A0A3Q3DZT1_HIPCM Loading...

U6 snRNA-associated Sm-like protein LSm2

Binds specifically to the 3'-terminal U-tract of U6 snRNA. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB , UniProt , Accession A0A3Q3DZT1, Species HIPCM (Hippocampus comes, Tiger tail seahorse), Gene n/a, Length 95 aa.

						>A0A3Q3DZT1_HIPCM|A0A3Q3DZT1
MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEAMQQKQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	88.8	Confident	96.6	Very high	150 Å²	150	67.1 Å²	67.1	74%	0.739	35%	0.346	S	S	*	.				0	-16.9	0	-78.8	-66.1	-128.3	0	0	113.6	F3 Y4 S5 E89	M1-F3 PolarHBondContact O-N 2.75Å; M1-Y4 PolarHBondContact O-N 3.29Å; M1-Y4 HydrophobicContact SD-CD1 4.23Å; M1-S5 PolarHBondContact O-N 3.41Å; M1-S5 PolarHBondContact O-OG 2.88Å; M1-E89 PolarHBondContact N-OE1 3.28Å; M1-E89 PolarHBondContact N-OE2 3.05Å
2	L	96.1	Very high	96.6	Very high	28 Å²	28	65.8 Å²	65.8	15%	0.147	36%	0.362	C	S	.	.	H	α-helix	trans	-40.6	-63.2	-179.2	-175.8	66.1	0	0	0	114.9	Y4 S5 F6 A85 A86 E89	L2-Y4 PolarHBondContact O-N 3.42Å; L2-S5 PolarHBondContact O-N 3.03Å; L2-F6 WeakPolarHBondContact O-CB 3.49Å; L2-F6 PolarHBondContact O-N 3.16Å; L2-A85 HydrophobicContact CD1-CB 3.37Å; L2-A86 HydrophobicContact CD2-CB 4.09Å; L2-E89 HydrophobicContact CB-CB 4.29Å; L2-E89 HydrophobicContact CB-CG 3.96Å; L2-E89 PolarHBondContact N-OE2 3.28Å
3	F	97.3	Very high	96.7	Very high	119 Å²	119	66.2 Å²	66.2	52%	0.522	36%	0.358	S	S	.	.	H	α-helix	trans	-69.3	-31.2	-172	-68.3	-65.1	0	0	0	114.2	M1 F6 F7 L36	M1-F3 PolarHBondContact O-N 2.75Å; F3-F6 PolarHBondContact O-N 3.28Å; F3-F7 WeakPolarHBondContact O-CD2 2.98Å; F3-F7 PolarHBondContact O-N 3.02Å; F3-L36 HydrophobicContact CB-CD1 4.1Å; F3-L36 HydrophobicContact CB-CD2 4.24Å
4	Y	97.4	Very high	96.8	Very high	57 Å²	57	68.6 Å²	68.6	22%	0.224	37%	0.37	C	S	.	.	H	α-helix	trans	-62	-46.3	172.5	170.5	-118.2	0	0	0	111.2	M1 L2 K8 V32 D33	M1-Y4 PolarHBondContact O-N 3.29Å; M1-Y4 HydrophobicContact SD-CD1 4.23Å; L2-Y4 PolarHBondContact O-N 3.42Å; Y4-K8 HydrophobicContact CE2-CG 4.29Å; Y4-K8 PolarHBondContact O-N 3.05Å; Y4-K8 WeakPolarHBondContact OH-CE 3.44Å; Y4-K8 PolarHBondContact OH-NZ 3.44Å; Y4-V32 HydrophobicContact CD2-CG1 4.17Å; Y4-V32 HydrophobicContact CE2-CG1 4.28Å; Y4-D33 VanDerWaalsContact CD2-O 3.27Å; Y4-D33 WeakPolarHBondContact CD2-O 3.42Å
5	S	97.1	Very high	96.8	Very high	68 Å²	68	64.3 Å²	64.3	48%	0.476	35%	0.348	S	S	.	.	H	α-helix	trans	-66.9	-39.3	178.7	-51.9	0	0	0	0	111.4	M1 L2 K8 S9	M1-S5 PolarHBondContact O-N 3.41Å; M1-S5 PolarHBondContact O-OG 2.88Å; L2-S5 PolarHBondContact O-N 3.03Å; S5-K8 WeakPolarHBondContact O-CB 3.45Å; S5-K8 PolarHBondContact O-N 3.48Å; S5-S9 PolarHBondContact O-N 3.48Å
6	F	97.9	Very high	96.9	Very high	34 Å²	34	62.3 Å²	62.3	15%	0.149	34%	0.338	C	S	.	.	H	α-helix	trans	-59.8	-53.9	175	176.6	-108.1	0	0	0	111.9	L2 F3 K8 S9 L10 L72 V77 L82	L2-F6 WeakPolarHBondContact O-CB 3.49Å; L2-F6 PolarHBondContact O-N 3.16Å; F3-F6 PolarHBondContact O-N 3.28Å; F6-K8 VanDerWaalsContact C-N 3.26Å; F6-K8 PolarHBondContact O-N 3.03Å; F6-S9 WeakPolarHBondContact O-CB 3.24Å; F6-S9 PolarHBondContact O-N 2.92Å; F6-S9 PolarHBondContact O-OG 3.5Å; F6-L10 HydrophobicContact CD1-CD1 4.25Å; F6-L10 HydrophobicContact CE1-CD1 3.73Å; F6-L10 HydrophobicContact CE2-CD1 4.41Å; F6-L10 HydrophobicContact CZ-CD1 3.82Å; F6-L72 HydrophobicContact CE1-CD1 3.63Å; F6-L72 HydrophobicContact CZ-CD1 3.65Å; F6-V77 HydrophobicContact CE2-CG1 4.07Å; F6-V77 HydrophobicContact CE2-CG2 4.21Å; F6-V77 HydrophobicContact CZ-CG1 4.31Å; F6-V77 HydrophobicContact CZ-CG2 3.96Å; F6-L82 HydrophobicContact CD2-CD1 4.09Å; F6-L82 HydrophobicContact CE2-CD1 4.43Å
7	F	97.9	Very high	96.9	Very high	24 Å²	24	58.6 Å²	58.6	11%	0.105	32%	0.318	C	S	.	.	H	α-helix	trans	-65.8	-28.2	178.4	-76.8	-61	0	0	0	113.2	F3 S9 L10 L29 V32 L36 V70	F3-F7 WeakPolarHBondContact O-CD2 2.98Å; F3-F7 PolarHBondContact O-N 3.02Å; F7-S9 VanDerWaalsContact C-N 3.28Å; F7-S9 PolarHBondContact O-N 3.39Å; F7-L10 HydrophobicContact CD1-CD1 4.09Å; F7-L10 PolarHBondContact O-N 3.41Å; F7-L29 HydrophobicContact CD1-CD2 4.48Å; F7-L29 WeakPolarHBondContact O-CD2 3.18Å; F7-V32 HydrophobicContact CB-CB 4.06Å; F7-V32 HydrophobicContact CB-CG1 3.78Å; F7-V32 HydrophobicContact CB-CG2 3.88Å; F7-V32 HydrophobicContact CG-CG2 4.5Å; F7-L36 HydrophobicContact CD2-CD2 4.28Å; F7-V70 HydrophobicContact CE1-CB 4.2Å; F7-V70 HydrophobicContact CE1-CG1 4.08Å; F7-V70 HydrophobicContact CE1-CG2 4.22Å; F7-V70 HydrophobicContact CZ-CB 4.33Å; F7-V70 HydrophobicContact CZ-CG2 4.08Å
8	K	97.3	Very high	97	Very high	111 Å²	111	57.4 Å²	57.4	48%	0.483	31%	0.31	S	S	.	.	H	α-helix	trans	-61.1	-36.5	170.1	-89.1	-150.7	-176.6	173.4	0	113	Y4 S5 F6 L10 V11 V32	Y4-K8 HydrophobicContact CE2-CG 4.29Å; Y4-K8 PolarHBondContact O-N 3.05Å; Y4-K8 WeakPolarHBondContact OH-CE 3.44Å; Y4-K8 PolarHBondContact OH-NZ 3.44Å; S5-K8 WeakPolarHBondContact O-CB 3.45Å; S5-K8 PolarHBondContact O-N 3.48Å; F6-K8 VanDerWaalsContact C-N 3.26Å; F6-K8 PolarHBondContact O-N 3.03Å; K8-L10 PolarHBondContact O-N 3.17Å; K8-V11 WeakPolarHBondContact O-CG2 3.47Å; K8-V11 PolarHBondContact O-N 3.42Å; K8-V32 HydrophobicContact CG-CG1 3.83Å
9	S	97.1	Very high	97	Very high	79 Å²	79	55.3 Å²	55.3	55%	0.552	30%	0.298	S	S	*	.	H	α-helix	trans	-67.2	-20.5	177.9	73.5	0	0	0	0	113.2	S5 F6 F7	S5-S9 PolarHBondContact O-N 3.48Å; F6-S9 WeakPolarHBondContact O-CB 3.24Å; F6-S9 PolarHBondContact O-N 2.92Å; F6-S9 PolarHBondContact O-OG 3.5Å; F7-S9 VanDerWaalsContact C-N 3.28Å; F7-S9 PolarHBondContact O-N 3.39Å
10	L	97.6	Very high	97	Very high	1 Å²	1	58.9 Å²	58.9	1%	0.005	31%	0.311	C	S	.	.	T	Hydrogen-bonded Turn	trans	-94.5	4.2	-179.2	-61	170.3	0	0	0	113.2	F6 F7 K8 G12 K13 L29 L72 E76	F6-L10 HydrophobicContact CD1-CD1 4.25Å; F6-L10 HydrophobicContact CE1-CD1 3.73Å; F6-L10 HydrophobicContact CE2-CD1 4.41Å; F6-L10 HydrophobicContact CZ-CD1 3.82Å; F7-L10 HydrophobicContact CD1-CD1 4.09Å; F7-L10 PolarHBondContact O-N 3.41Å; K8-L10 PolarHBondContact O-N 3.17Å; L10-G12 PolarHBondContact O-N 3.09Å; L10-K13 VanDerWaalsContact O-CB 3.28Å; L10-K13 WeakPolarHBondContact O-CB 2.94Å; L10-K13 WeakPolarHBondContact O-CG 3.5Å; L10-K13 PolarHBondContact O-N 2.69Å; L10-L29 HydrophobicContact CB-CD2 3.86Å; L10-L72 HydrophobicContact CD1-CD1 3.75Å; L10-L72 HydrophobicContact CD1-CD2 3.78Å; L10-L72 HydrophobicContact CD1-CG 4.38Å; L10-E76 HydrophobicContact CD2-CB 3.79Å
11	V	97.9	Very high	96.9	Very high	67 Å²	67	60.4 Å²	60.4	41%	0.406	32%	0.319	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.2	130.4	176.4	171	0	0	0	0	109.7	K8 L29 H30	K8-V11 WeakPolarHBondContact O-CG2 3.47Å; K8-V11 PolarHBondContact O-N 3.42Å; V11-L29 CarbonylContact C-O 3.49Å; V11-L29 WeakPolarHBondContact CA-O 3.46Å; V11-L29 HydrophobicContact CG2-CG 4.47Å; V11-H30 WeakPolarHBondContact CG1-O 3.28Å
12	G	97.5	Very high	97.1	Very high	52 Å²	52	57.4 Å²	57.4	54%	0.536	31%	0.306	S	S	.	.	T	Hydrogen-bonded Turn	trans	89.3	1	-174.1	0	0	0	0	0	114.4	L10 L29	L10-G12 PolarHBondContact O-N 3.09Å; G12-L29 PolarHBondContact N-O 2.87Å
13	K	97.7	Very high	97	Very high	70 Å²	70	56.5 Å²	56.5	30%	0.304	30%	0.302	S	S	.	.	S	Bend	trans	-99.6	150.7	177.3	-52.2	-58.7	-179.2	153.7	0	111.6	L10 L29 E76	L10-K13 VanDerWaalsContact O-CB 3.28Å; L10-K13 WeakPolarHBondContact O-CB 2.94Å; L10-K13 WeakPolarHBondContact O-CG 3.5Å; L10-K13 PolarHBondContact O-N 2.69Å; K13-L29 PolarHBondContact O-N 2.62Å; K13-E76 VanDerWaalsContact CD-CD 3.5Å; K13-E76 HydrophobicContact CD-CG 4.21Å; K13-E76 WeakPolarHBondContact CD-OE1 3.25Å; K13-E76 WeakPolarHBondContact CD-OE2 3.46Å; K13-E76 WeakPolarHBondContact CE-OE1 3.5Å; K13-E76 WeakPolarHBondContact CE-OE2 3.39Å; K13-E76 HydrophobicContact CG-CG 4.28Å; K13-E76 IonicContact NZ-OE1 3.18Å; K13-E76 PolarHBondContact NZ-OE1 3.29Å; K13-E76 IonicContact NZ-OE2 2.81Å; K13-E76 PolarHBondContact NZ-OE2 3.2Å
14	D	97.3	Very high	96.9	Very high	100 Å²	100	52.1 Å²	52.1	54%	0.535	29%	0.286	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	130.7	175.5	-68.5	-24.5	0	0	0	110.5	T28	D14-T28 PolarHBondContact OD1-OG1 2.95Å
15	V	97.6	Very high	96.9	Very high	5 Å²	5	49.5 Å²	49.5	3%	0.03	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.3	158.9	-177	-59.6	0	0	0	0	110.1	V17 C26 G27 L29 L40 V70 L72	V15-V17 HydrophobicContact CG2-CG2 4.28Å; V15-C26 WeakPolarHBondContact O-CA 3.35Å; V15-G27 PolarHBondContact N-O 3.17Å; V15-G27 PolarHBondContact O-N 3.1Å; V15-G27 VanDerWaalsContact O-N 3.1Å; V15-L29 HydrophobicContact CG2-CB 4.27Å; V15-L40 HydrophobicContact CG2-CD2 3.76Å; V15-V70 HydrophobicContact CB-CG1 4.16Å; V15-V70 HydrophobicContact CG2-CG1 4.5Å; V15-L72 HydrophobicContact CB-CD2 4.2Å; V15-L72 HydrophobicContact CG1-CD2 3.49Å; V15-L72 VanDerWaalsContact CG1-CD2 3.49Å
16	V	97.9	Very high	96.9	Very high	32 Å²	32	48.2 Å²	48.2	19%	0.194	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	120.9	169.8	-174.7	0	0	0	0	108.9	I25 C26 V70 Q71	V16-I25 WeakPolarHBondContact CA-O 3.39Å; V16-C26 HydrophobicContact CG2-CB 4.22Å; V16-V70 CarbonylContact O-C 3.58Å; V16-V70 WeakPolarHBondContact O-CA 3.36Å; V16-Q71 HydrophobicContact CB-CB 4.05Å; V16-Q71 HydrophobicContact CB-CG 4.27Å; V16-Q71 PolarHBondContact N-O 3.35Å; V16-Q71 VanDerWaalsContact N-O 3.15Å; V16-Q71 PolarHBondContact O-N 2.78Å
17	V	98	Very high	96.9	Very high	0 Å²	0	46.8 Å²	46.8	0%	0	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.6	115.3	177.6	-176.9	0	0	0	0	108.9	V15 L19 S24 I25 I38 L40 I62 V67 V70	V15-V17 HydrophobicContact CG2-CG2 4.28Å; V17-L19 HydrophobicContact CG1-CD2 3.87Å; V17-S24 WeakPolarHBondContact O-CA 3.37Å; V17-I25 PolarHBondContact N-O 3.44Å; V17-I25 PolarHBondContact O-N 3.37Å; V17-I38 HydrophobicContact CG2-CD1 4.34Å; V17-L40 HydrophobicContact CB-CD1 4.45Å; V17-L40 HydrophobicContact CG2-CD1 3.94Å; V17-I62 HydrophobicContact CB-CD1 4.17Å; V17-I62 HydrophobicContact CG1-CD1 3.99Å; V17-I62 HydrophobicContact CG2-CD1 4.46Å; V17-V67 HydrophobicContact CG1-CG1 3.97Å; V17-V67 HydrophobicContact CG1-CG2 3.96Å; V17-V70 HydrophobicContact CG2-CG1 4.32Å; V17-V70 HydrophobicContact CG2-CG2 4.41Å
18	E	97.9	Very high	96.9	Very high	36 Å²	36	47.2 Å²	47.2	17%	0.168	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.1	124.6	172.2	-170.1	-171.8	131.2	0	0	109.5	R68 Y69	E18-R68 WeakPolarHBondContact O-CA 3.24Å; E18-R68 PolarHBondContact O-N 2.98Å; E18-R68 IonicContact OE1-CZ 2.75Å; E18-R68 IonicContact OE1-NH1 2.68Å; E18-R68 PolarHBondContact OE1-NH1 3.39Å; E18-Y69 PolarHBondContact N-O 2.83Å; E18-Y69 PolarHBondContact O-N 2.85Å
19	L	97.2	Very high	96.9	Very high	18 Å²	18	42 Å²	42	9%	0.094	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-90.9	160.5	179.8	-56.2	-172.1	0	0	0	111.5	V17 N21 D22 L23 I25 I62 V66 V67	V17-L19 HydrophobicContact CG1-CD2 3.87Å; L19-N21 WeakPolarHBondContact CB-OD1 3.44Å; L19-N21 PolarHBondContact O-N 2.91Å; L19-D22 PolarHBondContact O-N 3.48Å; L19-L23 HydrophobicContact CB-CB 4.44Å; L19-L23 HydrophobicContact CD1-CB 4.29Å; L19-L23 HydrophobicContact CD1-CD2 4.09Å; L19-L23 HydrophobicContact CD1-CG 4.35Å; L19-L23 PolarHBondContact N-O 3.25Å; L19-I25 HydrophobicContact CD1-CD1 4.22Å; L19-I62 HydrophobicContact CD2-CG2 3.58Å; L19-V66 WeakPolarHBondContact CA-O 3.39Å; L19-V66 HydrophobicContact CD2-CG2 4.26Å; L19-V67 HydrophobicContact CD2-CG2 4.33Å
20	K	97.4	Very high	97	Very high	127 Å²	127	42.9 Å²	42.9	55%	0.552	24%	0.238	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.7	-14	178.5	-73.2	176.8	-179.7	174	0	114.8	S65 V66 R68	K20-S65 WeakPolarHBondContact CE-O 3.49Å; K20-S65 PolarHBondContact NZ-O 2.91Å; K20-V66 WeakPolarHBondContact CG-O 3.42Å; K20-V66 PolarHBondContact N-O 3.31Å; K20-R68 HydrophobicContact CG-CB 4.13Å; K20-R68 PolarHBondContact O-NH2 2.92Å
21	N	93.8	Very high	97	Very high	91 Å²	91	45.2 Å²	45.2	49%	0.487	25%	0.254	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.4	18.1	174.6	69.3	-17.1	0	0	0	112.7	L19 L23 Y51	L19-N21 WeakPolarHBondContact CB-OD1 3.44Å; L19-N21 PolarHBondContact O-N 2.91Å; N21-L23 PolarHBondContact O-N 2.99Å; N21-L23 WeakPolarHBondContact OD1-CB 3.28Å; N21-L23 PolarHBondContact OD1-N 3.48Å; N21-Y51 PolarHBondContact O-OH 3.15Å
22	D	93.2	Very high	97.1	Very high	87 Å²	87	42.8 Å²	42.8	47%	0.465	24%	0.239	S	C	.	.	S	Bend	trans	67.6	8	178	-44.7	-40.1	0	0	0	115	L19 S24 R68	L19-D22 PolarHBondContact O-N 3.48Å; D22-S24 PolarHBondContact O-N 3.27Å; D22-R68 IonicContact OD1-CZ 3.83Å; D22-R68 IonicContact OD1-NH1 2.87Å; D22-R68 PolarHBondContact OD1-NH1 2.91Å; D22-R68 IonicContact OD1-NH2 2.75Å; D22-R68 PolarHBondContact OD1-NH2 3.44Å
23	L	94.2	Very high	97.1	Very high	9 Å²	9	42.7 Å²	42.7	5%	0.047	23%	0.227	C	C	.	.			trans	-72.5	125.2	170.1	173.7	59.6	0	0	0	109.6	L19 N21 I25 V45 Y51	L19-L23 HydrophobicContact CB-CB 4.44Å; L19-L23 HydrophobicContact CD1-CB 4.29Å; L19-L23 HydrophobicContact CD1-CD2 4.09Å; L19-L23 HydrophobicContact CD1-CG 4.35Å; L19-L23 PolarHBondContact N-O 3.25Å; N21-L23 PolarHBondContact O-N 2.99Å; N21-L23 WeakPolarHBondContact OD1-CB 3.28Å; N21-L23 PolarHBondContact OD1-N 3.48Å; L23-I25 HydrophobicContact CD1-CG1 4.36Å; L23-I25 HydrophobicContact CD2-CD1 4.04Å; L23-I25 HydrophobicContact CD2-CG1 4.23Å; L23-I25 HydrophobicContact CG-CD1 4.26Å; L23-I25 HydrophobicContact CG-CG1 3.95Å; L23-V45 HydrophobicContact CD1-CG1 3.59Å; L23-V45 HydrophobicContact CD1-CG2 4.37Å; L23-Y51 HydrophobicContact CB-CE1 4.16Å; L23-Y51 HydrophobicContact CB-CE2 4.47Å; L23-Y51 HydrophobicContact CD1-CD1 3.98Å; L23-Y51 HydrophobicContact CD1-CD2 3.61Å; L23-Y51 HydrophobicContact CD1-CE1 4.26Å; L23-Y51 HydrophobicContact CD1-CE2 3.89Å; L23-Y51 HydrophobicContact CD1-CG 3.67Å
24	S	96.1	Very high	97	Very high	27 Å²	27	46 Å²	46	19%	0.189	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	127.7	174	-66.3	0	0	0	0	110.9	V17 D22 T46	V17-S24 WeakPolarHBondContact O-CA 3.37Å; D22-S24 PolarHBondContact O-N 3.27Å; S24-T46 PolarHBondContact O-N 2.89Å
25	I	96.6	Very high	97	Very high	2 Å²	2	48.9 Å²	48.9	1%	0.01	25%	0.248	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	118.6	-178.2	-52.8	172.3	0	0	0	108.1	V16 V17 L19 L23 L40 I43 M54 I62	V16-I25 WeakPolarHBondContact CA-O 3.39Å; V17-I25 PolarHBondContact N-O 3.44Å; V17-I25 PolarHBondContact O-N 3.37Å; L19-I25 HydrophobicContact CD1-CD1 4.22Å; L23-I25 HydrophobicContact CD1-CG1 4.36Å; L23-I25 HydrophobicContact CD2-CD1 4.04Å; L23-I25 HydrophobicContact CD2-CG1 4.23Å; L23-I25 HydrophobicContact CG-CD1 4.26Å; L23-I25 HydrophobicContact CG-CG1 3.95Å; I25-L40 HydrophobicContact CB-CD1 4.46Å; I25-L40 HydrophobicContact CG2-CD1 3.97Å; I25-I43 HydrophobicContact CG2-CB 3.88Å; I25-I43 HydrophobicContact CG2-CD1 4.18Å; I25-I43 HydrophobicContact CG2-CG2 4.14Å; I25-M54 HydrophobicContact CD1-CE 3.94Å; I25-M54 HydrophobicContact CG1-CE 4.44Å; I25-I62 HydrophobicContact CD1-CD1 4.11Å
26	C	97	Very high	97	Very high	41 Å²	41	51.3 Å²	51.3	28%	0.277	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	142.8	169.3	-178.7	0	0	0	0	109.2	V15 V16 I43 S44	V15-C26 WeakPolarHBondContact O-CA 3.35Å; V16-C26 HydrophobicContact CG2-CB 4.22Å; C26-I43 CarbonylContact O-C 3.59Å; C26-I43 WeakPolarHBondContact O-CA 3.45Å; C26-I43 WeakPolarHBondContact O-CB 3.27Å; C26-S44 PolarHBondContact N-O 2.78Å; C26-S44 PolarHBondContact O-N 3.33Å
27	G	97.2	Very high	97	Very high	3 Å²	3	50.8 Å²	50.8	3%	0.031	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	174.6	176.7	171.9	0	0	0	0	0	112.2	V15	V15-G27 PolarHBondContact N-O 3.17Å; V15-G27 PolarHBondContact O-N 3.1Å; V15-G27 VanDerWaalsContact O-N 3.1Å
28	T	98.1	Very high	97.1	Very high	33 Å²	33	51 Å²	51	20%	0.202	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.9	129.2	179.9	-48.9	0	0	0	0	110.3	D14 H30 L40 T41	D14-T28 PolarHBondContact OD1-OG1 2.95Å; T28-H30 PolarHBondContact O-N 3.35Å; T28-H30 VanDerWaalsContact O-N 3.15Å; T28-L40 WeakPolarHBondContact O-CA 3.43Å; T28-T41 PolarHBondContact N-O 3.46Å; T28-T41 PolarHBondContact O-N 2.77Å
29	L	98.4	Very high	97.1	Very high	2 Å²	2	53.2 Å²	53.2	1%	0.01	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.8	109.8	178.4	-178.2	59.7	0	0	0	110.7	F7 L10 V11 G12 K13 V15 I38 L40	F7-L29 HydrophobicContact CD1-CD2 4.48Å; F7-L29 WeakPolarHBondContact O-CD2 3.18Å; L10-L29 HydrophobicContact CB-CD2 3.86Å; V11-L29 CarbonylContact C-O 3.49Å; V11-L29 WeakPolarHBondContact CA-O 3.46Å; V11-L29 HydrophobicContact CG2-CG 4.47Å; G12-L29 PolarHBondContact N-O 2.87Å; K13-L29 PolarHBondContact O-N 2.62Å; V15-L29 HydrophobicContact CG2-CB 4.27Å; L29-I38 HydrophobicContact CD1-CB 4.49Å; L29-I38 HydrophobicContact CD1-CG1 4.43Å; L29-I38 HydrophobicContact CD1-CG2 3.61Å; L29-L40 HydrophobicContact CB-CD2 4.44Å; L29-L40 HydrophobicContact CD1-CD2 4.23Å
30	H	98.4	Very high	97.2	Very high	98 Å²	98	52.4 Å²	52.4	45%	0.454	26%	0.262	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.6	-40.3	-177.5	-177.2	82.3	0	0	0	112.9	V11 T28 K39 T41	V11-H30 WeakPolarHBondContact CG1-O 3.28Å; T28-H30 PolarHBondContact O-N 3.35Å; T28-H30 VanDerWaalsContact O-N 3.15Å; H30-K39 HydrophobicContact CB-CB 4.47Å; H30-K39 HydrophobicContact CB-CG 4.49Å; H30-K39 WeakPolarHBondContact CB-O 3.38Å; H30-K39 PolarHBondContact N-O 2.72Å; H30-T41 HydrophobicContact CB-CG2 3.79Å
31	S	98.3	Very high	97.2	Very high	50 Å²	50	47.5 Å²	47.5	35%	0.35	24%	0.243	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-159.9	153.9	178.2	64.5	0	0	0	0	112.5	K39	S31-K39 PolarHBondContact N-O 2.88Å; S31-K39 PolarHBondContact O-N 2.91Å; S31-K39 VanDerWaalsContact OG-CB 3.23Å; S31-K39 WeakPolarHBondContact OG-CB 3.43Å
32	V	98.4	Very high	97.3	Very high	15 Å²	15	49.1 Å²	49.1	9%	0.091	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.2	147.2	171.8	67.6	0	0	0	0	110.5	Y4 F7 K8 L36 N37	Y4-V32 HydrophobicContact CD2-CG1 4.17Å; Y4-V32 HydrophobicContact CE2-CG1 4.28Å; F7-V32 HydrophobicContact CB-CB 4.06Å; F7-V32 HydrophobicContact CB-CG1 3.78Å; F7-V32 HydrophobicContact CB-CG2 3.88Å; F7-V32 HydrophobicContact CG-CG2 4.5Å; K8-V32 HydrophobicContact CG-CG1 3.83Å; V32-L36 HydrophobicContact CG2-CD2 4.45Å; V32-N37 VanDerWaalsContact CA-O 3.31Å; V32-N37 WeakPolarHBondContact CA-O 3.42Å
33	D	97.8	Very high	97.5	Very high	51 Å²	51	45.9 Å²	45.9	27%	0.273	23%	0.234	S	C	.	.			trans	-113.9	-178.7	174.3	76.3	13.2	0	0	0	113.3	Y4 Y35 L36 N37	Y4-D33 VanDerWaalsContact CD2-O 3.27Å; Y4-D33 WeakPolarHBondContact CD2-O 3.42Å; D33-Y35 PolarHBondContact O-N 3.33Å; D33-Y35 WeakPolarHBondContact OD1-CA 3.43Å; D33-Y35 PolarHBondContact OD1-N 3.32Å; D33-L36 WeakPolarHBondContact O-CA 3.47Å; D33-L36 PolarHBondContact O-N 3.19Å; D33-L36 PolarHBondContact OD1-N 3.43Å; D33-N37 PolarHBondContact N-O 3.02Å; D33-N37 WeakPolarHBondContact OD1-CB 3.37Å; D33-N37 PolarHBondContact OD1-N 3.01Å; D33-N37 PolarHBondContact OD1-ND2 3.06Å; D33-N37 WeakPolarHBondContact OD2-CB 3.21Å; D33-N37 PolarHBondContact OD2-ND2 3.29Å
34	Q	95.9	Very high	97.5	Very high	138 Å²	138	48.8 Å²	48.8	65%	0.645	26%	0.255	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.8	-20.4	-178	68.1	-175.6	-6.1	0	0	114.6	L36	Q34-L36 VanDerWaalsContact C-N 3.3Å
35	Y	97.4	Very high	97.3	Very high	161 Å²	161	48.6 Å²	48.6	63%	0.631	25%	0.253	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.7	8.4	175.3	-60.7	-66.4	0	0	0	112.1	D33 N37	D33-Y35 PolarHBondContact O-N 3.33Å; D33-Y35 WeakPolarHBondContact OD1-CA 3.43Å; D33-Y35 PolarHBondContact OD1-N 3.32Å; Y35-N37 PolarHBondContact O-N 3.2Å
36	L	98.3	Very high	96.8	Very high	56 Å²	56	52.7 Å²	52.7	29%	0.293	28%	0.278	S	S	.	.			trans	59.4	29.7	-175.8	-44.6	-179.7	0	0	0	111.9	F3 F7 V32 D33 Q34 G64	F3-L36 HydrophobicContact CB-CD1 4.1Å; F3-L36 HydrophobicContact CB-CD2 4.24Å; F7-L36 HydrophobicContact CD2-CD2 4.28Å; V32-L36 HydrophobicContact CG2-CD2 4.45Å; D33-L36 WeakPolarHBondContact O-CA 3.47Å; D33-L36 PolarHBondContact O-N 3.19Å; D33-L36 PolarHBondContact OD1-N 3.43Å; Q34-L36 VanDerWaalsContact C-N 3.3Å; L36-G64 VanDerWaalsContact O-CA 3.25Å; L36-G64 WeakPolarHBondContact O-CA 3.35Å
37	N	98.4	Very high	96.4	Very high	22 Å²	22	55.1 Å²	55.1	12%	0.118	29%	0.288	C	S	.	.			trans	-67.2	137.8	165.3	-57.9	-47.9	0	0	0	108.4	V32 D33 Y35 F61 I62 R63 G64	V32-N37 VanDerWaalsContact CA-O 3.31Å; V32-N37 WeakPolarHBondContact CA-O 3.42Å; D33-N37 PolarHBondContact N-O 3.02Å; D33-N37 WeakPolarHBondContact OD1-CB 3.37Å; D33-N37 PolarHBondContact OD1-N 3.01Å; D33-N37 PolarHBondContact OD1-ND2 3.06Å; D33-N37 WeakPolarHBondContact OD2-CB 3.21Å; D33-N37 PolarHBondContact OD2-ND2 3.29Å; Y35-N37 PolarHBondContact O-N 3.2Å; N37-F61 HydrophobicContact CB-CE2 3.7Å; N37-F61 HydrophobicContact CB-CZ 3.56Å; N37-I62 CarbonylContact C-O 3.26Å; N37-I62 WeakPolarHBondContact CA-O 3.46Å; N37-R63 VanDerWaalsContact OD1-CA 3.3Å; N37-R63 WeakPolarHBondContact OD1-CA 3.5Å; N37-G64 PolarHBondContact OD1-N 3.35Å
38	I	98.7	Very high	95.8	Very high	4 Å²	4	57.6 Å²	57.6	2%	0.021	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	132.3	-172.3	-71.9	168.9	0	0	0	108.9	V17 L29 L40 I62 V70	V17-I38 HydrophobicContact CG2-CD1 4.34Å; L29-I38 HydrophobicContact CD1-CB 4.49Å; L29-I38 HydrophobicContact CD1-CG1 4.43Å; L29-I38 HydrophobicContact CD1-CG2 3.61Å; I38-L40 HydrophobicContact CG2-CD2 3.66Å; I38-L40 HydrophobicContact CG2-CG 3.83Å; I38-I62 HydrophobicContact CB-CB 4.48Å; I38-I62 PolarHBondContact N-O 2.93Å; I38-I62 PolarHBondContact O-N 3.44Å; I38-V70 HydrophobicContact CD1-CG2 4.11Å
39	K	98.4	Very high	95.3	Very high	83 Å²	83	65 Å²	65	36%	0.361	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.1	122.2	165.2	-166.7	173.2	170.9	-168.4	0	108.7	H30 S31 C60	H30-K39 HydrophobicContact CB-CB 4.47Å; H30-K39 HydrophobicContact CB-CG 4.49Å; H30-K39 WeakPolarHBondContact CB-O 3.38Å; H30-K39 PolarHBondContact N-O 2.72Å; S31-K39 PolarHBondContact N-O 2.88Å; S31-K39 PolarHBondContact O-N 2.91Å; S31-K39 VanDerWaalsContact OG-CB 3.23Å; S31-K39 WeakPolarHBondContact OG-CB 3.43Å; K39-C60 WeakPolarHBondContact CA-O 3.42Å
40	L	98.3	Very high	94.8	Very high	0 Å²	0	71 Å²	71	0%	0	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.2	146.2	172.3	-61.1	-178.5	0	0	0	110.3	V15 V17 I25 T28 L29 I38 I43 N59 C60 I62	V15-L40 HydrophobicContact CG2-CD2 3.76Å; V17-L40 HydrophobicContact CB-CD1 4.45Å; V17-L40 HydrophobicContact CG2-CD1 3.94Å; I25-L40 HydrophobicContact CB-CD1 4.46Å; I25-L40 HydrophobicContact CG2-CD1 3.97Å; T28-L40 WeakPolarHBondContact O-CA 3.43Å; L29-L40 HydrophobicContact CB-CD2 4.44Å; L29-L40 HydrophobicContact CD1-CD2 4.23Å; I38-L40 HydrophobicContact CG2-CD2 3.66Å; I38-L40 HydrophobicContact CG2-CG 3.83Å; L40-I43 HydrophobicContact CB-CG2 3.55Å; L40-I43 HydrophobicContact CD1-CG2 4.49Å; L40-N59 WeakPolarHBondContact O-CA 3.35Å; L40-C60 PolarHBondContact N-O 3.16Å; L40-C60 PolarHBondContact O-N 3.19Å; L40-I62 HydrophobicContact CD1-CD1 4.01Å; L40-I62 HydrophobicContact CG-CD1 4.38Å
41	T	98	Very high	94.4	Very high	25 Å²	25	67.7 Å²	67.7	15%	0.153	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	161	170.3	52.9	0	0	0	0	110.7	T28 H30 I43 K58 N59	T28-T41 PolarHBondContact N-O 3.46Å; T28-T41 PolarHBondContact O-N 2.77Å; H30-T41 HydrophobicContact CB-CG2 3.79Å; T41-I43 VanDerWaalsContact C-N 3.29Å; T41-I43 PolarHBondContact O-N 3.39Å; T41-K58 CarbonylContact C-O 3.56Å; T41-N59 WeakPolarHBondContact CA-OD1 3.34Å; T41-N59 WeakPolarHBondContact CB-OD1 3.37Å; T41-N59 WeakPolarHBondContact CG2-OD1 3.23Å
42	D	96.1	Very high	94	Very high	124 Å²	124	69 Å²	69	66%	0.663	35%	0.353	S	S	*	.	E	Extended strand (participates in β ladder)	trans	49.1	49.3	-179.1	-61.5	-42.8	0	0	0	112.9	K58 N59	D42-K58 WeakPolarHBondContact CA-O 2.94Å; D42-K58 PolarHBondContact N-O 3.19Å; D42-N59 PolarHBondContact N-OD1 3.1Å
43	I	96.6	Very high	93.4	Very high	20 Å²	20	74.1 Å²	74.1	10%	0.103	38%	0.376	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.9	152.5	-171.3	75.1	176.4	0	0	0	113	I25 C26 L40 T41 M54 V57 K58 C60	I25-I43 HydrophobicContact CG2-CB 3.88Å; I25-I43 HydrophobicContact CG2-CD1 4.18Å; I25-I43 HydrophobicContact CG2-CG2 4.14Å; C26-I43 CarbonylContact O-C 3.59Å; C26-I43 WeakPolarHBondContact O-CA 3.45Å; C26-I43 WeakPolarHBondContact O-CB 3.27Å; L40-I43 HydrophobicContact CB-CG2 3.55Å; L40-I43 HydrophobicContact CD1-CG2 4.49Å; T41-I43 VanDerWaalsContact C-N 3.29Å; T41-I43 PolarHBondContact O-N 3.39Å; I43-M54 HydrophobicContact CD1-CE 3.82Å; I43-V57 HydrophobicContact CD1-CB 4.08Å; I43-V57 HydrophobicContact CD1-CG1 3.67Å; I43-V57 WeakPolarHBondContact CD1-O 3.13Å; I43-V57 WeakPolarHBondContact CG1-O 3.35Å; I43-K58 PolarHBondContact N-O 3.37Å; I43-C60 HydrophobicContact CD1-CB 3.89Å
44	S	94.3	Very high	92.9	Very high	69 Å²	69	72.8 Å²	72.8	48%	0.483	37%	0.368	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136	149	164.5	59.8	0	0	0	0	110.1	C26	C26-S44 PolarHBondContact N-O 2.78Å; C26-S44 PolarHBondContact O-N 3.33Å
45	V	92.8	Very high	92.4	Very high	24 Å²	24	72.4 Å²	72.4	15%	0.145	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	134.8	176	176.7	0	0	0	0	108.8	L23 D47 Y51 M54	L23-V45 HydrophobicContact CD1-CG1 3.59Å; L23-V45 HydrophobicContact CD1-CG2 4.37Å; V45-D47 VanDerWaalsContact C-N 3.33Å; V45-D47 PolarHBondContact O-N 2.88Å; V45-Y51 HydrophobicContact CG1-CD2 4.28Å; V45-M54 HydrophobicContact CB-CB 4.48Å; V45-M54 HydrophobicContact CG2-CB 3.45Å; V45-M54 VanDerWaalsContact CG2-CB 3.45Å; V45-M54 HydrophobicContact CG2-CE 4.14Å; V45-M54 HydrophobicContact CG2-CG 3.91Å
46	T	86.3	Confident	92	Very high	88 Å²	88	70 Å²	70	54%	0.54	38%	0.376	S	S	.	.	S	Bend	trans	-64.1	-37.5	-177.6	-44.2	0	0	0	0	112.3	S24 P48	S24-T46 PolarHBondContact O-N 2.89Å; T46-P48 VanDerWaalsContact O-CD 3.24Å; T46-P48 WeakPolarHBondContact O-CD 3.21Å
47	D	87.6	Confident	91.7	Very high	91 Å²	91	69.6 Å²	69.6	49%	0.487	38%	0.377	S	S	.	.			trans	-116.2	75.9	179	-68.3	-34.8	0	0	0	112.1	V45 E49 K50 Y51	V45-D47 VanDerWaalsContact C-N 3.33Å; V45-D47 PolarHBondContact O-N 2.88Å; D47-E49 VanDerWaalsContact C-N 3.29Å; D47-E49 PolarHBondContact O-N 2.72Å; D47-K50 HydrophobicContact CB-CB 4.17Å; D47-K50 PolarHBondContact O-N 2.96Å; D47-Y51 HydrophobicContact CB-CD2 4.39Å; D47-Y51 WeakPolarHBondContact O-CD2 3.33Å; D47-Y51 PolarHBondContact O-N 3.38Å
48	P	84.7	Confident	91.4	Very high	55 Å²	55	75.8 Å²	75.8	36%	0.357	40%	0.402	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64	-30.4	-175.1	23	-31.9	0	0	0	113.7	T46 K50 Y51 P52 L55	T46-P48 VanDerWaalsContact O-CD 3.24Å; T46-P48 WeakPolarHBondContact O-CD 3.21Å; P48-K50 VanDerWaalsContact C-N 3.34Å; P48-K50 PolarHBondContact O-N 2.93Å; P48-Y51 CarbonylContact O-C 3.52Å; P48-Y51 VanDerWaalsContact O-C 3.26Å; P48-Y51 PolarHBondContact O-N 3.29Å; P48-P52 WeakPolarHBondContact O-CA 3.38Å; P48-P52 VanDerWaalsContact O-N 3.16Å; P48-L55 HydrophobicContact CB-CD2 3.71Å
49	E	87.8	Confident	91.3	Very high	190 Å²	190	79.8 Å²	79.8	89%	0.888	42%	0.424	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.2	-34.9	179.3	-62.7	-170.7	160.6	0	0	112.5	D47	D47-E49 VanDerWaalsContact C-N 3.29Å; D47-E49 PolarHBondContact O-N 2.72Å
50	K	89.1	Confident	91.1	Very high	128 Å²	128	77.2 Å²	77.2	56%	0.557	42%	0.416	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.7	-27.6	178.1	-171.2	177.7	174.8	-161.9	0	111.9	D47 P48 P52	D47-K50 HydrophobicContact CB-CB 4.17Å; D47-K50 PolarHBondContact O-N 2.96Å; P48-K50 VanDerWaalsContact C-N 3.34Å; P48-K50 PolarHBondContact O-N 2.93Å; K50-P52 VanDerWaalsContact C-CD 3.44Å
51	Y	88.6	Confident	91.1	Very high	28 Å²	28	83.4 Å²	83.4	11%	0.11	44%	0.443	C	S	.	.			trans	-128.1	60.9	-177.5	-55.4	-84.8	0	0	0	112.5	N21 L23 V45 D47 P48 H53 M54	N21-Y51 PolarHBondContact O-OH 3.15Å; L23-Y51 HydrophobicContact CB-CE1 4.16Å; L23-Y51 HydrophobicContact CB-CE2 4.47Å; L23-Y51 HydrophobicContact CD1-CD1 3.98Å; L23-Y51 HydrophobicContact CD1-CD2 3.61Å; L23-Y51 HydrophobicContact CD1-CE1 4.26Å; L23-Y51 HydrophobicContact CD1-CE2 3.89Å; L23-Y51 HydrophobicContact CD1-CG 3.67Å; V45-Y51 HydrophobicContact CG1-CD2 4.28Å; D47-Y51 HydrophobicContact CB-CD2 4.39Å; D47-Y51 WeakPolarHBondContact O-CD2 3.33Å; D47-Y51 PolarHBondContact O-N 3.38Å; P48-Y51 CarbonylContact O-C 3.52Å; P48-Y51 VanDerWaalsContact O-C 3.26Å; P48-Y51 PolarHBondContact O-N 3.29Å; Y51-H53 AromaticContact CD1-CE1 3.77Å; Y51-H53 PolarHBondContact O-N 2.96Å; Y51-H53 VanDerWaalsContact O-N 3.13Å; Y51-M54 PolarHBondContact O-N 3.01Å; Y51-M54 VanDerWaalsContact O-N 3.08Å
52	P	90.3	Very high	91.1	Very high	78 Å²	78	82.5 Å²	82.5	51%	0.506	44%	0.437	S	S	.	.	G	3₁₀ helix	trans	-65.2	-23.4	-173.1	25.9	-35.5	0	0	0	113.4	P48 K50 M54 L55	P48-P52 WeakPolarHBondContact O-CA 3.38Å; P48-P52 VanDerWaalsContact O-N 3.16Å; K50-P52 VanDerWaalsContact C-CD 3.44Å; P52-M54 PolarHBondContact O-N 2.85Å; P52-M54 VanDerWaalsContact O-N 3.17Å; P52-L55 HydrophobicContact CB-CD1 4.27Å; P52-L55 WeakPolarHBondContact O-CB 3.43Å; P52-L55 WeakPolarHBondContact O-CG 3.42Å; P52-L55 PolarHBondContact O-N 3.4Å
53	H	86	Confident	91.2	Very high	122 Å²	122	84.6 Å²	84.6	57%	0.565	44%	0.436	S	S	*	.	G	3₁₀ helix	trans	-63.7	-17	176.4	56	-88	0	0	0	113.6	Y51	Y51-H53 AromaticContact CD1-CE1 3.77Å; Y51-H53 PolarHBondContact O-N 2.96Å; Y51-H53 VanDerWaalsContact O-N 3.13Å
54	M	88.3	Confident	91.3	Very high	23 Å²	23	84.4 Å²	84.4	11%	0.113	44%	0.439	C	S	.	.	G	3₁₀ helix	trans	-88	-12.3	178.7	-66.6	-66	-71.5	0	0	113.3	I25 I43 V45 Y51 P52 S56 V57	I25-M54 HydrophobicContact CD1-CE 3.94Å; I25-M54 HydrophobicContact CG1-CE 4.44Å; I43-M54 HydrophobicContact CD1-CE 3.82Å; V45-M54 HydrophobicContact CB-CB 4.48Å; V45-M54 HydrophobicContact CG2-CB 3.45Å; V45-M54 VanDerWaalsContact CG2-CB 3.45Å; V45-M54 HydrophobicContact CG2-CE 4.14Å; V45-M54 HydrophobicContact CG2-CG 3.91Å; Y51-M54 PolarHBondContact O-N 3.01Å; Y51-M54 VanDerWaalsContact O-N 3.08Å; P52-M54 PolarHBondContact O-N 2.85Å; P52-M54 VanDerWaalsContact O-N 3.17Å; M54-S56 PolarHBondContact O-N 2.99Å; M54-V57 WeakPolarHBondContact O-CB 3.16Å; M54-V57 PolarHBondContact O-N 2.97Å; M54-V57 HydrophobicContact SD-CG2 4.39Å
55	L	85	Confident	91.5	Very high	130 Å²	130	84.1 Å²	84.1	68%	0.681	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.2	-30.9	-173.3	-73.6	170.5	0	0	0	114.2	P48 P52	P48-L55 HydrophobicContact CB-CD2 3.71Å; P52-L55 HydrophobicContact CB-CD1 4.27Å; P52-L55 WeakPolarHBondContact O-CB 3.43Å; P52-L55 WeakPolarHBondContact O-CG 3.42Å; P52-L55 PolarHBondContact O-N 3.4Å
56	S	89.3	Confident	91.7	Very high	109 Å²	109	86 Å²	86	76%	0.762	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.1	-6.5	178.2	56.1	0	0	0	0	113.6	M54	M54-S56 PolarHBondContact O-N 2.99Å
57	V	91.5	Very high	92.3	Very high	49 Å²	49	83 Å²	83	30%	0.297	43%	0.43	S	S	.	.			trans	-89.3	118.8	-173.7	-174.8	0	0	0	0	108.9	I43 M54 N59	I43-V57 HydrophobicContact CD1-CB 4.08Å; I43-V57 HydrophobicContact CD1-CG1 3.67Å; I43-V57 WeakPolarHBondContact CD1-O 3.13Å; I43-V57 WeakPolarHBondContact CG1-O 3.35Å; M54-V57 WeakPolarHBondContact O-CB 3.16Å; M54-V57 PolarHBondContact O-N 2.97Å; M54-V57 HydrophobicContact SD-CG2 4.39Å; V57-N59 WeakPolarHBondContact CG1-O 3.47Å
58	K	92.7	Very high	92.8	Very high	151 Å²	151	83.1 Å²	83.1	66%	0.657	42%	0.424	S	S	*	.	S	Bend	trans	-96.2	-28.6	176.7	-64	-169.5	176	-169.9	0	113.7	T41 D42 I43	T41-K58 CarbonylContact C-O 3.56Å; D42-K58 WeakPolarHBondContact CA-O 2.94Å; D42-K58 PolarHBondContact N-O 3.19Å; I43-K58 PolarHBondContact N-O 3.37Å
59	N	95	Very high	93.5	Very high	89 Å²	89	87.3 Å²	87.3	48%	0.476	43%	0.433	S	S	.	.			trans	-131.6	141	-178.1	-58.3	-38.4	0	0	0	108.9	L40 T41 D42 V57	L40-N59 WeakPolarHBondContact O-CA 3.35Å; T41-N59 WeakPolarHBondContact CA-OD1 3.34Å; T41-N59 WeakPolarHBondContact CB-OD1 3.37Å; T41-N59 WeakPolarHBondContact CG2-OD1 3.23Å; D42-N59 PolarHBondContact N-OD1 3.1Å; V57-N59 WeakPolarHBondContact CG1-O 3.47Å
60	C	95.5	Very high	94	Very high	29 Å²	29	79.9 Å²	79.9	20%	0.196	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.9	142.8	179.9	-171.6	0	0	0	0	111.2	K39 L40 I43	K39-C60 WeakPolarHBondContact CA-O 3.42Å; L40-C60 PolarHBondContact N-O 3.16Å; L40-C60 PolarHBondContact O-N 3.19Å; I43-C60 HydrophobicContact CD1-CB 3.89Å
61	F	97.9	Very high	94.4	Very high	129 Å²	129	78.7 Å²	78.7	57%	0.566	40%	0.397	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.7	121.9	165	175.4	-94.9	0	0	0	108.7	N37	N37-F61 HydrophobicContact CB-CE2 3.7Å; N37-F61 HydrophobicContact CB-CZ 3.56Å
62	I	98.1	Very high	94.8	Very high	6 Å²	6	79.9 Å²	79.9	3%	0.031	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	124.3	-175.4	-55.9	172.6	0	0	0	108.1	V17 L19 I25 N37 I38 L40 G64 V66 V67	V17-I62 HydrophobicContact CB-CD1 4.17Å; V17-I62 HydrophobicContact CG1-CD1 3.99Å; V17-I62 HydrophobicContact CG2-CD1 4.46Å; L19-I62 HydrophobicContact CD2-CG2 3.58Å; I25-I62 HydrophobicContact CD1-CD1 4.11Å; N37-I62 CarbonylContact C-O 3.26Å; N37-I62 WeakPolarHBondContact CA-O 3.46Å; I38-I62 HydrophobicContact CB-CB 4.48Å; I38-I62 PolarHBondContact N-O 2.93Å; I38-I62 PolarHBondContact O-N 3.44Å; L40-I62 HydrophobicContact CD1-CD1 4.01Å; L40-I62 HydrophobicContact CG-CD1 4.38Å; I62-G64 PolarHBondContact O-N 3.15Å; I62-V66 HydrophobicContact CG2-CG2 4.03Å; I62-V67 HydrophobicContact CG2-CG2 3.75Å
63	R	98.4	Very high	94.8	Very high	168 Å²	168	78.2 Å²	78.2	63%	0.634	40%	0.395	S	S	*	.			trans	-70	126.9	174.2	-170.4	179.6	178.2	172.1	0.2	109.7	N37 S65 V66	N37-R63 VanDerWaalsContact OD1-CA 3.3Å; N37-R63 WeakPolarHBondContact OD1-CA 3.5Å; R63-S65 WeakPolarHBondContact CD-OG 3.47Å; R63-S65 WeakPolarHBondContact CG-OG 3.31Å; R63-S65 PolarHBondContact NE-OG 3.06Å; R63-S65 PolarHBondContact O-N 2.85Å; R63-V66 HydrophobicContact CB-CG2 4.36Å; R63-V66 WeakPolarHBondContact O-CG2 3.43Å; R63-V66 PolarHBondContact O-N 2.86Å
64	G	98	Very high	95.1	Very high	16 Å²	16	76.7 Å²	76.7	17%	0.165	40%	0.403	C	S	.	.	G	3₁₀ helix	trans	-56	-31.8	-175.5	0	0	0	0	0	113.4	L36 N37 I62 V66 V67	L36-G64 VanDerWaalsContact O-CA 3.25Å; L36-G64 WeakPolarHBondContact O-CA 3.35Å; N37-G64 PolarHBondContact OD1-N 3.35Å; I62-G64 PolarHBondContact O-N 3.15Å; G64-V66 PolarHBondContact O-N 3.47Å; G64-V67 PolarHBondContact O-N 2.93Å
65	S	98.3	Very high	95.4	Very high	64 Å²	64	82.1 Å²	82.1	45%	0.448	43%	0.432	S	S	.	.	G	3₁₀ helix	trans	-66.7	-18.5	179	65.4	0	0	0	0	115	K20 R63	K20-S65 WeakPolarHBondContact CE-O 3.49Å; K20-S65 PolarHBondContact NZ-O 2.91Å; R63-S65 WeakPolarHBondContact CD-OG 3.47Å; R63-S65 WeakPolarHBondContact CG-OG 3.31Å; R63-S65 PolarHBondContact NE-OG 3.06Å; R63-S65 PolarHBondContact O-N 2.85Å
66	V	98.3	Very high	95.8	Very high	62 Å²	62	78.7 Å²	78.7	38%	0.376	41%	0.413	S	S	.	.	G	3₁₀ helix	trans	-97.1	-7	178.3	-57.5	0	0	0	0	113.2	L19 K20 I62 R63 G64	L19-V66 WeakPolarHBondContact CA-O 3.39Å; L19-V66 HydrophobicContact CD2-CG2 4.26Å; K20-V66 WeakPolarHBondContact CG-O 3.42Å; K20-V66 PolarHBondContact N-O 3.31Å; I62-V66 HydrophobicContact CG2-CG2 4.03Å; R63-V66 HydrophobicContact CB-CG2 4.36Å; R63-V66 WeakPolarHBondContact O-CG2 3.43Å; R63-V66 PolarHBondContact O-N 2.86Å; G64-V66 PolarHBondContact O-N 3.47Å
67	V	98.4	Very high	96.1	Very high	27 Å²	27	74.9 Å²	74.9	16%	0.164	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.6	135.9	175.6	-179.5	0	0	0	0	109.3	V17 L19 I62 G64 V70	V17-V67 HydrophobicContact CG1-CG1 3.97Å; V17-V67 HydrophobicContact CG1-CG2 3.96Å; L19-V67 HydrophobicContact CD2-CG2 4.33Å; I62-V67 HydrophobicContact CG2-CG2 3.75Å; G64-V67 PolarHBondContact O-N 2.93Å; V67-V70 HydrophobicContact CG1-CG2 3.82Å
68	R	98.4	Very high	96.4	Very high	93 Å²	93	77.1 Å²	77.1	35%	0.351	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.4	-53	169.8	-172.5	-171.3	-66.4	154.1	-4.8	110.1	E18 K20 D22	E18-R68 WeakPolarHBondContact O-CA 3.24Å; E18-R68 PolarHBondContact O-N 2.98Å; E18-R68 IonicContact OE1-CZ 2.75Å; E18-R68 IonicContact OE1-NH1 2.68Å; E18-R68 PolarHBondContact OE1-NH1 3.39Å; K20-R68 HydrophobicContact CG-CB 4.13Å; K20-R68 PolarHBondContact O-NH2 2.92Å; D22-R68 IonicContact OD1-CZ 3.83Å; D22-R68 IonicContact OD1-NH1 2.87Å; D22-R68 PolarHBondContact OD1-NH1 2.91Å; D22-R68 IonicContact OD1-NH2 2.75Å; D22-R68 PolarHBondContact OD1-NH2 3.44Å
69	Y	98.4	Very high	96.6	Very high	142 Å²	142	73.9 Å²	73.9	56%	0.557	39%	0.388	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-135.8	153	179.8	-59	-56.8	0	0	0	111.8	E18	E18-Y69 PolarHBondContact N-O 2.83Å; E18-Y69 PolarHBondContact O-N 2.85Å
70	V	98.1	Very high	96.7	Very high	35 Å²	35	76.4 Å²	76.4	21%	0.212	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	115.1	165.1	-172.4	0	0	0	0	106.9	F7 V15 V16 V17 I38 V67 L72	F7-V70 HydrophobicContact CE1-CB 4.2Å; F7-V70 HydrophobicContact CE1-CG1 4.08Å; F7-V70 HydrophobicContact CE1-CG2 4.22Å; F7-V70 HydrophobicContact CZ-CB 4.33Å; F7-V70 HydrophobicContact CZ-CG2 4.08Å; V15-V70 HydrophobicContact CB-CG1 4.16Å; V15-V70 HydrophobicContact CG2-CG1 4.5Å; V16-V70 CarbonylContact O-C 3.58Å; V16-V70 WeakPolarHBondContact O-CA 3.36Å; V17-V70 HydrophobicContact CG2-CG1 4.32Å; V17-V70 HydrophobicContact CG2-CG2 4.41Å; I38-V70 HydrophobicContact CD1-CG2 4.11Å; V67-V70 HydrophobicContact CG1-CG2 3.82Å; V70-L72 HydrophobicContact CG1-CD2 3.66Å; V70-L72 HydrophobicContact CG1-CG 4.33Å
71	Q	97.9	Very high	96.8	Very high	103 Å²	103	80.6 Å²	80.6	48%	0.481	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.5	132.4	175.2	-47.8	178.1	7.2	0	0	108.4	V16	V16-Q71 HydrophobicContact CB-CB 4.05Å; V16-Q71 HydrophobicContact CB-CG 4.27Å; V16-Q71 PolarHBondContact N-O 3.35Å; V16-Q71 VanDerWaalsContact N-O 3.15Å; V16-Q71 PolarHBondContact O-N 2.78Å
72	L	96.6	Very high	96.7	Very high	53 Å²	53	77.1 Å²	77.1	28%	0.277	40%	0.404	S	S	.	.			trans	-127.4	148	-170.9	-58.3	175.9	0	0	0	110.1	F6 L10 V15 V70 V77	F6-L72 HydrophobicContact CE1-CD1 3.63Å; F6-L72 HydrophobicContact CZ-CD1 3.65Å; L10-L72 HydrophobicContact CD1-CD1 3.75Å; L10-L72 HydrophobicContact CD1-CD2 3.78Å; L10-L72 HydrophobicContact CD1-CG 4.38Å; V15-L72 HydrophobicContact CB-CD2 4.2Å; V15-L72 HydrophobicContact CG1-CD2 3.49Å; V15-L72 VanDerWaalsContact CG1-CD2 3.49Å; V70-L72 HydrophobicContact CG1-CD2 3.66Å; V70-L72 HydrophobicContact CG1-CG 4.33Å; L72-V77 HydrophobicContact CB-CG2 4.49Å; L72-V77 HydrophobicContact CD1-CG2 4.35Å
73	P	89.9	Confident	96.7	Very high	43 Å²	43	81.5 Å²	81.5	28%	0.279	43%	0.425	S	S	.	.			trans	-63.9	133.8	167	-11.8	26.3	0	0	0	109.9	D75 E76	P73-D75 VanDerWaalsContact C-N 3.28Å; P73-D75 WeakPolarHBondContact CB-OD1 3.48Å; P73-D75 PolarHBondContact O-N 2.92Å; P73-E76 HydrophobicContact CB-CB 4.37Å; P73-E76 HydrophobicContact CB-CG 3.86Å; P73-E76 HydrophobicContact CG-CG 3.96Å; P73-E76 PolarHBondContact O-N 3.28Å
74	A	93.3	Very high	96.6	Very high	90 Å²	90	77.2 Å²	77.2	74%	0.744	41%	0.414	S	S	*	.	G	3₁₀ helix	trans	-68.6	-29.4	-176.6	0	0	0	0	0	112.8	E76 V77	A74-E76 PolarHBondContact O-N 2.96Å; A74-V77 PolarHBondContact O-N 2.97Å
75	D	95.2	Very high	96.6	Very high	136 Å²	136	78 Å²	78	73%	0.727	42%	0.419	S	S	*	.	G	3₁₀ helix	trans	-67.2	-21.6	176.3	53.7	-40.2	0	0	0	113.5	P73 V77	P73-D75 VanDerWaalsContact C-N 3.28Å; P73-D75 WeakPolarHBondContact CB-OD1 3.48Å; P73-D75 PolarHBondContact O-N 2.92Å; D75-V77 VanDerWaalsContact C-N 3.31Å
76	E	93.2	Very high	96.5	Very high	59 Å²	59	76.9 Å²	76.9	28%	0.276	41%	0.414	S	S	.	.	G	3₁₀ helix	trans	-87.9	1.7	177.5	-61.5	-66.3	171	0	0	112.9	L10 K13 P73 A74	L10-E76 HydrophobicContact CD2-CB 3.79Å; K13-E76 VanDerWaalsContact CD-CD 3.5Å; K13-E76 HydrophobicContact CD-CG 4.21Å; K13-E76 WeakPolarHBondContact CD-OE1 3.25Å; K13-E76 WeakPolarHBondContact CD-OE2 3.46Å; K13-E76 WeakPolarHBondContact CE-OE1 3.5Å; K13-E76 WeakPolarHBondContact CE-OE2 3.39Å; K13-E76 HydrophobicContact CG-CG 4.28Å; K13-E76 IonicContact NZ-OE1 3.18Å; K13-E76 PolarHBondContact NZ-OE1 3.29Å; K13-E76 IonicContact NZ-OE2 2.81Å; K13-E76 PolarHBondContact NZ-OE2 3.2Å; P73-E76 HydrophobicContact CB-CB 4.37Å; P73-E76 HydrophobicContact CB-CG 3.86Å; P73-E76 HydrophobicContact CG-CG 3.96Å; P73-E76 PolarHBondContact O-N 3.28Å; A74-E76 PolarHBondContact O-N 2.96Å
77	V	96	Very high	96.4	Very high	29 Å²	29	80.6 Å²	80.6	18%	0.176	42%	0.421	C	S	.	.			trans	-122.6	106.7	-174.2	-177.9	0	0	0	0	111.7	F6 L72 A74 D75 T79 L82	F6-V77 HydrophobicContact CE2-CG1 4.07Å; F6-V77 HydrophobicContact CE2-CG2 4.21Å; F6-V77 HydrophobicContact CZ-CG1 4.31Å; F6-V77 HydrophobicContact CZ-CG2 3.96Å; L72-V77 HydrophobicContact CB-CG2 4.49Å; L72-V77 HydrophobicContact CD1-CG2 4.35Å; A74-V77 PolarHBondContact O-N 2.97Å; D75-V77 VanDerWaalsContact C-N 3.31Å; V77-T79 HydrophobicContact CG1-CG2 4.46Å; V77-T79 PolarHBondContact O-N 3.28Å; V77-T79 VanDerWaalsContact O-N 3.16Å; V77-L82 HydrophobicContact CG1-CD2 4.38Å
78	D	96.6	Very high	96.3	Very high	95 Å²	95	85.9 Å²	85.9	51%	0.508	44%	0.442	S	S	.	.			trans	-75.5	102	166.4	-173.6	-26.3	0	0	0	110.3	Q80 L81 L82	D78-Q80 VanDerWaalsContact C-N 3.32Å; D78-Q80 PolarHBondContact O-N 3.46Å; D78-Q80 WeakPolarHBondContact OD1-CA 3.45Å; D78-Q80 WeakPolarHBondContact OD1-CB 3.19Å; D78-Q80 PolarHBondContact OD1-N 2.88Å; D78-L81 HydrophobicContact CB-CB 4Å; D78-L81 PolarHBondContact O-N 2.85Å; D78-L81 PolarHBondContact OD1-N 3.22Å; D78-L82 WeakPolarHBondContact O-CB 3.48Å; D78-L82 PolarHBondContact O-N 3.21Å
79	T	96.8	Very high	96.1	Very high	84 Å²	84	83 Å²	83	52%	0.515	43%	0.432	S	S	.	.	H	α-helix	trans	-68	-27.7	-179.3	61.4	0	0	0	0	113.6	V77 Q83	V77-T79 HydrophobicContact CG1-CG2 4.46Å; V77-T79 PolarHBondContact O-N 3.28Å; V77-T79 VanDerWaalsContact O-N 3.16Å; T79-Q83 WeakPolarHBondContact O-CB 3.41Å; T79-Q83 WeakPolarHBondContact O-CG 3.45Å; T79-Q83 PolarHBondContact O-N 3.04Å; T79-Q83 PolarHBondContact O-NE2 3.42Å
80	Q	97.3	Very high	95.9	Very high	142 Å²	142	78.5 Å²	78.5	66%	0.664	42%	0.424	S	S	*	.	H	α-helix	trans	-70.3	-47.4	177.3	-66.6	-175	-7.7	0	0	109.9	D78 L82 Q83 D84	D78-Q80 VanDerWaalsContact C-N 3.32Å; D78-Q80 PolarHBondContact O-N 3.46Å; D78-Q80 WeakPolarHBondContact OD1-CA 3.45Å; D78-Q80 WeakPolarHBondContact OD1-CB 3.19Å; D78-Q80 PolarHBondContact OD1-N 2.88Å; Q80-L82 VanDerWaalsContact C-N 3.3Å; Q80-L82 PolarHBondContact O-N 3.22Å; Q80-Q83 PolarHBondContact O-N 2.81Å; Q80-D84 PolarHBondContact O-N 2.92Å
81	L	96.9	Very high	95.8	Very high	117 Å²	117	83.4 Å²	83.4	61%	0.613	45%	0.447	S	S	*	.	H	α-helix	trans	-59.2	-43.1	175.5	-177.8	63.9	0	0	0	111.4	D78 D84 A85	D78-L81 HydrophobicContact CB-CB 4Å; D78-L81 PolarHBondContact O-N 2.85Å; D78-L81 PolarHBondContact OD1-N 3.22Å; L81-D84 PolarHBondContact O-N 2.75Å; L81-A85 VanDerWaalsContact O-CB 3.24Å; L81-A85 WeakPolarHBondContact O-CB 3.3Å; L81-A85 PolarHBondContact O-N 3.19Å
82	L	97.1	Very high	95.4	Very high	55 Å²	55	84.4 Å²	84.4	29%	0.288	45%	0.452	S	S	.	.	H	α-helix	trans	-64.1	-42.3	179.3	-172.1	63.6	0	0	0	112.2	F6 V77 D78 Q80 A86	F6-L82 HydrophobicContact CD2-CD1 4.09Å; F6-L82 HydrophobicContact CE2-CD1 4.43Å; V77-L82 HydrophobicContact CG1-CD2 4.38Å; D78-L82 WeakPolarHBondContact O-CB 3.48Å; D78-L82 PolarHBondContact O-N 3.21Å; Q80-L82 VanDerWaalsContact C-N 3.3Å; Q80-L82 PolarHBondContact O-N 3.22Å; L82-A86 VanDerWaalsContact O-CB 3.28Å; L82-A86 WeakPolarHBondContact O-CB 3.49Å; L82-A86 PolarHBondContact O-N 2.94Å
83	Q	97.6	Very high	94.8	Very high	99 Å²	99	88.6 Å²	88.6	46%	0.463	47%	0.47	S	S	.	.	H	α-helix	trans	-61.9	-47.2	176.1	-75.5	172.2	40.5	0	0	111.8	T79 Q80 A86 R87	T79-Q83 WeakPolarHBondContact O-CB 3.41Å; T79-Q83 WeakPolarHBondContact O-CG 3.45Å; T79-Q83 PolarHBondContact O-N 3.04Å; T79-Q83 PolarHBondContact O-NE2 3.42Å; Q80-Q83 PolarHBondContact O-N 2.81Å; Q83-A86 PolarHBondContact O-N 3.44Å; Q83-R87 WeakPolarHBondContact O-CG 3.42Å; Q83-R87 PolarHBondContact O-N 2.82Å; Q83-R87 VanDerWaalsContact O-N 3.09Å
84	D	96.9	Very high	94.2	Very high	78 Å²	78	95.4 Å²	95.4	42%	0.417	50%	0.495	S	S	.	.	H	α-helix	trans	-66.3	-42.3	-179.1	-76.9	-9.9	0	0	0	111.9	Q80 L81 A86 R87 K88	Q80-D84 PolarHBondContact O-N 2.92Å; L81-D84 PolarHBondContact O-N 2.75Å; D84-A86 VanDerWaalsContact C-N 3.34Å; D84-A86 PolarHBondContact O-N 2.81Å; D84-R87 PolarHBondContact O-N 2.68Å; D84-R87 IonicContact OD1-CZ 2.69Å; D84-R87 IonicContact OD1-NH1 3.78Å; D84-R87 PolarHBondContact OD1-NH1 3.18Å; D84-K88 WeakPolarHBondContact O-CG 3.4Å; D84-K88 PolarHBondContact O-N 2.97Å; D84-K88 VanDerWaalsContact O-N 3.17Å
85	A	96.8	Very high	92.6	Very high	32 Å²	32	102 Å²	102	26%	0.264	51%	0.51	S	S	.	.	H	α-helix	trans	-64.2	-38.7	176.2	0	0	0	0	0	111.7	L2 L81 K88 E89	L2-A85 HydrophobicContact CD1-CB 3.37Å; L81-A85 VanDerWaalsContact O-CB 3.24Å; L81-A85 WeakPolarHBondContact O-CB 3.3Å; L81-A85 PolarHBondContact O-N 3.19Å; A85-K88 PolarHBondContact O-N 3.13Å; A85-E89 WeakPolarHBondContact O-CB 3.08Å; A85-E89 PolarHBondContact O-N 3.08Å
86	A	97.1	Very high	92.4	Very high	41 Å²	41	100.3 Å²	100.3	34%	0.339	50%	0.499	S	S	.	.	H	α-helix	trans	-64.2	-42.6	176.2	0	0	0	0	0	112.8	L2 L82 Q83 D84 K88 E89 A90	L2-A86 HydrophobicContact CD2-CB 4.09Å; L82-A86 VanDerWaalsContact O-CB 3.28Å; L82-A86 WeakPolarHBondContact O-CB 3.49Å; L82-A86 PolarHBondContact O-N 2.94Å; Q83-A86 PolarHBondContact O-N 3.44Å; D84-A86 VanDerWaalsContact C-N 3.34Å; D84-A86 PolarHBondContact O-N 2.81Å; A86-K88 VanDerWaalsContact C-N 3.35Å; A86-K88 PolarHBondContact O-N 2.79Å; A86-E89 PolarHBondContact O-N 3.26Å; A86-A90 WeakPolarHBondContact O-CB 3.48Å; A86-A90 PolarHBondContact O-N 2.73Å
87	R	96.2	Very high	92.4	Very high	140 Å²	140	102.5 Å²	102.5	53%	0.528	51%	0.511	S	S	.	.	H	α-helix	trans	-60.9	-44.3	175.7	-68.1	179.4	-159.2	127.9	5.8	111.4	Q83 D84 M91	Q83-R87 WeakPolarHBondContact O-CG 3.42Å; Q83-R87 PolarHBondContact O-N 2.82Å; Q83-R87 VanDerWaalsContact O-N 3.09Å; D84-R87 PolarHBondContact O-N 2.68Å; D84-R87 IonicContact OD1-CZ 2.69Å; D84-R87 IonicContact OD1-NH1 3.78Å; D84-R87 PolarHBondContact OD1-NH1 3.18Å; R87-M91 WeakPolarHBondContact O-CG 3.17Å; R87-M91 PolarHBondContact O-N 3.42Å
88	K	95.3	Very high	92.2	Very high	138 Å²	138	106.6 Å²	106.6	60%	0.6	53%	0.53	S	S	*	.	H	α-helix	trans	-65.1	-47.8	178.5	-70.5	174.6	-177.6	173.6	0	112	D84 A85 A86 A90 M91 Q92	D84-K88 WeakPolarHBondContact O-CG 3.4Å; D84-K88 PolarHBondContact O-N 2.97Å; D84-K88 VanDerWaalsContact O-N 3.17Å; A85-K88 PolarHBondContact O-N 3.13Å; A86-K88 VanDerWaalsContact C-N 3.35Å; A86-K88 PolarHBondContact O-N 2.79Å; K88-A90 VanDerWaalsContact C-N 3.34Å; K88-A90 PolarHBondContact O-N 2.99Å; K88-M91 PolarHBondContact O-N 3.32Å; K88-Q92 WeakPolarHBondContact O-CG 3.38Å; K88-Q92 PolarHBondContact O-N 3.36Å; K88-Q92 VanDerWaalsContact O-N 3.1Å
89	E	95.3	Very high	91.9	Very high	31 Å²	31	107.2 Å²	107.2	15%	0.145	53%	0.531	C	S	.	.	H	α-helix	trans	-61.2	-41.7	178.7	178.4	85.9	-158.1	0	0	111.3	M1 L2 A85 A86 M91 Q92 Q93	M1-E89 PolarHBondContact N-OE1 3.28Å; M1-E89 PolarHBondContact N-OE2 3.05Å; L2-E89 HydrophobicContact CB-CB 4.29Å; L2-E89 HydrophobicContact CB-CG 3.96Å; L2-E89 PolarHBondContact N-OE2 3.28Å; A85-E89 WeakPolarHBondContact O-CB 3.08Å; A85-E89 PolarHBondContact O-N 3.08Å; A86-E89 PolarHBondContact O-N 3.26Å; E89-M91 VanDerWaalsContact C-N 3.31Å; E89-M91 PolarHBondContact O-N 3.18Å; E89-Q92 PolarHBondContact O-N 2.78Å; E89-Q93 HydrophobicContact CG-CG 4.48Å; E89-Q93 WeakPolarHBondContact O-CG 3.38Å; E89-Q93 PolarHBondContact O-N 3.48Å; E89-Q93 PolarHBondContact OE1-NE2 3.3Å
90	A	95	Very high	91.6	Very high	48 Å²	48	108.7 Å²	108.7	40%	0.397	53%	0.532	S	S	.	.	H	α-helix	trans	-66	-30.1	179	0	0	0	0	0	113.6	A86 K88 K94	A86-A90 WeakPolarHBondContact O-CB 3.48Å; A86-A90 PolarHBondContact O-N 2.73Å; K88-A90 VanDerWaalsContact C-N 3.34Å; K88-A90 PolarHBondContact O-N 2.99Å; A90-K94 WeakPolarHBondContact O-CG 3.36Å
91	M	94.1	Very high	91.3	Very high	139 Å²	139	106.5 Å²	106.5	69%	0.685	52%	0.523	S	S	*	.	H	α-helix	trans	-72.3	-39.6	172.1	-69.8	178.2	-177.6	0	0	111.5	R87 K88 E89 K94	R87-M91 WeakPolarHBondContact O-CG 3.17Å; R87-M91 PolarHBondContact O-N 3.42Å; K88-M91 PolarHBondContact O-N 3.32Å; E89-M91 VanDerWaalsContact C-N 3.31Å; E89-M91 PolarHBondContact O-N 3.18Å; M91-K94 PolarHBondContact O-N 2.86Å
92	Q	91	Very high	90.9	Very high	124 Å²	124	105.7 Å²	105.7	58%	0.579	52%	0.517	S	S	*	.	H	α-helix	trans	-68.4	-38.1	179.2	-70.7	172.7	1.6	0	0	112.8	K88 E89 K94 Q95	K88-Q92 WeakPolarHBondContact O-CG 3.38Å; K88-Q92 PolarHBondContact O-N 3.36Å; K88-Q92 VanDerWaalsContact O-N 3.1Å; E89-Q92 PolarHBondContact O-N 2.78Å; Q92-K94 PolarHBondContact O-N 3.17Å; Q92-Q95 PolarHBondContact O-N 3.3Å
93	Q	83.1	Confident	90.4	Very high	141 Å²	141	109.6 Å²	109.6	66%	0.659	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.8	-15.6	179.2	-75.1	-176.7	11.1	0	0	114.3	E89	E89-Q93 HydrophobicContact CG-CG 4.48Å; E89-Q93 WeakPolarHBondContact O-CG 3.38Å; E89-Q93 PolarHBondContact O-N 3.48Å; E89-Q93 PolarHBondContact OE1-NE2 3.3Å
94	K	77.4	Confident	89.8	Confident	185 Å²	185	110.5 Å²	110.5	80%	0.804	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.2	-10.6	179.9	-73.3	-179.7	178.5	-175.2	0	113.5	A90 M91 Q92	A90-K94 WeakPolarHBondContact O-CG 3.36Å; M91-K94 PolarHBondContact O-N 2.86Å; Q92-K94 PolarHBondContact O-N 3.17Å
95	Q	59.3	Low	89.1	Confident	229 Å²	229	113.5 Å²	113.5	100%	1.07	55%	0.552	S	S	*	*			trans	-89	0	172.6	-74.7	-177.7	-7.1	0	0	110	Q92	Q92-Q95 PolarHBondContact O-N 3.3Å

Retrieved 95 of 95 residues in 63.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).