CZ 4.48Å; E57-F59 VanDerWaalsContact O-CD2 3.27Å; E57-F59 WeakPolarHBondContact O-CD2 3.47Å; E57-F59 PolarHBondContact O-N 2.88Å; E57-F59 VanDerWaalsContact OE2-CZ 3.28Å; E57-F59 WeakPolarHBondContact OE2-CZ 3.34Å
58	N	67.2	Low	76.5	Confident	120 Å²	120	123 Å²	123	64%	0.642	64%	0.64	S	S	*	*			trans	-64.5	84.5	168.1	-71.2	-30.5	0	0	107.6	K56 F60	K56-N58 VanDerWaalsContact C-N 3.32Å; K56-N58 PolarHBondContact O-N 2.8Å; N58-F60 HydrophobicContact CB-CD2 3.74Å; N58-F60 HydrophobicContact CB-CE2 3.99Å; N58-F60 PolarHBondContact O-N 3.15Å
59	F	66.4	Low	77.4	Confident	179 Å²	179	122 Å²	122	79%	0.785	63%	0.631	S	S	*	*			trans	-69.8	59.4	169.5	-69.1	-78.1	0	0	110	E57 S61	E57-F59 HydrophobicContact CB-CD2 3.96Å; E57-F59 HydrophobicContact CB-CE2 3.51Å; E57-F59 HydrophobicContact CB-CZ 3.93Å; E57-F59 HydrophobicContact CG-CE2 4.49Å; E57-F59 HydrophobicContact CG-CZ 4.48Å; E57-F59 VanDerWaalsContact O-CD2 3.27Å; E57-F59 WeakPolarHBondContact O-CD2 3.47Å; E57-F59 PolarHBondContact O-N 2.88Å; E57-F59 VanDerWaalsContact OE2-CZ 3.28Å; E57-F59 WeakPolarHBondContact OE2-CZ 3.34Å; F59-S61 PolarHBondContact O-N 3.25Å
60	F	70.4	Confident	78.3	Confident	143 Å²	143	122.8 Å²	122.8	63%	0.627	62%	0.617	S	S	*	*			trans	-73.9	114.3	166.8	-78.7	-71.8	0	0	107.7	N58 Y64	N58-F60 HydrophobicContact CB-CD2 3.74Å; N58-F60 HydrophobicContact CB-CE2 3.99Å; N58-F60 PolarHBondContact O-N 3.15Å; F60-Y64 HydrophobicContact CB-CD2 4.33Å; F60-Y64 AromaticContact CD1-CD2 3.7Å; F60-Y64 HydrophobicContact CD1-CD2 3.7Å; F60-Y64 AromaticContact CD1-CE2 3.93Å; F60-Y64 HydrophobicContact CD1-CE2 3.93Å; F60-Y64 HydrophobicContact CD1-CG 4.26Å
61	S	82.4	Confident	79.4	Confident	58 Å²	58	121.4 Å²	121.4	41%	0.406	61%	0.611	S	S	.	*			trans	-58.2	146.1	171.8	67.7	0	0	0	110.2	F59 S63 Y64	F59-S61 PolarHBondContact O-N 3.25Å; S61-S63 PolarHBondContact O-N 3.42Å; S61-S63 WeakPolarHBondContact OG-CB 3.43Å; S61-Y64 WeakPolarHBondContact O-CD2 3.45Å; S61-Y64 PolarHBondContact O-N 3.17Å; S61-Y64 WeakPolarHBondContact OG-CD2 3.35Å
62	F	87	Confident	80.7	Confident	138 Å²	138	118.6 Å²	118.6	61%	0.605	60%	0.599	S	S	*	*	H	α-helix	trans	-53.1	-21.5	174.2	-175.1	-104.2	0	0	113.3	Y64 L65 N66	F62-Y64 VanDerWaalsContact C-N 3.27Å; F62-Y64 PolarHBondContact O-N 3.26Å; F62-L65 HydrophobicContact CD2-CB 4.48Å; F62-L65 HydrophobicContact CD2-CD2 4.46Å; F62-L65 HydrophobicContact CE2-CD2 3.84Å; F62-L65 HydrophobicContact CZ-CD2 4.21Å; F62-L65 WeakPolarHBondContact O-CB 3.12Å; F62-L65 PolarHBondContact O-N 3.42Å; F62-L65 VanDerWaalsContact O-N 3.1Å; F62-N66 VanDerWaalsContact CE1-ND2 3.32Å; F62-N66 WeakPolarHBondContact CE1-ND2 3.22Å; F62-N66 WeakPolarHBondContact CE1-OD1 3.28Å; F62-N66 PolarHBondContact O-N 3.37Å
63	S	92.1	Very high	82.1	Confident	71 Å²	71	118.7 Å²	118.7	50%	0.497	60%	0.596	S	S	.	*	H	α-helix	trans	-53.3	-38.6	173.6	-48.4	0	0	0	113.6	S61 N66 L67	S61-S63 PolarHBondContact O-N 3.42Å; S61-S63 WeakPolarHBondContact OG-CB 3.43Å; S63-N66 PolarHBondContact O-N 2.93Å; S63-L67 WeakPolarHBondContact O-CG 3.43Å; S63-L67 PolarHBondContact O-N 3.42Å
64	Y	91.7	Very high	83.8	Confident	140 Å²	140	116.1 Å²	116.1	55%	0.549	58%	0.583	S	S	.	*	H	α-helix	trans	-68.7	-36.9	178.6	-67.8	-72.8	0	0	112.1	F60 S61 F62 L67 L68	F60-Y64 HydrophobicContact CB-CD2 4.33Å; F60-Y64 AromaticContact CD1-CD2 3.7Å; F60-Y64 HydrophobicContact CD1-CD2 3.7Å; F60-Y64 AromaticContact CD1-CE2 3.93Å; F60-Y64 HydrophobicContact CD1-CE2 3.93Å; F60-Y64 HydrophobicContact CD1-CG 4.26Å; S61-Y64 WeakPolarHBondContact O-CD2 3.45Å; S61-Y64 PolarHBondContact O-N 3.17Å; S61-Y64 WeakPolarHBondContact OG-CD2 3.35Å; F62-Y64 VanDerWaalsContact C-N 3.27Å; F62-Y64 PolarHBondContact O-N 3.26Å; Y64-L67 PolarHBondContact O-N 2.83Å; Y64-L68 WeakPolarHBondContact O-CB 3.26Å; Y64-L68 PolarHBondContact O-N 2.77Å
65	L	92.1	Very high	85.5	Confident	97 Å²	97	117.3 Å²	117.3	51%	0.508	57%	0.573	S	S	.	*	H	α-helix	trans	-66.2	-43.7	175.1	-172.5	151	0	0	110.4	F62 L67 L68 V69	F62-L65 HydrophobicContact CD2-CB 4.48Å; F62-L65 HydrophobicContact CD2-CD2 4.46Å; F62-L65 HydrophobicContact CE2-CD2 3.84Å; F62-L65 HydrophobicContact CZ-CD2 4.21Å; F62-L65 WeakPolarHBondContact O-CB 3.12Å; F62-L65 PolarHBondContact O-N 3.42Å; F62-L65 VanDerWaalsContact O-N 3.1Å; L65-L67 PolarHBondContact O-N 3.4Å; L65-L68 PolarHBondContact O-N 3.42Å; L65-V69 HydrophobicContact CD2-CG2 4.14Å; L65-V69 WeakPolarHBondContact O-CG2 3.44Å; L65-V69 PolarHBondContact O-N 3.43Å
66	N	94.9	Very high	87.4	Confident	79 Å²	79	111.9 Å²	111.9	42%	0.422	56%	0.559	S	S	.	*	H	α-helix	trans	-60	-43.6	174	-90.2	-14.8	0	0	112.5	F62 S63 L68 V69 L70	F62-N66 VanDerWaalsContact CE1-ND2 3.32Å; F62-N66 WeakPolarHBondContact CE1-ND2 3.22Å; F62-N66 WeakPolarHBondContact CE1-OD1 3.28Å; F62-N66 PolarHBondContact O-N 3.37Å; S63-N66 PolarHBondContact O-N 2.93Å; N66-L68 VanDerWaalsContact C-N 3.3Å; N66-L68 PolarHBondContact O-N 2.97Å; N66-V69 PolarHBondContact O-N 2.87Å; N66-L70 WeakPolarHBondContact O-CG 3.35Å; N66-L70 PolarHBondContact O-N 3.02Å
67	L	95.4	Very high	89.1	Confident	110 Å²	110	108 Å²	108	58%	0.576	54%	0.543	S	S	*	.	H	α-helix	trans	-61.2	-40	175.9	-77.9	169.1	0	0	111.7	S63 Y64 L65 L70 F71	S63-L67 WeakPolarHBondContact O-CG 3.43Å; S63-L67 PolarHBondContact O-N 3.42Å; Y64-L67 PolarHBondContact O-N 2.83Å; L65-L67 PolarHBondContact O-N 3.4Å; L67-L70 PolarHBondContact O-N 3.08Å; L67-F71 VanDerWaalsContact O-CB 3.27Å; L67-F71 WeakPolarHBondContact O-CB 3.37Å; L67-F71 PolarHBondContact O-N 3.48Å
68	L	96.3	Very high	91	Very high	112 Å²	112	105.1 Å²	105.1	59%	0.586	54%	0.535	S	S	*	.	H	α-helix	trans	-65.5	-42.9	177.4	-167.8	153.3	0	0	111.6	Y64 L65 N66 F71 V72	Y64-L68 WeakPolarHBondContact O-CB 3.26Å; Y64-L68 PolarHBondContact O-N 2.77Å; L65-L68 PolarHBondContact O-N 3.42Å; N66-L68 VanDerWaalsContact C-N 3.3Å; N66-L68 PolarHBondContact O-N 2.97Å; L68-F71 WeakPolarHBondContact O-CB 3.41Å; L68-F71 PolarHBondContact O-N 2.89Å; L68-V72 HydrophobicContact CD2-CG2 4.32Å; L68-V72 WeakPolarHBondContact O-CG2 3.37Å; L68-V72 PolarHBondContact O-N 2.93Å; L68-V72 VanDerWaalsContact O-N 3.1Å
69	V	97.2	Very high	92.3	Very high	75 Å²	75	102.6 Å²	102.6	46%	0.455	53%	0.527	S	S	.	.	H	α-helix	trans	-62.5	-46.4	176.3	173.1	0	0	0	110.9	L65 N66 F71 V72 V73	L65-V69 HydrophobicContact CD2-CG2 4.14Å; L65-V69 WeakPolarHBondContact O-CG2 3.44Å; L65-V69 PolarHBondContact O-N 3.43Å; N66-V69 PolarHBondContact O-N 2.87Å; V69-F71 VanDerWaalsContact C-N 3.34Å; V69-F71 PolarHBondContact O-N 3.32Å; V69-V72 PolarHBondContact O-N 2.87Å; V69-V73 WeakPolarHBondContact O-CG2 3.3Å; V69-V73 PolarHBondContact O-N 3.01Å; V69-V73 VanDerWaalsContact O-N 3.15Å
70	L	97.3	Very high	93.6	Very high	91 Å²	91	99.2 Å²	99.2	48%	0.476	52%	0.516	S	S	.	.	H	α-helix	trans	-62.6	-41.3	176.8	-72.4	172.6	0	0	111.8	N66 L67 V72 V73 F74	N66-L70 WeakPolarHBondContact O-CG 3.35Å; N66-L70 PolarHBondContact O-N 3.02Å; L67-L70 PolarHBondContact O-N 3.08Å; L70-V72 VanDerWaalsContact C-N 3.33Å; L70-V72 PolarHBondContact O-N 2.84Å; L70-V73 PolarHBondContact O-N 2.89Å; L70-F74 HydrophobicContact CB-CD2 4.26Å; L70-F74 HydrophobicContact CB-CE2 4.26Å; L70-F74 HydrophobicContact CD2-CE2 4.14Å; L70-F74 WeakPolarHBondContact O-CD2 3.42Å; L70-F74 PolarHBondContact O-N 3.41Å
71	F	97.8	Very high	94.6	Very high	137 Å²	137	96.6 Å²	96.6	60%	0.601	51%	0.508	S	S	*	.	H	α-helix	trans	-55.9	-47.3	176.3	169.5	-101.8	0	0	111.6	L67 L68 V69 V73 F74 D75	L67-F71 VanDerWaalsContact O-CB 3.27Å; L67-F71 WeakPolarHBondContact O-CB 3.37Å; L67-F71 PolarHBondContact O-N 3.48Å; L68-F71 WeakPolarHBondContact O-CB 3.41Å; L68-F71 PolarHBondContact O-N 2.89Å; V69-F71 VanDerWaalsContact C-N 3.34Å; V69-F71 PolarHBondContact O-N 3.32Å; F71-V73 PolarHBondContact O-N 3Å; F71-F74 PolarHBondContact O-N 2.95Å; F71-D75 WeakPolarHBondContact O-CB 3.48Å; F71-D75 PolarHBondContact O-N 3.37Å
72	V	98.4	Very high	95	Very high	79 Å²	79	98 Å²	98	48%	0.479	51%	0.51	S	S	.	.	H	α-helix	trans	-64	-41.4	179.2	173.6	0	0	0	111.9	L68 V69 L70 L76	L68-V72 HydrophobicContact CD2-CG2 4.32Å; L68-V72 WeakPolarHBondContact O-CG2 3.37Å; L68-V72 PolarHBondContact O-N 2.93Å; L68-V72 VanDerWaalsContact O-N 3.1Å; V69-V72 PolarHBondContact O-N 2.87Å; L70-V72 VanDerWaalsContact C-N 3.33Å; L70-V72 PolarHBondContact O-N 2.84Å; V72-L76 PolarHBondContact O-N 3.41Å
73	V	98	Very high	95.1	Very high	86 Å²	86	97 Å²	97	52%	0.521	51%	0.506	S	S	.	.	H	α-helix	trans	-65.2	-47.2	179.1	173.9	0	0	0	111	V69 L70 F71 D75 L76 E77	V69-V73 WeakPolarHBondContact O-CG2 3.3Å; V69-V73 PolarHBondContact O-N 3.01Å; V69-V73 VanDerWaalsContact O-N 3.15Å; L70-V73 PolarHBondContact O-N 2.89Å; F71-V73 PolarHBondContact O-N 3Å; V73-D75 PolarHBondContact O-N 2.89Å; V73-L76 PolarHBondContact O-N 3.37Å; V73-E77 PolarHBondContact O-N 3.05Å; V73-E77 VanDerWaalsContact O-N 3.07Å
74	F	98	Very high	94.9	Very high	116 Å²	116	96.2 Å²	96.2	51%	0.509	50%	0.498	S	S	.	.	H	α-helix	trans	-69	-32.6	-179.1	-75.2	-58	0	0	112.9	L70 F71 L76 E77 V78	L70-F74 HydrophobicContact CB-CD2 4.26Å; L70-F74 HydrophobicContact CB-CE2 4.26Å; L70-F74 HydrophobicContact CD2-CE2 4.14Å; L70-F74 WeakPolarHBondContact O-CD2 3.42Å; L70-F74 PolarHBondContact O-N 3.41Å; F71-F74 PolarHBondContact O-N 2.95Å; F74-L76 VanDerWaalsContact C-N 3.3Å; F74-L76 PolarHBondContact O-N 2.81Å; F74-E77 WeakPolarHBondContact CD1-OE2 3.33Å; F74-E77 PolarHBondContact O-N 3.36Å; F74-V78 WeakPolarHBondContact O-CG2 3.38Å; F74-V78 PolarHBondContact O-N 3.47Å
75	D	97.8	Very high	94.6	Very high	92 Å²	92	93.9 Å²	93.9	49%	0.492	50%	0.499	S	S	.	.	H	α-helix	trans	-63.4	-38.3	174.9	-168.8	42	0	0	111.8	F71 V73 S79	F71-D75 WeakPolarHBondContact O-CB 3.48Å; F71-D75 PolarHBondContact O-N 3.37Å; V73-D75 PolarHBondContact O-N 2.89Å; D75-S79 WeakPolarHBondContact O-CB 3.27Å; D75-S79 PolarHBondContact O-N 3.45Å; D75-S79 PolarHBondContact O-OG 2.94Å
76	L	97.2	Very high	94.3	Very high	105 Å²	105	97.2 Å²	97.2	55%	0.55	51%	0.509	S	S	.	.	H	α-helix	trans	-69	-41.6	175.7	-141.7	170.7	0	0	111.5	V72 V73 F74 S79 L80	V72-L76 PolarHBondContact O-N 3.41Å; V73-L76 PolarHBondContact O-N 3.37Å; F74-L76 VanDerWaalsContact C-N 3.3Å; F74-L76 PolarHBondContact O-N 2.81Å; L76-S79 PolarHBondContact O-N 3.37Å; L76-L80 HydrophobicContact CD2-CD1 3.59Å; L76-L80 HydrophobicContact CD2-CG 4.2Å; L76-L80 PolarHBondContact O-N 3.45Å
77	E	96.6	Very high	93.8	Very high	102 Å²	102	97 Å²	97	48%	0.477	51%	0.508	S	S	.	.	H	α-helix	trans	-61.1	-45.7	176.2	-172.7	-179.3	179.7	0	111.8	V73 F74 S79 L80 L81	V73-E77 PolarHBondContact O-N 3.05Å; V73-E77 VanDerWaalsContact O-N 3.07Å; F74-E77 WeakPolarHBondContact CD1-OE2 3.33Å; F74-E77 PolarHBondContact O-N 3.36Å; E77-S79 VanDerWaalsContact C-N 3.32Å; E77-S79 PolarHBondContact O-N 2.98Å; E77-L80 PolarHBondContact O-N 3.32Å; E77-L81 HydrophobicContact CG-CD1 4.17Å; E77-L81 PolarHBondContact O-N 3.02Å
78	V	96.3	Very high	92.8	Very high	78 Å²	78	92.3 Å²	92.3	47%	0.473	49%	0.486	S	S	.	.	H	α-helix	trans	-62.8	-40.6	177.5	171.6	0	0	0	111.1	F74 L80 L81 L82	F74-V78 WeakPolarHBondContact O-CG2 3.38Å; F74-V78 PolarHBondContact O-N 3.47Å; V78-L80 VanDerWaalsContact C-N 3.33Å; V78-L80 PolarHBondContact O-N 2.97Å; V78-L81 PolarHBondContact O-N 2.93Å; V78-L82 HydrophobicContact CG1-CD1 4.09Å; V78-L82 WeakPolarHBondContact O-CB 3.37Å; V78-L82 PolarHBondContact O-N 3.26Å
79	S	95.5	Very high	91.6	Very high	67 Å²	67	91.2 Å²	91.2	47%	0.469	48%	0.48	S	S	.	.	H	α-helix	trans	-61.9	-40.4	176.6	-64.1	0	0	0	112.4	D75 L76 E77 K83	D75-S79 WeakPolarHBondContact O-CB 3.27Å; D75-S79 PolarHBondContact O-N 3.45Å; D75-S79 PolarHBondContact O-OG 2.94Å; L76-S79 PolarHBondContact O-N 3.37Å; E77-S79 VanDerWaalsContact C-N 3.32Å; E77-S79 PolarHBondContact O-N 2.98Å; S79-K83 PolarHBondContact O-N 3.46Å
80	L	93.3	Very high	90	Very high	107 Å²	107	94.9 Å²	94.9	56%	0.56	49%	0.485	S	S	*	.	H	α-helix	trans	-68.1	-43.4	175	-82.7	158	0	0	112.1	L76 E77 V78 L82 K83 V84	L76-L80 HydrophobicContact CD2-CD1 3.59Å; L76-L80 HydrophobicContact CD2-CG 4.2Å; L76-L80 PolarHBondContact O-N 3.45Å; E77-L80 PolarHBondContact O-N 3.32Å; V78-L80 VanDerWaalsContact C-N 3.33Å; V78-L80 PolarHBondContact O-N 2.97Å; L80-L82 VanDerWaalsContact C-N 3.32Å; L80-L82 PolarHBondContact O-N 3.45Å; L80-K83 WeakPolarHBondContact O-CB 3.43Å; L80-K83 PolarHBondContact O-N 3.32Å; L80-V84 PolarHBondContact O-N 2.93Å
81	L	91.6	Very high	88.3	Confident	88 Å²	88	97.5 Å²	97.5	46%	0.461	49%	0.493	S	S	.	.	H	α-helix	trans	-60.5	-42.5	176.1	-81.4	165.9	0	0	111.6	E77 V78 K83 V84 V85	E77-L81 HydrophobicContact CG-CD1 4.17Å; E77-L81 PolarHBondContact O-N 3.02Å; V78-L81 PolarHBondContact O-N 2.93Å; L81-K83 VanDerWaalsContact C-N 3.29Å; L81-K83 PolarHBondContact O-N 2.94Å; L81-V84 PolarHBondContact O-N 3.3Å; L81-V85 WeakPolarHBondContact O-CG2 3.41Å; L81-V85 PolarHBondContact O-N 3.42Å
82	L	91	Very high	86.6	Confident	87 Å²	87	99.5 Å²	99.5	46%	0.455	50%	0.498	S	S	.	.	H	α-helix	trans	-57.3	-42.4	175.1	-105.1	148.2	0	0	111.9	V78 L80 V84 V85 F86	V78-L82 HydrophobicContact CG1-CD1 4.09Å; V78-L82 WeakPolarHBondContact O-CB 3.37Å; V78-L82 PolarHBondContact O-N 3.26Å; L80-L82 VanDerWaalsContact C-N 3.32Å; L80-L82 PolarHBondContact O-N 3.45Å; L82-V84 PolarHBondContact O-N 2.95Å; L82-V85 PolarHBondContact O-N 3Å; L82-F86 HydrophobicContact CD2-CD2 3.99Å; L82-F86 HydrophobicContact CD2-CE2 3.35Å; L82-F86 HydrophobicContact CD2-CZ 4.16Å; L82-F86 WeakPolarHBondContact O-CD2 3.36Å; L82-F86 PolarHBondContact O-N 3.32Å
83	K	89.4	Confident	84.9	Confident	117 Å²	117	100.5 Å²	100.5	51%	0.509	50%	0.504	S	S	.	.	H	α-helix	trans	-61.1	-43.3	177.1	-178.9	54.5	174.2	157	112	S79 L80 L81 V85 F86 D87	S79-K83 PolarHBondContact O-N 3.46Å; L80-K83 WeakPolarHBondContact O-CB 3.43Å; L80-K83 PolarHBondContact O-N 3.32Å; L81-K83 VanDerWaalsContact C-N 3.29Å; L81-K83 PolarHBondContact O-N 2.94Å; K83-V85 VanDerWaalsContact C-N 3.35Å; K83-V85 PolarHBondContact O-N 3.44Å; K83-F86 PolarHBondContact O-N 2.94Å; K83-D87 WeakPolarHBondContact CE-OD2 3.1Å; K83-D87 VanDerWaalsContact NZ-CG 3.31Å; K83-D87 IonicContact NZ-OD1 2.71Å; K83-D87 PolarHBondContact NZ-OD1 3.02Å; K83-D87 IonicContact NZ-OD2 3.16Å; K83-D87 PolarHBondContact NZ-OD2 3.33Å; K83-D87 VanDerWaalsContact NZ-OD2 3.16Å; K83-D87 PolarHBondContact O-N 3.39Å
84	V	87	Confident	83.1	Confident	56 Å²	56	105.3 Å²	105.3	34%	0.339	52%	0.515	S	S	.	.	H	α-helix	trans	-64.2	-39.4	178.6	175.3	0	0	0	112	L80 L81 L82 W90	L80-V84 PolarHBondContact O-N 2.93Å; L81-V84 PolarHBondContact O-N 3.3Å; L82-V84 PolarHBondContact O-N 2.95Å; V84-W90 VanDerWaalsContact CG1-CD1 3.46Å; V84-W90 VanDerWaalsContact CG1-NE1 3.3Å
85	V	85.3	Confident	80.7	Confident	91 Å²	91	113.2 Å²	113.2	55%	0.552	54%	0.541	S	S	*	.	H	α-helix	trans	-64.1	-43.1	175.7	174.9	0	0	0	110.8	L81 L82 K83 G88	L81-V85 WeakPolarHBondContact O-CG2 3.41Å; L81-V85 PolarHBondContact O-N 3.42Å; L82-V85 PolarHBondContact O-N 3Å; K83-V85 VanDerWaalsContact C-N 3.35Å; K83-V85 PolarHBondContact O-N 3.44Å; V85-G88 PolarHBondContact O-N 3.01Å
86	F	85.8	Confident	79.9	Confident	166 Å²	166	114.3 Å²	114.3	73%	0.728	54%	0.544	S	S	*	.	H	α-helix	trans	-71.5	-34.8	-179.9	-80.3	-59.2	0	0	114.4	L82 K83 G88	L82-F86 HydrophobicContact CD2-CD2 3.99Å; L82-F86 HydrophobicContact CD2-CE2 3.35Å; L82-F86 HydrophobicContact CD2-CZ 4.16Å; L82-F86 WeakPolarHBondContact O-CD2 3.36Å; L82-F86 PolarHBondContact O-N 3.32Å; K83-F86 PolarHBondContact O-N 2.94Å; F86-G88 PolarHBondContact O-N 3.06Å
87	D	85.5	Confident	79	Confident	76 Å²	76	114.8 Å²	114.8	41%	0.406	54%	0.543	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71.7	-5.7	175.8	-75.9	-15.3	0	0	112.3	K83 I89	K83-D87 WeakPolarHBondContact CE-OD2 3.1Å; K83-D87 VanDerWaalsContact NZ-CG 3.31Å; K83-D87 IonicContact NZ-OD1 2.71Å; K83-D87 PolarHBondContact NZ-OD1 3.02Å; K83-D87 IonicContact NZ-OD2 3.16Å; K83-D87 PolarHBondContact NZ-OD2 3.33Å; K83-D87 VanDerWaalsContact NZ-OD2 3.16Å; K83-D87 PolarHBondContact O-N 3.39Å; D87-I89 HydrophobicContact CB-CD1 3.49Å; D87-I89 VanDerWaalsContact CB-CD1 3.49Å; D87-I89 PolarHBondContact O-N 3.31Å; D87-I89 VanDerWaalsContact O-N 3.08Å
88	G	74.5	Confident	78	Confident	10 Å²	10	115.5 Å²	115.5	10%	0.103	55%	0.547	C	S	.	.	T	Hydrogen-bonded Turn	trans	70.2	4.9	171.2	0	0	0	0	114.5	V85 F86 W90 F91 Y92	V85-G88 PolarHBondContact O-N 3.01Å; F86-G88 PolarHBondContact O-N 3.06Å; G88-W90 PolarHBondContact O-N 3.42Å; G88-F91 WeakPolarHBondContact O-CA 3.27Å; G88-F91 PolarHBondContact O-N 3.01Å; G88-Y92 WeakPolarHBondContact O-CD2 3.48Å; G88-Y92 WeakPolarHBondContact O-CE2 3.43Å; G88-Y92 PolarHBondContact O-N 3.49Å; G88-Y92 VanDerWaalsContact O-N 3.14Å
89	I	70.6	Confident	76.9	Confident	89 Å²	89	117.7 Å²	117.7	46%	0.456	55%	0.552	S	S	.	*	H	α-helix	trans	-45.7	-43.2	179.2	-87.8	80.8	0	0	110.4	D87 F91 Y92 T93	D87-I89 HydrophobicContact CB-CD1 3.49Å; D87-I89 VanDerWaalsContact CB-CD1 3.49Å; D87-I89 PolarHBondContact O-N 3.31Å; D87-I89 VanDerWaalsContact O-N 3.08Å; I89-F91 PolarHBondContact O-N 2.82Å; I89-Y92 PolarHBondContact O-N 3.44Å; I89-T93 PolarHBondContact O-N 3.04Å; I89-T93 PolarHBondContact O-OG1 3.45Å
90	W	63.2	Low	75.7	Confident	152 Å²	152	120.9 Å²	120.9	58%	0.576	56%	0.557	S	S	*	*	H	α-helix	trans	-66.1	-39	-179.1	-75.2	43.3	0	0	112.6	V84 G88 T93 Y94	V84-W90 VanDerWaalsContact CG1-CD1 3.46Å; V84-W90 VanDerWaalsContact CG1-NE1 3.3Å; G88-W90 PolarHBondContact O-N 3.42Å; W90-T93 PolarHBondContact O-N 3.43Å; W90-Y94 WeakPolarHBondContact O-CD2 3.4Å
91	F	62.2	Low	74.6	Confident	146 Å²	146	121.8 Å²	121.8	64%	0.64	56%	0.556	S	S	*	*	H	α-helix	trans	-67.1	-36.5	176.5	-76.8	-75.5	0	0	112.6	G88 I89 T93 W95	G88-F91 WeakPolarHBondContact O-CA 3.27Å; G88-F91 PolarHBondContact O-N 3.01Å; I89-F91 PolarHBondContact O-N 2.82Å; F91-T93 VanDerWaalsContact C-N 3.28Å; F91-T93 PolarHBondContact O-N 2.86Å; F91-W95 PolarHBondContact O-N 2.95Å
92	Y	60.8	Low	73.3	Confident	179 Å²	179	124.2 Å²	124.2	70%	0.702	56%	0.563	S	S	*	*	H	α-helix	trans	-75.2	-13.8	178.1	-55.6	-67.5	0	0	114.1	G88 I89	G88-Y92 WeakPolarHBondContact O-CD2 3.48Å; G88-Y92 WeakPolarHBondContact O-CE2 3.43Å; G88-Y92 PolarHBondContact O-N 3.49Å; G88-Y92 VanDerWaalsContact O-N 3.14Å; I89-Y92 PolarHBondContact O-N 3.44Å
93	T	63.4	Low	72	Confident	100 Å²	100	127.1 Å²	127.1	61%	0.613	57%	0.572	S	S	*	*	H	α-helix	trans	-92.6	-21.8	-179	-34.3	0	0	0	112.5	I89 W90 F91	I89-T93 PolarHBondContact O-N 3.04Å; I89-T93 PolarHBondContact O-OG1 3.45Å; W90-T93 PolarHBondContact O-N 3.43Å; F91-T93 VanDerWaalsContact C-N 3.28Å; F91-T93 PolarHBondContact O-N 2.86Å
94	Y	60.1	Low	70.5	Confident	188 Å²	188	127.9 Å²	127.9	74%	0.737	58%	0.577	S	S	*	*	H	α-helix	trans	-109	-1.2	-177.9	-62.9	-69.1	0	0	114.4	W90	W90-Y94 WeakPolarHBondContact O-CD2 3.4Å
95	W	48.1	Very low	69	Low	282 Å²	282	134.5 Å²	134.5	100%	1.068	60%	0.598	S	S	*	*			trans	-116.1	0	167.7	-84.3	88.1	0	0	109.5	F91	F91-W95 PolarHBondContact O-N 2.95Å

Retrieved 95 of 95 residues in 78.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).