A0A4W5KLP8_9TELE Loading...

U6 snRNA-associated Sm-like protein LSm1

Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated. Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation. Probably involved with other LSm subunits in the general process of degradation of mRNAs.

AlphaFold DB , UniProt , Accession A0A4W5KLP8, Species 9TELE (Hucho hucho, huchen), Gene LSM1, Length 133 aa.

						>A0A4W5KLP8_9TELE|A0A4W5KLP8|LSM1
MNYMPGTASLIDDIDKKHLVLLRDGRTLIGFLRSIDQFANLVFHQTVERIHVGKKFGDIPRGIFIVRGENVVLLGEIDMDKPCDTVLQQVSIEEILEEQRLQQQAKQETEKAKVTALKDRGLSIPKADNLDEY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.9	Low	76	Confident	233 Å²	233	98.6 Å²	98.6	100%	1.148	54%	0.539	S	S	*	.				0	136.6	0	-71.9	-168.6	-160.1	0	0	108.3	Y3	M1-Y3 PolarHBondContact O-N 3.23Å
2	N	66.4	Low	77.1	Confident	158 Å²	158	99.3 Å²	99.3	85%	0.845	54%	0.542	S	S	*	.	P	Polyproline II helix	trans	-67.9	122.1	173.2	-93.9	-5.4	0	0	0	108.6	M4	N2-M4 PolarHBondContact O-N 3.38Å
3	Y	72.7	Confident	78.1	Confident	202 Å²	202	93.7 Å²	93.7	79%	0.792	51%	0.511	S	S	*	.	P	Polyproline II helix	trans	-60.3	116.2	169.1	174.6	-100.7	0	0	0	108.8	M1 P5	M1-Y3 PolarHBondContact O-N 3.23Å; Y3-P5 HydrophobicContact CD1-CB 4.44Å; Y3-P5 HydrophobicContact CE1-CB 3.92Å
4	M	72.1	Confident	79.1	Confident	102 Å²	102	91.6 Å²	91.6	50%	0.502	50%	0.498	S	S	.	.	P	Polyproline II helix	trans	-88.8	117.2	170.4	-73.8	-152.9	147.7	0	0	108.6	N2 A8	N2-M4 PolarHBondContact O-N 3.38Å; M4-A8 HydrophobicContact CB-CB 3.84Å; M4-A8 HydrophobicContact SD-CB 4.11Å
5	P	76.9	Confident	80.1	Confident	92 Å²	92	91.9 Å²	91.9	60%	0.597	50%	0.499	S	S	*	.	P	Polyproline II helix	trans	-75.3	145.7	-175.9	29.7	-34.4	0	0	0	112.1	Y3	Y3-P5 HydrophobicContact CD1-CB 4.44Å; Y3-P5 HydrophobicContact CE1-CB 3.92Å
6	G	79.1	Confident	81	Confident	52 Å²	52	90.4 Å²	90.4	54%	0.536	49%	0.486	S	S	.	.	G	3₁₀ helix	trans	65	-141.9	172	0	0	0	0	0	112.8	A8 S9	G6-A8 PolarHBondContact O-N 3.42Å; G6-S9 WeakPolarHBondContact O-CB 3.5Å; G6-S9 PolarHBondContact O-N 3.02Å; G6-S9 PolarHBondContact O-OG 3.48Å
7	T	79.5	Confident	81.8	Confident	44 Å²	44	88.5 Å²	88.5	27%	0.27	47%	0.473	S	S	.	.	G	3₁₀ helix	trans	-58.7	-21.9	-175.4	-42.7	0	0	0	0	114	S9 L10 D36 Q37 A39	T7-S9 PolarHBondContact O-N 3.44Å; T7-L10 HydrophobicContact CG2-CD1 4.23Å; T7-L10 WeakPolarHBondContact O-CB 3.46Å; T7-L10 PolarHBondContact O-N 2.92Å; T7-L10 VanDerWaalsContact O-N 3.09Å; T7-D36 WeakPolarHBondContact CG2-O 3.46Å; T7-Q37 PolarHBondContact OG1-O 2.97Å; T7-A39 HydrophobicContact CG2-CB 4.47Å
8	A	80	Confident	82.5	Confident	34 Å²	34	83.7 Å²	83.7	28%	0.281	45%	0.447	S	S	.	.	G	3₁₀ helix	trans	-64.9	-23.1	176.3	0	0	0	0	0	112.8	M4 G6 L10 I11	M4-A8 HydrophobicContact CB-CB 3.84Å; M4-A8 HydrophobicContact SD-CB 4.11Å; G6-A8 PolarHBondContact O-N 3.42Å; A8-L10 VanDerWaalsContact C-N 3.26Å; A8-L10 PolarHBondContact O-N 3.48Å; A8-I11 WeakPolarHBondContact O-CG1 3.34Å; A8-I11 PolarHBondContact O-N 3.41Å
9	S	84.4	Confident	83.2	Confident	49 Å²	49	82.1 Å²	82.1	34%	0.343	44%	0.438	S	S	.	.	G	3₁₀ helix	trans	-67.1	-28.7	173.3	72	0	0	0	0	112.6	G6 T7 I11 D12	G6-S9 WeakPolarHBondContact O-CB 3.5Å; G6-S9 PolarHBondContact O-N 3.02Å; G6-S9 PolarHBondContact O-OG 3.48Å; T7-S9 PolarHBondContact O-N 3.44Å; S9-I11 PolarHBondContact O-N 3.01Å; S9-D12 PolarHBondContact O-N 3Å
10	L	85.1	Confident	83.8	Confident	26 Å²	26	78 Å²	78	14%	0.136	42%	0.416	C	S	.	.	G	3₁₀ helix	trans	-73.5	-9.1	-177.7	-61.2	177.8	0	0	0	113	T7 A8 D12 D13 I35 L74	T7-L10 HydrophobicContact CG2-CD1 4.23Å; T7-L10 WeakPolarHBondContact O-CB 3.46Å; T7-L10 PolarHBondContact O-N 2.92Å; T7-L10 VanDerWaalsContact O-N 3.09Å; A8-L10 VanDerWaalsContact C-N 3.26Å; A8-L10 PolarHBondContact O-N 3.48Å; L10-D12 PolarHBondContact O-N 3.01Å; L10-D13 WeakPolarHBondContact O-CB 3.43Å; L10-D13 PolarHBondContact O-N 3.39Å; L10-D13 VanDerWaalsContact O-N 3.12Å; L10-I35 VanDerWaalsContact C-CD1 3.44Å; L10-I35 HydrophobicContact CB-CD1 3.5Å; L10-I35 HydrophobicContact CB-CG2 4.46Å; L10-L74 HydrophobicContact CD2-CD2 3.68Å
11	I	87.9	Confident	84.3	Confident	93 Å²	93	76.6 Å²	76.6	48%	0.477	41%	0.408	S	S	.	.	G	3₁₀ helix	trans	-64.1	-37.2	175.1	-63.1	171.8	0	0	0	110	A8 S9 D13 I14 I35	A8-I11 WeakPolarHBondContact O-CG1 3.34Å; A8-I11 PolarHBondContact O-N 3.41Å; S9-I11 PolarHBondContact O-N 3.01Å; I11-D13 PolarHBondContact O-N 3.49Å; I11-I14 HydrophobicContact CG2-CD1 4.45Å; I11-I14 WeakPolarHBondContact O-CG1 3.23Å; I11-I14 PolarHBondContact O-N 3.33Å; I11-I35 HydrophobicContact CG1-CD1 3.97Å
12	D	88.8	Confident	86.3	Confident	107 Å²	107	66 Å²	66	57%	0.572	36%	0.357	S	S	*	.	G	3₁₀ helix	trans	-71.2	-10.5	177.5	-66	-26.9	0	0	0	112.4	S9 L10 K16	S9-D12 PolarHBondContact O-N 3Å; L10-D12 PolarHBondContact O-N 3.01Å; D12-K16 WeakPolarHBondContact O-CE 3.43Å; D12-K16 PolarHBondContact O-NZ 3.46Å
13	D	90.3	Very high	87.6	Confident	26 Å²	26	65 Å²	65	14%	0.139	34%	0.341	C	S	.	.	G	3₁₀ helix	trans	-98.6	-1.3	-176.4	-73.3	-29	0	0	0	113.4	L10 I11 K16 H18 L32	L10-D13 WeakPolarHBondContact O-CB 3.43Å; L10-D13 PolarHBondContact O-N 3.39Å; L10-D13 VanDerWaalsContact O-N 3.12Å; I11-D13 PolarHBondContact O-N 3.49Å; D13-K16 PolarHBondContact O-N 3.17Å; D13-K16 IonicContact OD1-NZ 3.63Å; D13-K16 PolarHBondContact OD1-NZ 3.2Å; D13-H18 VanDerWaalsContact CB-CE1 3.41Å; D13-H18 WeakPolarHBondContact CB-CE1 3.36Å; D13-H18 PolarHBondContact O-CE1 3.41Å; D13-H18 IonicContact OD1-CE1 2.77Å; D13-H18 IonicContact OD1-NE2 3.71Å; D13-H18 IonicContact OD2-NE2 3.63Å; D13-L32 HydrophobicContact CB-CD2 4.13Å
14	I	92.7	Very high	88.2	Confident	65 Å²	65	60.2 Å²	60.2	33%	0.333	33%	0.329	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.1	141.8	173.4	-63.3	173.8	0	0	0	109.9	I11 K16	I11-I14 HydrophobicContact CG2-CD1 4.45Å; I11-I14 WeakPolarHBondContact O-CG1 3.23Å; I11-I14 PolarHBondContact O-N 3.33Å; I14-K16 PolarHBondContact O-N 3.02Å; I14-K16 VanDerWaalsContact O-N 3.1Å
15	D	93.9	Very high	89	Confident	96 Å²	96	57.9 Å²	57.9	51%	0.513	33%	0.331	S	S	.	.	T	Hydrogen-bonded Turn	trans	64.5	3.4	-178.4	-62.1	-30.7	0	0	0	115.9	L32 R33	D15-L32 WeakPolarHBondContact CA-O 3.4Å; D15-L32 PolarHBondContact N-O 3Å; D15-R33 WeakPolarHBondContact OD1-CD 3.41Å; D15-R33 IonicContact OD1-CZ 3.52Å; D15-R33 IonicContact OD1-NE 3.53Å; D15-R33 IonicContact OD1-NH1 3.57Å; D15-R33 PolarHBondContact OD1-NH1 3.33Å
16	K	94.2	Very high	89.8	Confident	67 Å²	67	56.9 Å²	56.9	29%	0.291	32%	0.315	S	S	.	.	S	Bend	trans	-93.7	156.2	172.1	-50.8	-174.2	-166.4	152.4	0	112.1	D12 D13 I14 H18 L32 E76	D12-K16 WeakPolarHBondContact O-CE 3.43Å; D12-K16 PolarHBondContact O-NZ 3.46Å; D13-K16 PolarHBondContact O-N 3.17Å; D13-K16 IonicContact OD1-NZ 3.63Å; D13-K16 PolarHBondContact OD1-NZ 3.2Å; I14-K16 PolarHBondContact O-N 3.02Å; I14-K16 VanDerWaalsContact O-N 3.1Å; K16-H18 PolarHBondContact O-ND1 3.42Å; K16-L32 PolarHBondContact O-N 2.95Å; K16-L32 VanDerWaalsContact O-N 3.08Å; K16-E76 HydrophobicContact CB-CG 4.32Å; K16-E76 HydrophobicContact CD-CG 3.93Å; K16-E76 WeakPolarHBondContact CD-OE1 3.39Å; K16-E76 VanDerWaalsContact CD-OE2 3.31Å; K16-E76 WeakPolarHBondContact CD-OE2 3.31Å; K16-E76 IonicContact NZ-OE1 2.97Å; K16-E76 IonicContact NZ-OE2 3.96Å; K16-E76 PolarHBondContact NZ-OE2 3.13Å
17	K	94.4	Very high	90.5	Very high	59 Å²	59	55.1 Å²	55.1	26%	0.257	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	131.7	176.7	-164.6	177.6	-173.2	177.4	0	109.9	I29 G30 F31 I77 M79	K17-I29 HydrophobicContact CD-CG2 4.46Å; K17-I29 VanDerWaalsContact CE-CG2 3.5Å; K17-I29 HydrophobicContact CG-CG2 4.35Å; K17-G30 CarbonylContact C-O 3.58Å; K17-G30 WeakPolarHBondContact CA-O 3.42Å; K17-F31 HydrophobicContact CB-CD1 4.19Å; K17-F31 HydrophobicContact CB-CE1 3.95Å; K17-F31 HydrophobicContact CB-CZ 4.4Å; K17-F31 HydrophobicContact CD-CZ 4.45Å; K17-I77 HydrophobicContact CB-CB 4.44Å; K17-I77 HydrophobicContact CD-CD1 4.49Å; K17-I77 HydrophobicContact CG-CB 4.39Å; K17-I77 HydrophobicContact CG-CD1 4.25Å; K17-I77 PolarHBondContact O-N 2.96Å; K17-M79 HydrophobicContact CD-SD 3.44Å; K17-M79 WeakPolarHBondContact CD-SD 3.37Å
18	H	94.9	Very high	91.3	Very high	1 Å²	1	53.1 Å²	53.1	1%	0.005	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	149.4	-176.7	-76.8	81.9	0	0	0	111.7	D13 K16 I29 G30 F43 L74 G75 E76	D13-H18 VanDerWaalsContact CB-CE1 3.41Å; D13-H18 WeakPolarHBondContact CB-CE1 3.36Å; D13-H18 PolarHBondContact O-CE1 3.41Å; D13-H18 IonicContact OD1-CE1 2.77Å; D13-H18 IonicContact OD1-NE2 3.71Å; D13-H18 IonicContact OD2-NE2 3.63Å; K16-H18 PolarHBondContact O-ND1 3.42Å; H18-I29 VanDerWaalsContact O-CA 3.32Å; H18-I29 WeakPolarHBondContact O-CA 3.41Å; H18-G30 PolarHBondContact N-O 3.45Å; H18-G30 PolarHBondContact O-N 3.25Å; H18-F43 HydrophobicContact CB-CE1 3.92Å; H18-F43 HydrophobicContact CB-CZ 4.36Å; H18-L74 HydrophobicContact CB-CG 4.46Å; H18-L74 WeakPolarHBondContact CD2-CD2 3.43Å; H18-G75 CarbonylContact C-O 3.53Å; H18-G75 WeakPolarHBondContact CA-O 3.41Å; H18-G75 VanDerWaalsContact CD2-C 3.47Å; H18-E76 VanDerWaalsContact CD2-CA 3.45Å; H18-E76 WeakPolarHBondContact CD2-CA 3.41Å; H18-E76 PolarHBondContact CD2-N 2.85Å
19	L	94.9	Very high	92.1	Very high	53 Å²	53	52 Å²	52	28%	0.277	27%	0.271	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	132	165	-174.7	148.3	0	0	0	108.8	T27 L28 I29 L73 L74 G75 I77	L19-T27 HydrophobicContact CD1-CG2 3.75Å; L19-T27 HydrophobicContact CD2-CG2 3.86Å; L19-T27 HydrophobicContact CG-CG2 3.63Å; L19-L28 CarbonylContact C-O 3.55Å; L19-L28 WeakPolarHBondContact CA-O 3.23Å; L19-I29 HydrophobicContact CB-CG1 4.43Å; L19-I29 HydrophobicContact CD1-CD1 4.32Å; L19-I29 HydrophobicContact CD1-CG1 4.24Å; L19-I29 HydrophobicContact CG-CG1 4.25Å; L19-L73 HydrophobicContact CD2-CD1 4.26Å; L19-L74 WeakPolarHBondContact O-CA 3.48Å; L19-G75 PolarHBondContact N-O 3.39Å; L19-G75 PolarHBondContact O-N 3.02Å; L19-I77 HydrophobicContact CB-CD1 3.9Å; L19-I77 HydrophobicContact CB-CG1 4.1Å
20	V	95.3	Very high	92.6	Very high	0 Å²	0	49.8 Å²	49.8	0%	0	26%	0.255	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	127.1	176.4	-177.8	0	0	0	0	109.6	L22 T27 L28 L41 F43 V71 L73 L74	V20-L22 HydrophobicContact CG1-CD2 3.93Å; V20-T27 WeakPolarHBondContact O-CA 3.45Å; V20-L28 HydrophobicContact CB-CB 4.49Å; V20-L28 PolarHBondContact N-O 3.46Å; V20-L28 PolarHBondContact O-N 3.04Å; V20-L41 HydrophobicContact CG2-CD1 4.24Å; V20-F43 HydrophobicContact CG2-CE1 4.28Å; V20-F43 HydrophobicContact CG2-CE2 3.55Å; V20-F43 HydrophobicContact CG2-CZ 3.3Å; V20-V71 HydrophobicContact CG1-CG1 4.07Å; V20-V71 HydrophobicContact CG1-CG2 4.28Å; V20-L73 WeakPolarHBondContact CA-O 3.29Å; V20-L74 HydrophobicContact CG2-CB 4.37Å; V20-L74 HydrophobicContact CG2-CD1 3.87Å; V20-L74 HydrophobicContact CG2-CG 4.18Å
21	L	95.4	Very high	93.1	Very high	50 Å²	50	51.2 Å²	51.2	26%	0.262	26%	0.261	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	126.9	168.8	-171.7	65.4	0	0	0	109	V72 L73	L21-V72 HydrophobicContact CB-CB 4.46Å; L21-V72 HydrophobicContact CD2-CB 4.48Å; L21-V72 HydrophobicContact CD2-CG1 4.31Å; L21-V72 HydrophobicContact CG-CB 4.47Å; L21-V72 WeakPolarHBondContact O-CB 3.31Å; L21-V72 PolarHBondContact O-N 3.43Å; L21-L73 HydrophobicContact CB-CD1 4.18Å; L21-L73 HydrophobicContact CB-CD2 4.17Å; L21-L73 HydrophobicContact CB-CG 3.73Å; L21-L73 HydrophobicContact CD2-CD2 3.85Å; L21-L73 HydrophobicContact CD2-CG 4.33Å; L21-L73 PolarHBondContact N-O 3.32Å
22	L	94.4	Very high	93.5	Very high	11 Å²	11	46.8 Å²	46.8	6%	0.058	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-93.3	160.9	176.2	-59.8	-175.2	0	0	0	111.6	V20 D24 G25 R26 L28 V66 N70	V20-L22 HydrophobicContact CG1-CD2 3.93Å; L22-D24 WeakPolarHBondContact CB-OD1 3.46Å; L22-D24 PolarHBondContact O-N 3.48Å; L22-G25 WeakPolarHBondContact O-CA 3.48Å; L22-G25 PolarHBondContact O-N 3.35Å; L22-R26 HydrophobicContact CB-CB 4.47Å; L22-R26 HydrophobicContact CD1-CB 4.3Å; L22-R26 PolarHBondContact N-O 3.37Å; L22-L28 HydrophobicContact CD1-CD1 3.89Å; L22-L28 HydrophobicContact CD1-CG 4.26Å; L22-L28 HydrophobicContact CG-CD1 4.43Å; L22-V66 HydrophobicContact CD2-CG1 3.51Å; L22-N70 CarbonylContact C-O 3.57Å; L22-N70 VanDerWaalsContact CA-O 3.25Å; L22-N70 WeakPolarHBondContact CA-O 3.29Å
23	R	91.7	Very high	93.8	Very high	136 Å²	136	46.8 Å²	46.8	51%	0.513	23%	0.23	S	C	.	.	T	Hydrogen-bonded Turn	trans	-60.9	-30.4	178.5	-173.8	-175.6	-64.8	-93	-2.7	113.3	G25 E69 N70 V72 L130	R23-G25 PolarHBondContact O-N 3.12Å; R23-E69 PolarHBondContact NE-O 2.87Å; R23-E69 PolarHBondContact NH2-O 2.82Å; R23-N70 PolarHBondContact N-O 3.01Å; R23-V72 HydrophobicContact CB-CG2 4.21Å; R23-L130 HydrophobicContact CG-CD1 4.42Å
24	D	86.9	Confident	94	Very high	101 Å²	101	48.5 Å²	48.5	54%	0.54	24%	0.244	S	C	.	.	T	Hydrogen-bonded Turn	trans	-76.4	0.6	174.6	63.4	7.7	0	0	0	113.3	L22 R26	L22-D24 WeakPolarHBondContact CB-OD1 3.46Å; L22-D24 PolarHBondContact O-N 3.48Å; D24-R26 VanDerWaalsContact C-N 3.34Å; D24-R26 VanDerWaalsContact CG-CD 3.41Å; D24-R26 VanDerWaalsContact OD1-CB 3.29Å; D24-R26 WeakPolarHBondContact OD1-CB 3.32Å; D24-R26 WeakPolarHBondContact OD1-CD 3.38Å; D24-R26 VanDerWaalsContact OD1-CG 3.3Å; D24-R26 WeakPolarHBondContact OD1-CG 3.34Å; D24-R26 PolarHBondContact OD1-N 3.01Å; D24-R26 WeakPolarHBondContact OD2-CD 3.26Å; D24-R26 IonicContact OD2-NH1 2.82Å
25	G	89	Confident	94.1	Very high	53 Å²	53	46.9 Å²	46.9	55%	0.546	24%	0.236	S	C	.	.	S	Bend	trans	84.8	2.5	179.4	0	0	0	0	0	114.3	L22 R23	L22-G25 WeakPolarHBondContact O-CA 3.48Å; L22-G25 PolarHBondContact O-N 3.35Å; R23-G25 PolarHBondContact O-N 3.12Å
26	R	91.9	Very high	94.1	Very high	72 Å²	72	44.8 Å²	44.8	27%	0.272	22%	0.224	S	C	.	.			trans	-73.8	144.7	175.8	-63.8	164.2	74.3	-162.9	-3.7	110.8	L22 D24 E48	L22-R26 HydrophobicContact CB-CB 4.47Å; L22-R26 HydrophobicContact CD1-CB 4.3Å; L22-R26 PolarHBondContact N-O 3.37Å; D24-R26 VanDerWaalsContact C-N 3.34Å; D24-R26 VanDerWaalsContact CG-CD 3.41Å; D24-R26 VanDerWaalsContact OD1-CB 3.29Å; D24-R26 WeakPolarHBondContact OD1-CB 3.32Å; D24-R26 WeakPolarHBondContact OD1-CD 3.38Å; D24-R26 VanDerWaalsContact OD1-CG 3.3Å; D24-R26 WeakPolarHBondContact OD1-CG 3.34Å; D24-R26 PolarHBondContact OD1-N 3.01Å; D24-R26 WeakPolarHBondContact OD2-CD 3.26Å; D24-R26 IonicContact OD2-NH1 2.82Å; R26-E48 IonicContact CZ-OE1 3.11Å; R26-E48 IonicContact CZ-OE2 3.51Å; R26-E48 VanDerWaalsContact NE-CD 3.34Å; R26-E48 IonicContact NE-OE1 3.65Å; R26-E48 PolarHBondContact NE-OE1 3.23Å; R26-E48 IonicContact NE-OE2 2.73Å; R26-E48 IonicContact NH2-OE1 3.51Å; R26-E48 IonicContact NH2-OE2 3.41Å; R26-E48 PolarHBondContact NH2-OE2 3.27Å
27	T	95.1	Very high	93.8	Very high	15 Å²	15	48.2 Å²	48.2	9%	0.092	24%	0.241	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	121.2	175	-55.8	0	0	0	0	109.4	L19 V20 E48 R49	L19-T27 HydrophobicContact CD1-CG2 3.75Å; L19-T27 HydrophobicContact CD2-CG2 3.86Å; L19-T27 HydrophobicContact CG-CG2 3.63Å; V20-T27 WeakPolarHBondContact O-CA 3.45Å; T27-E48 CarbonylContact O-C 3.5Å; T27-E48 WeakPolarHBondContact O-CA 3.24Å; T27-R49 WeakPolarHBondContact CB-O 3.1Å; T27-R49 PolarHBondContact O-N 3.39Å
28	L	96.3	Very high	93.6	Very high	1 Å²	1	52.1 Å²	52.1	1%	0.005	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	141.1	174.6	-61.6	-179.4	0	0	0	109.8	L19 V20 L22 T46 E48 F64 V66	L19-L28 CarbonylContact C-O 3.55Å; L19-L28 WeakPolarHBondContact CA-O 3.23Å; V20-L28 HydrophobicContact CB-CB 4.49Å; V20-L28 PolarHBondContact N-O 3.46Å; V20-L28 PolarHBondContact O-N 3.04Å; L22-L28 HydrophobicContact CD1-CD1 3.89Å; L22-L28 HydrophobicContact CD1-CG 4.26Å; L22-L28 HydrophobicContact CG-CD1 4.43Å; L28-T46 HydrophobicContact CB-CG2 4.05Å; L28-T46 HydrophobicContact CD1-CG2 4.49Å; L28-T46 HydrophobicContact CD2-CG2 4.18Å; L28-T46 HydrophobicContact CG-CG2 4.48Å; L28-E48 HydrophobicContact CD2-CB 3.75Å; L28-E48 HydrophobicContact CD2-CG 4.03Å; L28-F64 HydrophobicContact CD1-CD1 3.57Å; L28-F64 HydrophobicContact CD1-CE1 3.59Å; L28-F64 HydrophobicContact CD1-CG 4.29Å; L28-F64 HydrophobicContact CD1-CZ 4.33Å; L28-V66 HydrophobicContact CD1-CG2 3.81Å
29	I	95.8	Very high	93.3	Very high	12 Å²	12	53.1 Å²	53.1	6%	0.062	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	124.2	175.8	-62.4	173.2	0	0	0	107.8	K17 H18 L19 T46 V47 R49 I77	K17-I29 HydrophobicContact CD-CG2 4.46Å; K17-I29 VanDerWaalsContact CE-CG2 3.5Å; K17-I29 HydrophobicContact CG-CG2 4.35Å; H18-I29 VanDerWaalsContact O-CA 3.32Å; H18-I29 WeakPolarHBondContact O-CA 3.41Å; L19-I29 HydrophobicContact CB-CG1 4.43Å; L19-I29 HydrophobicContact CD1-CD1 4.32Å; L19-I29 HydrophobicContact CD1-CG1 4.24Å; L19-I29 HydrophobicContact CG-CG1 4.25Å; I29-T46 CarbonylContact O-C 3.58Å; I29-T46 VanDerWaalsContact O-CA 3.29Å; I29-T46 WeakPolarHBondContact O-CA 3.32Å; I29-V47 PolarHBondContact N-O 2.94Å; I29-V47 PolarHBondContact O-N 2.83Å; I29-R49 HydrophobicContact CD1-CB 4.03Å; I29-I77 HydrophobicContact CB-CD1 4.5Å; I29-I77 HydrophobicContact CG1-CD1 4.27Å; I29-I77 HydrophobicContact CG2-CD1 3.59Å
30	G	96.1	Very high	93.3	Very high	1 Å²	1	52.7 Å²	52.7	1%	0.01	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-168.7	-179.9	-179.3	0	0	0	0	0	112.8	K17 H18	K17-G30 CarbonylContact C-O 3.58Å; K17-G30 WeakPolarHBondContact CA-O 3.42Å; H18-G30 PolarHBondContact N-O 3.45Å; H18-G30 PolarHBondContact O-N 3.25Å
31	F	95.9	Very high	93.3	Very high	57 Å²	57	52.8 Å²	52.8	25%	0.25	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91	122.6	173.9	-68.1	-87.6	0	0	0	110.1	K17 R33 F43 H44 Q45	K17-F31 HydrophobicContact CB-CD1 4.19Å; K17-F31 HydrophobicContact CB-CE1 3.95Å; K17-F31 HydrophobicContact CB-CZ 4.4Å; K17-F31 HydrophobicContact CD-CZ 4.45Å; F31-R33 PolarHBondContact O-N 2.89Å; F31-F43 WeakPolarHBondContact O-CA 3.28Å; F31-H44 PolarHBondContact N-O 3.31Å; F31-H44 PolarHBondContact O-N 2.89Å; F31-Q45 HydrophobicContact CD2-CB 4.23Å
32	L	95.9	Very high	93.3	Very high	0 Å²	0	52.5 Å²	52.5	0%	0	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.5	123	177.6	-175.7	61.5	0	0	0	109	D13 D15 K16 I35 L41 F43	D13-L32 HydrophobicContact CB-CD2 4.13Å; D15-L32 WeakPolarHBondContact CA-O 3.4Å; D15-L32 PolarHBondContact N-O 3Å; K16-L32 PolarHBondContact O-N 2.95Å; K16-L32 VanDerWaalsContact O-N 3.08Å; L32-I35 HydrophobicContact CD1-CG2 3.79Å; L32-I35 HydrophobicContact CD2-CG2 3.77Å; L32-I35 HydrophobicContact CG-CG2 4.05Å; L32-L41 HydrophobicContact CD1-CB 3.98Å; L32-L41 HydrophobicContact CD1-CD2 4.12Å; L32-F43 HydrophobicContact CB-CD1 4.36Å; L32-F43 HydrophobicContact CB-CE1 3.82Å; L32-F43 HydrophobicContact CD1-CD1 4.47Å; L32-F43 HydrophobicContact CD1-CE1 3.9Å; L32-F43 HydrophobicContact CD1-CE2 4.37Å; L32-F43 HydrophobicContact CD1-CZ 3.84Å; L32-F43 HydrophobicContact CG-CE1 4.46Å
33	R	95.6	Very high	93.4	Very high	107 Å²	107	52 Å²	52	40%	0.404	26%	0.264	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	-31.3	-178.5	-65.9	-56.5	-173.1	-172.9	-3.7	113.5	D15 F31 V42 H44	D15-R33 WeakPolarHBondContact OD1-CD 3.41Å; D15-R33 IonicContact OD1-CZ 3.52Å; D15-R33 IonicContact OD1-NE 3.53Å; D15-R33 IonicContact OD1-NH1 3.57Å; D15-R33 PolarHBondContact OD1-NH1 3.33Å; F31-R33 PolarHBondContact O-N 2.89Å; R33-V42 PolarHBondContact N-O 2.86Å; R33-H44 HydrophobicContact CG-CB 3.64Å
34	S	94.4	Very high	93.6	Very high	61 Å²	61	48.6 Å²	48.6	43%	0.427	25%	0.253	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.8	149.5	-178.8	-168.6	0	0	0	0	110.4	V42	S34-V42 PolarHBondContact O-N 3.44Å
35	I	94.2	Very high	94.1	Very high	32 Å²	32	49.4 Å²	49.4	16%	0.164	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.5	155.4	176.6	58.5	171.3	0	0	0	109	L10 I11 L32 N40 L41	L10-I35 VanDerWaalsContact C-CD1 3.44Å; L10-I35 HydrophobicContact CB-CD1 3.5Å; L10-I35 HydrophobicContact CB-CG2 4.46Å; I11-I35 HydrophobicContact CG1-CD1 3.97Å; L32-I35 HydrophobicContact CD1-CG2 3.79Å; L32-I35 HydrophobicContact CD2-CG2 3.77Å; L32-I35 HydrophobicContact CG-CG2 4.05Å; I35-N40 WeakPolarHBondContact CA-O 3.4Å; I35-L41 HydrophobicContact CB-CD2 4.48Å; I35-L41 HydrophobicContact CG2-CD2 3.61Å
36	D	92.8	Very high	94.4	Very high	51 Å²	51	47 Å²	47	27%	0.273	23%	0.228	S	C	.	.			trans	-121.9	177.3	166.1	74.7	6.1	0	0	0	111.5	T7 F38 A39 N40	T7-D36 WeakPolarHBondContact CG2-O 3.46Å; D36-F38 PolarHBondContact O-N 2.91Å; D36-F38 VanDerWaalsContact O-N 3.12Å; D36-F38 WeakPolarHBondContact OD1-CA 3.41Å; D36-F38 PolarHBondContact OD1-N 3.01Å; D36-A39 PolarHBondContact O-N 3.01Å; D36-A39 PolarHBondContact OD1-N 3.38Å; D36-A39 VanDerWaalsContact OD1-N 3.1Å; D36-N40 PolarHBondContact N-O 3.32Å; D36-N40 WeakPolarHBondContact OD1-CB 3.16Å; D36-N40 PolarHBondContact OD1-N 3.39Å; D36-N40 PolarHBondContact OD1-ND2 3.5Å; D36-N40 WeakPolarHBondContact OD2-CB 3.39Å; D36-N40 PolarHBondContact OD2-ND2 2.92Å
37	Q	89.2	Confident	94.6	Very high	140 Å²	140	45.5 Å²	45.5	65%	0.654	23%	0.227	S	C	*	.	T	Hydrogen-bonded Turn	trans	-63.2	-18.3	-178.9	67.9	-90.8	13.4	0	0	114.5	T7 A39	T7-Q37 PolarHBondContact OG1-O 2.97Å; Q37-A39 VanDerWaalsContact C-N 3.32Å
38	F	89.6	Confident	94.6	Very high	140 Å²	140	45.3 Å²	45.3	61%	0.614	23%	0.225	S	C	*	.	T	Hydrogen-bonded Turn	trans	-93.7	7.7	178.4	-56.7	-68.8	0	0	0	112.5	D36 N40 G68	D36-F38 PolarHBondContact O-N 2.91Å; D36-F38 VanDerWaalsContact O-N 3.12Å; D36-F38 WeakPolarHBondContact OD1-CA 3.41Å; D36-F38 PolarHBondContact OD1-N 3.01Å; F38-N40 PolarHBondContact O-N 2.88Å; F38-G68 WeakPolarHBondContact O-CA 3.39Å
39	A	89.6	Confident	94.5	Very high	23 Å²	23	48.4 Å²	48.4	19%	0.19	24%	0.237	C	C	.	.			trans	60.1	31.5	-174.7	0	0	0	0	0	113.3	T7 D36 Q37 L41 G68	T7-A39 HydrophobicContact CG2-CB 4.47Å; D36-A39 PolarHBondContact O-N 3.01Å; D36-A39 PolarHBondContact OD1-N 3.38Å; D36-A39 VanDerWaalsContact OD1-N 3.1Å; Q37-A39 VanDerWaalsContact C-N 3.32Å; A39-L41 WeakPolarHBondContact O-CD2 3.34Å; A39-L41 WeakPolarHBondContact O-CG 3.48Å; A39-L41 PolarHBondContact O-N 3.25Å; A39-G68 WeakPolarHBondContact O-CA 3.43Å
40	N	93.6	Very high	94.4	Very high	44 Å²	44	48.3 Å²	48.3	24%	0.235	24%	0.236	C	C	.	.			trans	-69.4	127.8	162.2	-62.6	-50.1	0	0	0	108.4	I35 D36 F38 V66 R67 G68	I35-N40 WeakPolarHBondContact CA-O 3.4Å; D36-N40 PolarHBondContact N-O 3.32Å; D36-N40 WeakPolarHBondContact OD1-CB 3.16Å; D36-N40 PolarHBondContact OD1-N 3.39Å; D36-N40 PolarHBondContact OD1-ND2 3.5Å; D36-N40 WeakPolarHBondContact OD2-CB 3.39Å; D36-N40 PolarHBondContact OD2-ND2 2.92Å; F38-N40 PolarHBondContact O-N 2.88Å; N40-V66 CarbonylContact C-O 3.56Å; N40-V66 WeakPolarHBondContact CA-O 3.29Å; N40-R67 VanDerWaalsContact OD1-CA 3.29Å; N40-R67 WeakPolarHBondContact OD1-CA 3.19Å; N40-R67 WeakPolarHBondContact OD1-CG 3.49Å; N40-G68 PolarHBondContact OD1-N 2.81Å
41	L	94.9	Very high	94.2	Very high	1 Å²	1	52.1 Å²	52.1	1%	0.005	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	135.5	-169.7	-48	176.3	0	0	0	110.4	V20 L32 I35 A39 F43 I65 V66 V71 L74	V20-L41 HydrophobicContact CG2-CD1 4.24Å; L32-L41 HydrophobicContact CD1-CB 3.98Å; L32-L41 HydrophobicContact CD1-CD2 4.12Å; I35-L41 HydrophobicContact CB-CD2 4.48Å; I35-L41 HydrophobicContact CG2-CD2 3.61Å; A39-L41 WeakPolarHBondContact O-CD2 3.34Å; A39-L41 WeakPolarHBondContact O-CG 3.48Å; A39-L41 PolarHBondContact O-N 3.25Å; L41-F43 HydrophobicContact CB-CD2 4.09Å; L41-F43 HydrophobicContact CB-CE2 3.54Å; L41-F43 HydrophobicContact CB-CZ 4.22Å; L41-F43 HydrophobicContact CD1-CE2 3.63Å; L41-F43 HydrophobicContact CD1-CZ 3.92Å; L41-F43 HydrophobicContact CG-CE2 4.23Å; L41-I65 WeakPolarHBondContact O-CA 3.3Å; L41-V66 HydrophobicContact CB-CB 4.3Å; L41-V66 PolarHBondContact N-O 3.05Å; L41-V66 PolarHBondContact O-N 3.03Å; L41-V71 HydrophobicContact CD1-CG2 3.88Å; L41-V71 HydrophobicContact CG-CG2 4.44Å; L41-L74 HydrophobicContact CD1-CD1 3.55Å; L41-L74 HydrophobicContact CD2-CD1 4.48Å
42	V	96.3	Very high	93.9	Very high	45 Å²	45	50.2 Å²	50.2	27%	0.273	25%	0.246	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	116.7	169.7	-176.4	0	0	0	0	108.8	R33 S34 I65	R33-V42 PolarHBondContact N-O 2.86Å; S34-V42 PolarHBondContact O-N 3.44Å; V42-I65 HydrophobicContact CG2-CG1 4.38Å
43	F	96.7	Very high	93.5	Very high	1 Å²	1	53.5 Å²	53.5	0%	0.004	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	142.7	175.6	-72.7	-76.4	0	0	0	112	H18 V20 F31 L32 L41 T46 I63 F64 V66 L74	H18-F43 HydrophobicContact CB-CE1 3.92Å; H18-F43 HydrophobicContact CB-CZ 4.36Å; V20-F43 HydrophobicContact CG2-CE1 4.28Å; V20-F43 HydrophobicContact CG2-CE2 3.55Å; V20-F43 HydrophobicContact CG2-CZ 3.3Å; F31-F43 WeakPolarHBondContact O-CA 3.28Å; L32-F43 HydrophobicContact CB-CD1 4.36Å; L32-F43 HydrophobicContact CB-CE1 3.82Å; L32-F43 HydrophobicContact CD1-CD1 4.47Å; L32-F43 HydrophobicContact CD1-CE1 3.9Å; L32-F43 HydrophobicContact CD1-CE2 4.37Å; L32-F43 HydrophobicContact CD1-CZ 3.84Å; L32-F43 HydrophobicContact CG-CE1 4.46Å; L41-F43 HydrophobicContact CB-CD2 4.09Å; L41-F43 HydrophobicContact CB-CE2 3.54Å; L41-F43 HydrophobicContact CB-CZ 4.22Å; L41-F43 HydrophobicContact CD1-CE2 3.63Å; L41-F43 HydrophobicContact CD1-CZ 3.92Å; L41-F43 HydrophobicContact CG-CE2 4.23Å; F43-T46 HydrophobicContact CB-CG2 4.34Å; F43-T46 WeakPolarHBondContact CB-OG1 3.42Å; F43-I63 WeakPolarHBondContact O-CA 2.98Å; F43-F64 PolarHBondContact N-O 2.9Å; F43-F64 PolarHBondContact O-N 2.96Å; F43-V66 HydrophobicContact CD2-CG2 4.11Å; F43-V66 HydrophobicContact CE2-CG2 4.33Å; F43-L74 HydrophobicContact CZ-CD1 4.16Å
44	H	96.3	Very high	93.2	Very high	64 Å²	64	56 Å²	56	30%	0.296	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	149.2	172	178.7	-96.8	0	0	0	110.4	F31 R33 T46	F31-H44 PolarHBondContact N-O 3.31Å; F31-H44 PolarHBondContact O-N 2.89Å; R33-H44 HydrophobicContact CG-CB 3.64Å; H44-T46 PolarHBondContact O-N 2.97Å
45	Q	95.9	Very high	93	Very high	118 Å²	118	55.2 Å²	55.2	55%	0.551	28%	0.283	S	S	*	.	E	Extended strand (participates in β ladder)	trans	51.2	41	-175.3	-78.7	167.3	-12	0	0	112	F31 G62	F31-Q45 HydrophobicContact CD2-CB 4.23Å; Q45-G62 PolarHBondContact N-O 2.92Å; Q45-G62 VanDerWaalsContact N-O 3.08Å
46	T	96.4	Very high	93	Very high	1 Å²	1	54.7 Å²	54.7	1%	0.006	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.9	133.7	-178.4	-45.2	0	0	0	0	110.2	L28 I29 F43 H44 R61 G62 F64	L28-T46 HydrophobicContact CB-CG2 4.05Å; L28-T46 HydrophobicContact CD1-CG2 4.49Å; L28-T46 HydrophobicContact CD2-CG2 4.18Å; L28-T46 HydrophobicContact CG-CG2 4.48Å; I29-T46 CarbonylContact O-C 3.58Å; I29-T46 VanDerWaalsContact O-CA 3.29Å; I29-T46 WeakPolarHBondContact O-CA 3.32Å; F43-T46 HydrophobicContact CB-CG2 4.34Å; F43-T46 WeakPolarHBondContact CB-OG1 3.42Å; H44-T46 PolarHBondContact O-N 2.97Å; T46-R61 WeakPolarHBondContact O-CA 3.47Å; T46-R61 PolarHBondContact O-N 3.32Å; T46-G62 WeakPolarHBondContact CB-O 3.41Å; T46-G62 PolarHBondContact N-O 2.88Å; T46-G62 PolarHBondContact O-N 3.22Å; T46-G62 VanDerWaalsContact O-N 3.12Å; T46-G62 PolarHBondContact OG1-O 2.99Å; T46-F64 HydrophobicContact CG2-CB 3.98Å
47	V	96.2	Very high	93	Very high	41 Å²	41	52.3 Å²	52.3	25%	0.248	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	132.4	170	175.2	0	0	0	0	107.3	I29 D58 I59	I29-V47 PolarHBondContact N-O 2.94Å; I29-V47 PolarHBondContact O-N 2.83Å; V47-D58 HydrophobicContact CG1-CB 3.43Å; V47-D58 VanDerWaalsContact CG1-CB 3.43Å; V47-I59 CarbonylContact C-O 3.57Å; V47-I59 WeakPolarHBondContact CA-O 3.42Å
48	E	95.6	Very high	93.3	Very high	12 Å²	12	47.4 Å²	47.4	6%	0.056	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	119.9	168.5	179.3	176.9	172.7	0	0	109	R26 T27 L28 I59 R61	R26-E48 IonicContact CZ-OE1 3.11Å; R26-E48 IonicContact CZ-OE2 3.51Å; R26-E48 VanDerWaalsContact NE-CD 3.34Å; R26-E48 IonicContact NE-OE1 3.65Å; R26-E48 PolarHBondContact NE-OE1 3.23Å; R26-E48 IonicContact NE-OE2 2.73Å; R26-E48 IonicContact NH2-OE1 3.51Å; R26-E48 IonicContact NH2-OE2 3.41Å; R26-E48 PolarHBondContact NH2-OE2 3.27Å; T27-E48 CarbonylContact O-C 3.5Å; T27-E48 WeakPolarHBondContact O-CA 3.24Å; L28-E48 HydrophobicContact CD2-CB 3.75Å; L28-E48 HydrophobicContact CD2-CG 4.03Å; E48-I59 HydrophobicContact CB-CB 4.34Å; E48-I59 PolarHBondContact N-O 2.71Å; E48-I59 PolarHBondContact O-N 3.09Å; E48-R61 HydrophobicContact CB-CG 4.03Å; E48-R61 IonicContact OE2-CZ 2.69Å; E48-R61 IonicContact OE2-NE 3.96Å; E48-R61 PolarHBondContact OE2-NE 2.66Å; E48-R61 IonicContact OE2-NH2 3.18Å; E48-R61 PolarHBondContact OE2-NH2 3.26Å
49	R	94.1	Very high	93.5	Very high	66 Å²	66	41.9 Å²	41.9	25%	0.249	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	120.2	180	-176.5	166.8	-71.3	-178.1	-7.1	110.3	T27 I29 H51 F56 G57 D58	T27-R49 WeakPolarHBondContact CB-O 3.1Å; T27-R49 PolarHBondContact O-N 3.39Å; I29-R49 HydrophobicContact CD1-CB 4.03Å; R49-H51 WeakPolarHBondContact CD-NE2 3.23Å; R49-H51 WeakPolarHBondContact CG-NE2 3.41Å; R49-F56 HydrophobicContact CG-CB 4.26Å; R49-F56 HydrophobicContact CG-CD2 4.14Å; R49-G57 WeakPolarHBondContact CA-O 3.39Å; R49-D58 WeakPolarHBondContact CB-OD1 3.41Å; R49-D58 WeakPolarHBondContact CG-OD1 3.47Å; R49-D58 IonicContact CZ-OD1 3.54Å; R49-D58 IonicContact CZ-OD2 3.67Å; R49-D58 IonicContact NE-OD1 3.98Å; R49-D58 PolarHBondContact NE-OD1 2.69Å; R49-D58 IonicContact NE-OD2 2.61Å; R49-D58 IonicContact NH2-OD1 2.73Å; R49-D58 PolarHBondContact NH2-OD1 3.23Å; R49-D58 IonicContact NH2-OD2 2.64Å; R49-D58 PolarHBondContact NH2-OD2 3.18Å
50	I	93.1	Very high	93.7	Very high	10 Å²	10	45.5 Å²	45.5	5%	0.051	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	129.1	174.8	-58.1	169.8	0	0	0	107.9	V52 F56 G57 I59 I95 L96 Q99	I50-V52 HydrophobicContact CG2-CG2 4.15Å; I50-F56 CarbonylContact O-C 3.51Å; I50-F56 WeakPolarHBondContact O-CA 3.3Å; I50-G57 PolarHBondContact N-O 2.71Å; I50-G57 PolarHBondContact O-N 3.29Å; I50-I59 HydrophobicContact CD1-CD1 3.62Å; I50-I95 HydrophobicContact CB-CG1 3.91Å; I50-I95 HydrophobicContact CB-CG2 4.37Å; I50-I95 HydrophobicContact CD1-CG2 4.26Å; I50-I95 HydrophobicContact CG2-CG1 3.73Å; I50-L96 HydrophobicContact CD1-CD2 3.71Å; I50-Q99 HydrophobicContact CG2-CB 4.26Å; I50-Q99 HydrophobicContact CG2-CG 4.24Å
51	H	91.3	Very high	93.8	Very high	81 Å²	81	48.8 Å²	48.8	38%	0.375	25%	0.252	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	124.4	177.5	-58.9	100.8	0	0	0	109.6	R49	R49-H51 WeakPolarHBondContact CD-NE2 3.23Å; R49-H51 WeakPolarHBondContact CG-NE2 3.41Å
52	V	90.4	Very high	93.8	Very high	16 Å²	16	50.3 Å²	50.3	10%	0.097	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	109.2	173.7	-174.4	0	0	0	0	108.9	I50 K54 K55 I95 E98 Q99	I50-V52 HydrophobicContact CG2-CG2 4.15Å; V52-K54 PolarHBondContact O-N 2.92Å; V52-K55 PolarHBondContact N-O 3.27Å; V52-K55 PolarHBondContact O-N 2.98Å; V52-I95 HydrophobicContact CB-CD1 3.82Å; V52-I95 HydrophobicContact CG2-CD1 3.71Å; V52-I95 HydrophobicContact CG2-CG1 4.14Å; V52-E98 HydrophobicContact CB-CB 4.34Å; V52-E98 HydrophobicContact CG1-CB 3.95Å; V52-E98 HydrophobicContact CG2-CB 4.4Å; V52-Q99 HydrophobicContact CG2-CB 4Å
53	G	87.3	Confident	93.7	Very high	69 Å²	69	54 Å²	54	71%	0.711	29%	0.286	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.8	-110.3	-177.8	0	0	0	0	0	112.5
54	K	88.9	Confident	93.7	Very high	159 Å²	159	56.3 Å²	56.3	69%	0.691	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.2	9.3	177.5	-63.2	-174	179.9	-178.2	0	113.3	V52 L87 Q88	V52-K54 PolarHBondContact O-N 2.92Å; K54-L87 CarbonylContact O-C 3.58Å; K54-L87 VanDerWaalsContact O-CA 3.3Å; K54-L87 WeakPolarHBondContact O-CA 3.18Å; K54-Q88 PolarHBondContact O-N 2.79Å
55	K	91.9	Very high	93.6	Very high	46 Å²	46	59.2 Å²	59.2	20%	0.2	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	152.3	-178.8	-67.9	171.6	171.2	-170.2	0	110.7	V52 Q88 V90 E94 I95 E98	V52-K55 PolarHBondContact N-O 3.27Å; V52-K55 PolarHBondContact O-N 2.98Å; K55-Q88 CarbonylContact C-O 3.52Å; K55-Q88 VanDerWaalsContact CA-O 3.23Å; K55-Q88 WeakPolarHBondContact CA-O 3.34Å; K55-Q88 HydrophobicContact CG-CB 4.41Å; K55-V90 HydrophobicContact CB-CG1 4.16Å; K55-V90 HydrophobicContact CB-CG2 4.12Å; K55-V90 HydrophobicContact CD-CG1 3.8Å; K55-V90 HydrophobicContact CG-CG1 3.9Å; K55-E94 IonicContact NZ-OE1 2.77Å; K55-E94 PolarHBondContact NZ-OE1 3.24Å; K55-I95 HydrophobicContact CB-CD1 4.14Å; K55-E98 WeakPolarHBondContact CD-OE1 3.33Å; K55-E98 VanDerWaalsContact CD-OE2 3.32Å; K55-E98 WeakPolarHBondContact CD-OE2 3.47Å; K55-E98 IonicContact NZ-OE1 2.71Å; K55-E98 PolarHBondContact NZ-OE1 3.44Å
56	F	92.8	Very high	93.6	Very high	21 Å²	21	53.9 Å²	53.9	9%	0.092	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.6	150.8	170.3	77.8	-83	0	0	0	111.9	R49 I50 L87 Q88 Q89 V90	R49-F56 HydrophobicContact CG-CB 4.26Å; R49-F56 HydrophobicContact CG-CD2 4.14Å; I50-F56 CarbonylContact O-C 3.51Å; I50-F56 WeakPolarHBondContact O-CA 3.3Å; F56-L87 HydrophobicContact CD1-CB 3.71Å; F56-L87 HydrophobicContact CE1-CB 4.21Å; F56-Q88 PolarHBondContact N-O 2.86Å; F56-Q89 HydrophobicContact CD1-CB 4.43Å; F56-Q89 HydrophobicContact CE1-CB 3.72Å; F56-Q89 HydrophobicContact CE1-CG 4.37Å; F56-Q89 HydrophobicContact CE2-CB 4.11Å; F56-Q89 HydrophobicContact CE2-CG 3.85Å; F56-Q89 HydrophobicContact CZ-CB 3.54Å; F56-Q89 HydrophobicContact CZ-CG 3.79Å; F56-Q89 WeakPolarHBondContact O-CA 3.11Å; F56-V90 WeakPolarHBondContact O-CG2 3.12Å; F56-V90 PolarHBondContact O-N 2.84Å
57	G	93.4	Very high	93.5	Very high	0 Å²	0	61.3 Å²	61.3	0%	0	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	146.1	173.5	0	0	0	0	0	111.4	R49 I50	R49-G57 WeakPolarHBondContact CA-O 3.39Å; I50-G57 PolarHBondContact N-O 2.71Å; I50-G57 PolarHBondContact O-N 3.29Å
58	D	94.3	Very high	93.3	Very high	38 Å²	38	60 Å²	60	20%	0.203	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	121.8	-170.5	-82.1	-12.4	0	0	0	110.5	V47 R49	V47-D58 HydrophobicContact CG1-CB 3.43Å; V47-D58 VanDerWaalsContact CG1-CB 3.43Å; R49-D58 WeakPolarHBondContact CB-OD1 3.41Å; R49-D58 WeakPolarHBondContact CG-OD1 3.47Å; R49-D58 IonicContact CZ-OD1 3.54Å; R49-D58 IonicContact CZ-OD2 3.67Å; R49-D58 IonicContact NE-OD1 3.98Å; R49-D58 PolarHBondContact NE-OD1 2.69Å; R49-D58 IonicContact NE-OD2 2.61Å; R49-D58 IonicContact NH2-OD1 2.73Å; R49-D58 PolarHBondContact NH2-OD1 3.23Å; R49-D58 IonicContact NH2-OD2 2.64Å; R49-D58 PolarHBondContact NH2-OD2 3.18Å
59	I	94	Very high	93.2	Very high	23 Å²	23	63.8 Å²	63.8	12%	0.118	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	117	178.3	-57.5	175	0	0	0	109	V47 E48 I50 R61 I92 L96	V47-I59 CarbonylContact C-O 3.57Å; V47-I59 WeakPolarHBondContact CA-O 3.42Å; E48-I59 HydrophobicContact CB-CB 4.34Å; E48-I59 PolarHBondContact N-O 2.71Å; E48-I59 PolarHBondContact O-N 3.09Å; I50-I59 HydrophobicContact CD1-CD1 3.62Å; I59-R61 PolarHBondContact O-N 2.86Å; I59-I92 HydrophobicContact CD1-CG2 4.26Å; I59-I92 HydrophobicContact CG1-CD1 4.47Å; I59-I92 HydrophobicContact CG1-CG1 4.34Å; I59-I92 HydrophobicContact CG1-CG2 4Å; I59-L96 HydrophobicContact CD1-CD2 4.36Å
60	P	95.2	Very high	93.1	Very high	99 Å²	99	63.2 Å²	63.2	64%	0.643	33%	0.329	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.9	127.7	178.1	28.3	-33.2	0	0	0	110.8
61	R	94.5	Very high	93.1	Very high	113 Å²	113	64.4 Å²	64.4	43%	0.426	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	-23.5	177.3	-62.5	-58.8	-169.4	-177.4	-1.4	113.3	T46 E48 I59 F64	T46-R61 WeakPolarHBondContact O-CA 3.47Å; T46-R61 PolarHBondContact O-N 3.32Å; E48-R61 HydrophobicContact CB-CG 4.03Å; E48-R61 IonicContact OE2-CZ 2.69Å; E48-R61 IonicContact OE2-NE 3.96Å; E48-R61 PolarHBondContact OE2-NE 2.66Å; E48-R61 IonicContact OE2-NH2 3.18Å; E48-R61 PolarHBondContact OE2-NH2 3.26Å; I59-R61 PolarHBondContact O-N 2.86Å; R61-F64 HydrophobicContact CB-CD2 4.1Å; R61-F64 HydrophobicContact CG-CD2 4.5Å
62	G	94.9	Very high	93.2	Very high	34 Å²	34	64.7 Å²	64.7	35%	0.351	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	82.3	-117.1	177.6	0	0	0	0	0	112.2	Q45 T46	Q45-G62 PolarHBondContact N-O 2.92Å; Q45-G62 VanDerWaalsContact N-O 3.08Å; T46-G62 WeakPolarHBondContact CB-O 3.41Å; T46-G62 PolarHBondContact N-O 2.88Å; T46-G62 PolarHBondContact O-N 3.22Å; T46-G62 VanDerWaalsContact O-N 3.12Å; T46-G62 PolarHBondContact OG1-O 2.99Å
63	I	95.6	Very high	93.3	Very high	122 Å²	122	68.1 Å²	68.1	63%	0.626	36%	0.361	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91	128.9	173.8	-61.3	173.4	0	0	0	108.2	F43	F43-I63 WeakPolarHBondContact O-CA 2.98Å
64	F	95.1	Very high	93.6	Very high	49 Å²	49	66.9 Å²	66.9	22%	0.215	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	130.2	-176.9	-155.9	-88.1	0	0	0	110.6	L28 F43 T46 R61 V66	L28-F64 HydrophobicContact CD1-CD1 3.57Å; L28-F64 HydrophobicContact CD1-CE1 3.59Å; L28-F64 HydrophobicContact CD1-CG 4.29Å; L28-F64 HydrophobicContact CD1-CZ 4.33Å; F43-F64 PolarHBondContact N-O 2.9Å; F43-F64 PolarHBondContact O-N 2.96Å; T46-F64 HydrophobicContact CG2-CB 3.98Å; R61-F64 HydrophobicContact CB-CD2 4.1Å; R61-F64 HydrophobicContact CG-CD2 4.5Å; F64-V66 HydrophobicContact CD1-CG2 3.64Å; F64-V66 HydrophobicContact CE1-CG2 3.94Å
65	I	95.3	Very high	93.7	Very high	126 Å²	126	60.7 Å²	60.7	65%	0.646	32%	0.32	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.3	120.3	177	-56.6	176.4	0	0	0	107.5	L41 V42	L41-I65 WeakPolarHBondContact O-CA 3.3Å; V42-I65 HydrophobicContact CG2-CG1 4.38Å
66	V	94.8	Very high	93.8	Very high	5 Å²	5	63.5 Å²	63.5	3%	0.03	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	132.1	178.5	-175.8	0	0	0	0	108.8	L22 L28 N40 L41 F43 F64 V71	L22-V66 HydrophobicContact CD2-CG1 3.51Å; L28-V66 HydrophobicContact CD1-CG2 3.81Å; N40-V66 CarbonylContact C-O 3.56Å; N40-V66 WeakPolarHBondContact CA-O 3.29Å; L41-V66 HydrophobicContact CB-CB 4.3Å; L41-V66 PolarHBondContact N-O 3.05Å; L41-V66 PolarHBondContact O-N 3.03Å; F43-V66 HydrophobicContact CD2-CG2 4.11Å; F43-V66 HydrophobicContact CE2-CG2 4.33Å; F64-V66 HydrophobicContact CD1-CG2 3.64Å; F64-V66 HydrophobicContact CE1-CG2 3.94Å; V66-V71 HydrophobicContact CG1-CG2 3.63Å
67	R	95	Very high	93.6	Very high	158 Å²	158	64.8 Å²	64.8	60%	0.596	34%	0.341	S	S	*	.			trans	-81.5	135.2	173.3	-143	-178.6	146.8	115.2	-9.5	110.7	N40 E69 N70	N40-R67 VanDerWaalsContact OD1-CA 3.29Å; N40-R67 WeakPolarHBondContact OD1-CA 3.19Å; N40-R67 WeakPolarHBondContact OD1-CG 3.49Å; R67-E69 VanDerWaalsContact C-N 3.32Å; R67-E69 WeakPolarHBondContact CD-OE1 3.32Å; R67-E69 WeakPolarHBondContact CD-OE2 3.46Å; R67-E69 WeakPolarHBondContact CG-OE2 3.17Å; R67-E69 IonicContact CZ-OE1 3.74Å; R67-E69 IonicContact NE-OE1 2.72Å; R67-E69 PolarHBondContact NE-OE1 2.82Å; R67-E69 IonicContact NE-OE2 3.99Å; R67-E69 PolarHBondContact NE-OE2 2.73Å; R67-E69 VanDerWaalsContact NE-OE2 3.11Å; R67-E69 IonicContact NH2-OE1 3.96Å; R67-E69 PolarHBondContact O-N 2.83Å; R67-N70 WeakPolarHBondContact O-CB 3.47Å; R67-N70 PolarHBondContact O-N 3.38Å
68	G	92.2	Very high	93.4	Very high	12 Å²	12	67.8 Å²	67.8	12%	0.124	36%	0.357	C	S	.	.	G	3₁₀ helix	trans	-60.6	-33.6	-167.8	0	0	0	0	0	115	F38 A39 N40 N70 V71	F38-G68 WeakPolarHBondContact O-CA 3.39Å; A39-G68 WeakPolarHBondContact O-CA 3.43Å; N40-G68 PolarHBondContact OD1-N 2.81Å; G68-N70 PolarHBondContact O-N 2.77Å; G68-V71 WeakPolarHBondContact O-CB 3.06Å; G68-V71 PolarHBondContact O-N 2.95Å; G68-V71 VanDerWaalsContact O-N 3.15Å
69	E	93.1	Very high	92.7	Very high	93 Å²	93	71.9 Å²	71.9	44%	0.435	38%	0.376	S	S	.	.	G	3₁₀ helix	trans	-69.7	-17.4	177.9	73	-91	-141.5	0	0	114.2	R23 R67	R23-E69 PolarHBondContact NE-O 2.87Å; R23-E69 PolarHBondContact NH2-O 2.82Å; R67-E69 VanDerWaalsContact C-N 3.32Å; R67-E69 WeakPolarHBondContact CD-OE1 3.32Å; R67-E69 WeakPolarHBondContact CD-OE2 3.46Å; R67-E69 WeakPolarHBondContact CG-OE2 3.17Å; R67-E69 IonicContact CZ-OE1 3.74Å; R67-E69 IonicContact NE-OE1 2.72Å; R67-E69 PolarHBondContact NE-OE1 2.82Å; R67-E69 IonicContact NE-OE2 3.99Å; R67-E69 PolarHBondContact NE-OE2 2.73Å; R67-E69 VanDerWaalsContact NE-OE2 3.11Å; R67-E69 IonicContact NH2-OE1 3.96Å; R67-E69 PolarHBondContact O-N 2.83Å
70	N	92.6	Very high	92.1	Very high	54 Å²	54	78.1 Å²	78.1	29%	0.289	41%	0.41	S	S	.	.	G	3₁₀ helix	trans	-88.1	-11	177.1	-67.9	-38.1	0	0	0	112	L22 R23 R67 G68	L22-N70 CarbonylContact C-O 3.57Å; L22-N70 VanDerWaalsContact CA-O 3.25Å; L22-N70 WeakPolarHBondContact CA-O 3.29Å; R23-N70 PolarHBondContact N-O 3.01Å; R67-N70 WeakPolarHBondContact O-CB 3.47Å; R67-N70 PolarHBondContact O-N 3.38Å; G68-N70 PolarHBondContact O-N 2.77Å
71	V	92.9	Very high	91.3	Very high	34 Å²	34	80.1 Å²	80.1	21%	0.206	41%	0.408	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.8	123	176.5	-179.5	0	0	0	0	109.1	V20 L41 V66 G68	V20-V71 HydrophobicContact CG1-CG1 4.07Å; V20-V71 HydrophobicContact CG1-CG2 4.28Å; L41-V71 HydrophobicContact CD1-CG2 3.88Å; L41-V71 HydrophobicContact CG-CG2 4.44Å; V66-V71 HydrophobicContact CG1-CG2 3.63Å; G68-V71 WeakPolarHBondContact O-CB 3.06Å; G68-V71 PolarHBondContact O-N 2.95Å; G68-V71 VanDerWaalsContact O-N 3.15Å
72	V	93.3	Very high	89.8	Confident	87 Å²	87	79.8 Å²	79.8	53%	0.527	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.6	-49.8	173.2	176.9	0	0	0	0	110	L21 R23	L21-V72 HydrophobicContact CB-CB 4.46Å; L21-V72 HydrophobicContact CD2-CB 4.48Å; L21-V72 HydrophobicContact CD2-CG1 4.31Å; L21-V72 HydrophobicContact CG-CB 4.47Å; L21-V72 WeakPolarHBondContact O-CB 3.31Å; L21-V72 PolarHBondContact O-N 3.43Å; R23-V72 HydrophobicContact CB-CG2 4.21Å
73	L	92.9	Very high	88.4	Confident	88 Å²	88	83 Å²	83	46%	0.461	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.4	155.2	175.2	69.2	88.2	0	0	0	110.4	L19 V20 L21	L19-L73 HydrophobicContact CD2-CD1 4.26Å; V20-L73 WeakPolarHBondContact CA-O 3.29Å; L21-L73 HydrophobicContact CB-CD1 4.18Å; L21-L73 HydrophobicContact CB-CD2 4.17Å; L21-L73 HydrophobicContact CB-CG 3.73Å; L21-L73 HydrophobicContact CD2-CD2 3.85Å; L21-L73 HydrophobicContact CD2-CG 4.33Å; L21-L73 PolarHBondContact N-O 3.32Å
74	L	92.3	Very high	86.7	Confident	44 Å²	44	84.5 Å²	84.5	23%	0.23	45%	0.446	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133	136	173.5	173.8	145.9	0	0	0	108.2	L10 H18 L19 V20 L41 F43	L10-L74 HydrophobicContact CD2-CD2 3.68Å; H18-L74 HydrophobicContact CB-CG 4.46Å; H18-L74 WeakPolarHBondContact CD2-CD2 3.43Å; L19-L74 WeakPolarHBondContact O-CA 3.48Å; V20-L74 HydrophobicContact CG2-CB 4.37Å; V20-L74 HydrophobicContact CG2-CD1 3.87Å; V20-L74 HydrophobicContact CG2-CG 4.18Å; L41-L74 HydrophobicContact CD1-CD1 3.55Å; L41-L74 HydrophobicContact CD2-CD1 4.48Å; F43-L74 HydrophobicContact CZ-CD1 4.16Å
75	G	92.3	Very high	85.1	Confident	29 Å²	29	85.8 Å²	85.8	30%	0.299	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.1	133	178.7	0	0	0	0	0	111.9	H18 L19	H18-G75 CarbonylContact C-O 3.53Å; H18-G75 WeakPolarHBondContact CA-O 3.41Å; H18-G75 VanDerWaalsContact CD2-C 3.47Å; L19-G75 PolarHBondContact N-O 3.39Å; L19-G75 PolarHBondContact O-N 3.02Å
76	E	92.4	Very high	84.3	Confident	104 Å²	104	85.7 Å²	85.7	49%	0.486	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.9	132.8	174	-169.5	-173.1	146.8	0	0	110.1	K16 H18	K16-E76 HydrophobicContact CB-CG 4.32Å; K16-E76 HydrophobicContact CD-CG 3.93Å; K16-E76 WeakPolarHBondContact CD-OE1 3.39Å; K16-E76 VanDerWaalsContact CD-OE2 3.31Å; K16-E76 WeakPolarHBondContact CD-OE2 3.31Å; K16-E76 IonicContact NZ-OE1 2.97Å; K16-E76 IonicContact NZ-OE2 3.96Å; K16-E76 PolarHBondContact NZ-OE2 3.13Å; H18-E76 VanDerWaalsContact CD2-CA 3.45Å; H18-E76 WeakPolarHBondContact CD2-CA 3.41Å; H18-E76 PolarHBondContact CD2-N 2.85Å
77	I	90.6	Very high	83.8	Confident	49 Å²	49	88.4 Å²	88.4	25%	0.251	48%	0.477	S	S	.	.			trans	-95.3	112.1	171.5	-64.7	163.8	0	0	0	108	K17 L19 I29 M79	K17-I77 HydrophobicContact CB-CB 4.44Å; K17-I77 HydrophobicContact CD-CD1 4.49Å; K17-I77 HydrophobicContact CG-CB 4.39Å; K17-I77 HydrophobicContact CG-CD1 4.25Å; K17-I77 PolarHBondContact O-N 2.96Å; L19-I77 HydrophobicContact CB-CD1 3.9Å; L19-I77 HydrophobicContact CB-CG1 4.1Å; I29-I77 HydrophobicContact CB-CD1 4.5Å; I29-I77 HydrophobicContact CG1-CD1 4.27Å; I29-I77 HydrophobicContact CG2-CD1 3.59Å; I77-M79 HydrophobicContact CG2-SD 4.46Å; I77-M79 PolarHBondContact O-N 3.41Å
78	D	87.8	Confident	83.4	Confident	63 Å²	63	86.8 Å²	86.8	34%	0.337	48%	0.477	S	S	.	.			trans	-70.6	115.3	169.4	-171.8	-19.6	0	0	0	109.7	D80 K81	D78-D80 VanDerWaalsContact C-N 3.35Å; D78-D80 PolarHBondContact OD1-N 2.73Å; D78-K81 HydrophobicContact CB-CB 4.4Å; D78-K81 HydrophobicContact CB-CD 4.14Å; D78-K81 HydrophobicContact CB-CG 4.36Å; D78-K81 PolarHBondContact OD1-N 2.85Å; D78-K81 VanDerWaalsContact OD2-CD 3.29Å; D78-K81 WeakPolarHBondContact OD2-CD 3.44Å; D78-K81 WeakPolarHBondContact OD2-CE 3.44Å; D78-K81 WeakPolarHBondContact OD2-CG 3.25Å; D78-K81 IonicContact OD2-NZ 2.78Å; D78-K81 PolarHBondContact OD2-NZ 2.77Å
79	M	80.8	Confident	83.2	Confident	123 Å²	123	92.4 Å²	92.4	61%	0.606	50%	0.5	S	S	*	.	S	Bend	trans	-79.3	-19.5	-178.4	-68.8	-67.4	-61	0	0	113	K17 I77	K17-M79 HydrophobicContact CD-SD 3.44Å; K17-M79 WeakPolarHBondContact CD-SD 3.37Å; I77-M79 HydrophobicContact CG2-SD 4.46Å; I77-M79 PolarHBondContact O-N 3.41Å
80	D	80.3	Confident	83.2	Confident	154 Å²	154	88.8 Å²	88.8	82%	0.824	48%	0.484	S	S	*	.	S	Bend	trans	-88.4	-18.1	-175.6	-64	-33.8	0	0	0	111.8	D78	D78-D80 VanDerWaalsContact C-N 3.35Å; D78-D80 PolarHBondContact OD1-N 2.73Å
81	K	78.6	Confident	83.2	Confident	141 Å²	141	89.2 Å²	89.2	61%	0.613	49%	0.491	S	S	*	.	S	Bend	trans	-76.3	125.5	173.8	-79.6	177.1	-171.6	127.3	0	110.7	D78 C83	D78-K81 HydrophobicContact CB-CB 4.4Å; D78-K81 HydrophobicContact CB-CD 4.14Å; D78-K81 HydrophobicContact CB-CG 4.36Å; D78-K81 PolarHBondContact OD1-N 2.85Å; D78-K81 VanDerWaalsContact OD2-CD 3.29Å; D78-K81 WeakPolarHBondContact OD2-CD 3.44Å; D78-K81 WeakPolarHBondContact OD2-CE 3.44Å; D78-K81 WeakPolarHBondContact OD2-CG 3.25Å; D78-K81 IonicContact OD2-NZ 2.78Å; D78-K81 PolarHBondContact OD2-NZ 2.77Å; K81-C83 PolarHBondContact O-N 3.2Å; K81-C83 VanDerWaalsContact O-N 3.12Å
82	P	63.3	Low	83.1	Confident	107 Å²	107	91 Å²	91	70%	0.695	50%	0.499	S	S	*	.			trans	-60.5	122.1	171.6	25.3	-31.6	0	0	0	108.5	D84	P82-D84 VanDerWaalsContact C-N 3.33Å; P82-D84 PolarHBondContact O-N 2.8Å
83	C	64.4	Low	83	Confident	100 Å²	100	94.3 Å²	94.3	68%	0.676	51%	0.508	S	S	*	.			trans	-77	90.4	174.9	-147.5	0	0	0	0	107	K81 T85	K81-C83 PolarHBondContact O-N 3.2Å; K81-C83 VanDerWaalsContact O-N 3.12Å; C83-T85 HydrophobicContact CB-CG2 4.28Å; C83-T85 PolarHBondContact O-N 3.08Å; C83-T85 PolarHBondContact O-OG1 3.12Å; C83-T85 WeakPolarHBondContact SG-CG2 3.44Å
84	D	59.9	Low	83	Confident	155 Å²	155	93.6 Å²	93.6	83%	0.829	50%	0.502	S	S	*	.			trans	-64.7	67.5	169	-82.5	-19.2	0	0	0	109.1	P82 V86	P82-D84 VanDerWaalsContact C-N 3.33Å; P82-D84 PolarHBondContact O-N 2.8Å; D84-V86 PolarHBondContact O-N 2.78Å
85	T	62.4	Low	83	Confident	76 Å²	76	91.5 Å²	91.5	47%	0.466	49%	0.492	S	S	.	.			trans	-90.9	108.9	-171.7	24.9	0	0	0	0	108.6	C83 L87	C83-T85 HydrophobicContact CB-CG2 4.28Å; C83-T85 PolarHBondContact O-N 3.08Å; C83-T85 PolarHBondContact O-OG1 3.12Å; C83-T85 WeakPolarHBondContact SG-CG2 3.44Å; T85-L87 PolarHBondContact O-N 3.27Å; T85-L87 VanDerWaalsContact O-N 3.13Å
86	V	78.2	Confident	82.9	Confident	123 Å²	123	93.7 Å²	93.7	75%	0.745	50%	0.496	S	S	*	.			trans	-65.9	-3.2	166.9	-172.3	0	0	0	0	111.4	D84	D84-V86 PolarHBondContact O-N 2.78Å
87	L	84.3	Confident	82.9	Confident	63 Å²	63	95.2 Å²	95.2	33%	0.33	50%	0.503	S	S	.	.	P	Polyproline II helix	trans	-88.3	131.8	-173.8	-59.7	175.1	0	0	0	111.3	K54 F56 T85	K54-L87 CarbonylContact O-C 3.58Å; K54-L87 VanDerWaalsContact O-CA 3.3Å; K54-L87 WeakPolarHBondContact O-CA 3.18Å; F56-L87 HydrophobicContact CD1-CB 3.71Å; F56-L87 HydrophobicContact CE1-CB 4.21Å; T85-L87 PolarHBondContact O-N 3.27Å; T85-L87 VanDerWaalsContact O-N 3.13Å
88	Q	86.8	Confident	82.9	Confident	124 Å²	124	95.4 Å²	95.4	58%	0.579	50%	0.503	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.7	126.6	178.1	-177.8	179	-12.9	0	0	110.6	K54 K55 F56 V90	K54-Q88 PolarHBondContact O-N 2.79Å; K55-Q88 CarbonylContact C-O 3.52Å; K55-Q88 VanDerWaalsContact CA-O 3.23Å; K55-Q88 WeakPolarHBondContact CA-O 3.34Å; K55-Q88 HydrophobicContact CG-CB 4.41Å; F56-Q88 PolarHBondContact N-O 2.86Å; Q88-V90 HydrophobicContact CG-CG1 4.41Å
89	Q	88.7	Confident	83	Confident	130 Å²	130	95 Å²	95	61%	0.607	50%	0.499	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.7	130.8	171.9	-167.6	174.9	0.2	0	0	110.1	F56	F56-Q89 HydrophobicContact CD1-CB 4.43Å; F56-Q89 HydrophobicContact CE1-CB 3.72Å; F56-Q89 HydrophobicContact CE1-CG 4.37Å; F56-Q89 HydrophobicContact CE2-CB 4.11Å; F56-Q89 HydrophobicContact CE2-CG 3.85Å; F56-Q89 HydrophobicContact CZ-CB 3.54Å; F56-Q89 HydrophobicContact CZ-CG 3.79Å; F56-Q89 WeakPolarHBondContact O-CA 3.11Å
90	V	92.5	Very high	83.5	Confident	17 Å²	17	97 Å²	97	10%	0.103	50%	0.5	C	S	.	.			trans	-126.3	171.1	176.9	-64.3	0	0	0	0	111.4	K55 F56 Q88 I95	K55-V90 HydrophobicContact CB-CG1 4.16Å; K55-V90 HydrophobicContact CB-CG2 4.12Å; K55-V90 HydrophobicContact CD-CG1 3.8Å; K55-V90 HydrophobicContact CG-CG1 3.9Å; F56-V90 WeakPolarHBondContact O-CG2 3.12Å; F56-V90 PolarHBondContact O-N 2.84Å; Q88-V90 HydrophobicContact CG-CG1 4.41Å; V90-I95 HydrophobicContact CG2-CB 3.91Å; V90-I95 HydrophobicContact CG2-CD1 3.81Å; V90-I95 HydrophobicContact CG2-CG1 4.35Å
91	S	93.2	Very high	84	Confident	63 Å²	63	95 Å²	95	44%	0.441	49%	0.489	S	S	.	.			trans	-68.6	158	177.4	72.3	0	0	0	0	112.1	E93 E94 I95	S91-E93 VanDerWaalsContact C-N 3.28Å; S91-E93 PolarHBondContact O-N 2.88Å; S91-E94 PolarHBondContact O-N 2.89Å; S91-E94 WeakPolarHBondContact OG-CB 3.35Å; S91-E94 PolarHBondContact OG-N 2.94Å; S91-I95 PolarHBondContact O-N 2.85Å; S91-I95 VanDerWaalsContact O-N 3.09Å
92	I	90.9	Very high	84.5	Confident	72 Å²	72	93.2 Å²	93.2	37%	0.369	48%	0.483	S	S	.	.	H	α-helix	trans	-62.1	-38.6	178.3	-62.9	171.3	0	0	0	110.9	I59 I95 L96	I59-I92 HydrophobicContact CD1-CG2 4.26Å; I59-I92 HydrophobicContact CG1-CD1 4.47Å; I59-I92 HydrophobicContact CG1-CG1 4.34Å; I59-I92 HydrophobicContact CG1-CG2 4Å; I92-I95 WeakPolarHBondContact O-CG2 3.29Å; I92-L96 HydrophobicContact CG2-CD1 3.71Å; I92-L96 HydrophobicContact CG2-CG 4.31Å; I92-L96 WeakPolarHBondContact O-CB 3.34Å; I92-L96 WeakPolarHBondContact O-CD1 3.32Å; I92-L96 WeakPolarHBondContact O-CG 3.4Å; I92-L96 PolarHBondContact O-N 2.9Å
93	E	90.8	Very high	85.7	Confident	156 Å²	156	93 Å²	93	73%	0.729	47%	0.472	S	S	*	.	H	α-helix	trans	-65	-48.5	-179.8	-64.9	175.5	-179.5	0	0	110.8	S91 I95 L96 E97	S91-E93 VanDerWaalsContact C-N 3.28Å; S91-E93 PolarHBondContact O-N 2.88Å; E93-I95 PolarHBondContact O-N 3.3Å; E93-L96 PolarHBondContact O-N 2.83Å; E93-E97 WeakPolarHBondContact O-CG 3.33Å; E93-E97 PolarHBondContact O-N 3.15Å; E93-E97 VanDerWaalsContact O-N 3.12Å
94	E	91.9	Very high	87	Confident	72 Å²	72	92 Å²	92	34%	0.336	46%	0.458	S	S	.	.	H	α-helix	trans	-61.9	-45.2	179.7	-172.4	-178.3	167.6	0	0	112.2	K55 S91 L96 E97 E98	K55-E94 IonicContact NZ-OE1 2.77Å; K55-E94 PolarHBondContact NZ-OE1 3.24Å; S91-E94 PolarHBondContact O-N 2.89Å; S91-E94 WeakPolarHBondContact OG-CB 3.35Å; S91-E94 PolarHBondContact OG-N 2.94Å; E94-L96 VanDerWaalsContact C-N 3.32Å; E94-L96 PolarHBondContact O-N 3.11Å; E94-E97 PolarHBondContact O-N 3.03Å; E94-E98 WeakPolarHBondContact O-CG 3.36Å; E94-E98 PolarHBondContact O-N 3.24Å
95	I	92.4	Very high	88.5	Confident	0 Å²	0	87 Å²	87	0%	0	44%	0.438	C	S	.	.	H	α-helix	trans	-67.4	-34.1	-178.4	-158.4	68	0	0	0	112.3	I50 V52 K55 V90 S91 I92 E93 Q99	I50-I95 HydrophobicContact CB-CG1 3.91Å; I50-I95 HydrophobicContact CB-CG2 4.37Å; I50-I95 HydrophobicContact CD1-CG2 4.26Å; I50-I95 HydrophobicContact CG2-CG1 3.73Å; V52-I95 HydrophobicContact CB-CD1 3.82Å; V52-I95 HydrophobicContact CG2-CD1 3.71Å; V52-I95 HydrophobicContact CG2-CG1 4.14Å; K55-I95 HydrophobicContact CB-CD1 4.14Å; V90-I95 HydrophobicContact CG2-CB 3.91Å; V90-I95 HydrophobicContact CG2-CD1 3.81Å; V90-I95 HydrophobicContact CG2-CG1 4.35Å; S91-I95 PolarHBondContact O-N 2.85Å; S91-I95 VanDerWaalsContact O-N 3.09Å; I92-I95 WeakPolarHBondContact O-CG2 3.29Å; E93-I95 PolarHBondContact O-N 3.3Å; I95-Q99 VanDerWaalsContact O-CB 3.24Å; I95-Q99 WeakPolarHBondContact O-CB 3.38Å; I95-Q99 PolarHBondContact O-N 2.96Å
96	L	90.9	Very high	89.7	Confident	75 Å²	75	89.4 Å²	89.4	39%	0.393	44%	0.442	S	S	.	.	H	α-helix	trans	-70.3	-39.9	179	-73.9	172.7	0	0	0	111.3	I50 I59 I92 E93 E94 R100	I50-L96 HydrophobicContact CD1-CD2 3.71Å; I59-L96 HydrophobicContact CD1-CD2 4.36Å; I92-L96 HydrophobicContact CG2-CD1 3.71Å; I92-L96 HydrophobicContact CG2-CG 4.31Å; I92-L96 WeakPolarHBondContact O-CB 3.34Å; I92-L96 WeakPolarHBondContact O-CD1 3.32Å; I92-L96 WeakPolarHBondContact O-CG 3.4Å; I92-L96 PolarHBondContact O-N 2.9Å; E93-L96 PolarHBondContact O-N 2.83Å; E94-L96 VanDerWaalsContact C-N 3.32Å; E94-L96 PolarHBondContact O-N 3.11Å; L96-R100 WeakPolarHBondContact O-CB 3.45Å; L96-R100 PolarHBondContact O-N 3.42Å
97	E	91.7	Very high	90.2	Very high	136 Å²	136	88.4 Å²	88.4	64%	0.636	43%	0.429	S	S	*	.	H	α-helix	trans	-63.4	-47.4	173.7	-72.6	-175.4	172.4	0	0	111.5	E93 E94 Q99 R100 L101	E93-E97 WeakPolarHBondContact O-CG 3.33Å; E93-E97 PolarHBondContact O-N 3.15Å; E93-E97 VanDerWaalsContact O-N 3.12Å; E94-E97 PolarHBondContact O-N 3.03Å; E97-Q99 PolarHBondContact O-N 2.68Å; E97-R100 PolarHBondContact O-N 2.93Å; E97-L101 WeakPolarHBondContact O-CG 3.44Å; E97-L101 PolarHBondContact O-N 2.79Å
98	E	90.4	Very high	90.5	Very high	53 Å²	53	92 Å²	92	25%	0.248	44%	0.444	C	S	.	.	H	α-helix	trans	-62.2	-41.8	177.4	-72.5	-169	169.6	0	0	112.2	V52 K55 E94 R100 L101 Q102	V52-E98 HydrophobicContact CB-CB 4.34Å; V52-E98 HydrophobicContact CG1-CB 3.95Å; V52-E98 HydrophobicContact CG2-CB 4.4Å; K55-E98 WeakPolarHBondContact CD-OE1 3.33Å; K55-E98 VanDerWaalsContact CD-OE2 3.32Å; K55-E98 WeakPolarHBondContact CD-OE2 3.47Å; K55-E98 IonicContact NZ-OE1 2.71Å; K55-E98 PolarHBondContact NZ-OE1 3.44Å; E94-E98 WeakPolarHBondContact O-CG 3.36Å; E94-E98 PolarHBondContact O-N 3.24Å; E98-R100 VanDerWaalsContact C-N 3.33Å; E98-R100 PolarHBondContact O-N 2.9Å; E98-L101 PolarHBondContact O-N 2.91Å; E98-Q102 WeakPolarHBondContact O-CB 3.36Å; E98-Q102 PolarHBondContact O-N 2.61Å
99	Q	90.8	Very high	90.6	Very high	54 Å²	54	89.4 Å²	89.4	25%	0.252	44%	0.437	S	S	.	.	H	α-helix	trans	-61.1	-43.3	176.3	-174.2	-176.5	24.5	0	0	111.2	I50 V52 I95 E97 Q102 Q103	I50-Q99 HydrophobicContact CG2-CB 4.26Å; I50-Q99 HydrophobicContact CG2-CG 4.24Å; V52-Q99 HydrophobicContact CG2-CB 4Å; I95-Q99 VanDerWaalsContact O-CB 3.24Å; I95-Q99 WeakPolarHBondContact O-CB 3.38Å; I95-Q99 PolarHBondContact O-N 2.96Å; E97-Q99 PolarHBondContact O-N 2.68Å; Q99-Q102 PolarHBondContact O-N 2.83Å; Q99-Q103 WeakPolarHBondContact O-CB 3.43Å; Q99-Q103 WeakPolarHBondContact O-CG 3.44Å; Q99-Q103 PolarHBondContact O-N 3.39Å
100	R	90.5	Very high	90.6	Very high	165 Å²	165	87.6 Å²	87.6	62%	0.623	43%	0.428	S	S	*	.	H	α-helix	trans	-62	-45.7	178.3	-178	-179.8	175.5	175.7	1.2	111.5	L96 E97 E98 Q103 Q104	L96-R100 WeakPolarHBondContact O-CB 3.45Å; L96-R100 PolarHBondContact O-N 3.42Å; E97-R100 PolarHBondContact O-N 2.93Å; E98-R100 VanDerWaalsContact C-N 3.33Å; E98-R100 PolarHBondContact O-N 2.9Å; R100-Q103 PolarHBondContact O-N 2.83Å; R100-Q104 WeakPolarHBondContact O-CG 3.34Å; R100-Q104 PolarHBondContact O-N 3.04Å
101	L	91.3	Very high	90.4	Very high	114 Å²	114	93.3 Å²	93.3	60%	0.597	45%	0.452	S	S	*	.	H	α-helix	trans	-62.3	-43	177.1	-70.5	171.5	0	0	0	111.4	E97 E98 Q103 Q104 A105	E97-L101 WeakPolarHBondContact O-CG 3.44Å; E97-L101 PolarHBondContact O-N 2.79Å; E98-L101 PolarHBondContact O-N 2.91Å; L101-Q103 PolarHBondContact O-N 2.99Å; L101-Q104 PolarHBondContact O-N 3.48Å; L101-A105 WeakPolarHBondContact O-CB 3.14Å; L101-A105 PolarHBondContact O-N 2.81Å
102	Q	89.9	Confident	90.2	Very high	103 Å²	103	93.2 Å²	93.2	48%	0.481	46%	0.455	S	S	.	.	H	α-helix	trans	-63.2	-42.2	177.6	-169.7	-176.8	26.6	0	0	112.1	E98 Q99 K106	E98-Q102 WeakPolarHBondContact O-CB 3.36Å; E98-Q102 PolarHBondContact O-N 2.61Å; Q99-Q102 PolarHBondContact O-N 2.83Å; Q102-K106 VanDerWaalsContact O-CB 3.31Å; Q102-K106 WeakPolarHBondContact O-CB 3.33Å; Q102-K106 PolarHBondContact O-N 2.83Å
103	Q	87.6	Confident	90	Very high	101 Å²	101	96 Å²	96	47%	0.472	47%	0.465	S	S	.	.	H	α-helix	trans	-64.7	-43	177	-76.5	177.9	-6.6	0	0	111.9	Q99 R100 L101 K106 Q107	Q99-Q103 WeakPolarHBondContact O-CB 3.43Å; Q99-Q103 WeakPolarHBondContact O-CG 3.44Å; Q99-Q103 PolarHBondContact O-N 3.39Å; R100-Q103 PolarHBondContact O-N 2.83Å; L101-Q103 PolarHBondContact O-N 2.99Å; Q103-K106 PolarHBondContact O-N 2.92Å; Q103-Q107 WeakPolarHBondContact O-CB 3.4Å; Q103-Q107 VanDerWaalsContact O-CG 3.29Å; Q103-Q107 WeakPolarHBondContact O-CG 3.49Å; Q103-Q107 PolarHBondContact O-N 2.87Å
104	Q	91	Very high	89.9	Confident	81 Å²	81	92.2 Å²	92.2	38%	0.379	45%	0.452	S	S	.	.	H	α-helix	trans	-61	-49.2	176.5	-73.4	176.6	-14.1	0	0	111.4	R100 L101 K106 Q107 E108	R100-Q104 WeakPolarHBondContact O-CG 3.34Å; R100-Q104 PolarHBondContact O-N 3.04Å; L101-Q104 PolarHBondContact O-N 3.48Å; Q104-K106 VanDerWaalsContact C-N 3.32Å; Q104-K106 PolarHBondContact O-N 3.31Å; Q104-Q107 PolarHBondContact O-N 2.7Å; Q104-E108 WeakPolarHBondContact O-CG 3.44Å; Q104-E108 PolarHBondContact O-N 3.43Å
105	A	91.3	Very high	89.7	Confident	50 Å²	50	92.6 Å²	92.6	41%	0.413	46%	0.459	S	S	.	.	H	α-helix	trans	-60.1	-41.6	176.4	0	0	0	0	0	112.1	L101 E108 T109	L101-A105 WeakPolarHBondContact O-CB 3.14Å; L101-A105 PolarHBondContact O-N 2.81Å; A105-E108 PolarHBondContact O-N 3.4Å; A105-T109 VanDerWaalsContact O-CG2 3.32Å; A105-T109 WeakPolarHBondContact O-CG2 3.41Å; A105-T109 PolarHBondContact O-N 2.83Å; A105-T109 PolarHBondContact O-OG1 3.01Å
106	K	88.4	Confident	89.6	Confident	125 Å²	125	95 Å²	95	54%	0.543	48%	0.479	S	S	.	.	H	α-helix	trans	-62.9	-46	176.6	-169.3	-180	177.1	-167.9	0	111	Q102 Q103 Q104 E108 T109 E110	Q102-K106 VanDerWaalsContact O-CB 3.31Å; Q102-K106 WeakPolarHBondContact O-CB 3.33Å; Q102-K106 PolarHBondContact O-N 2.83Å; Q103-K106 PolarHBondContact O-N 2.92Å; Q104-K106 VanDerWaalsContact C-N 3.32Å; Q104-K106 PolarHBondContact O-N 3.31Å; K106-E108 PolarHBondContact O-N 3.08Å; K106-T109 PolarHBondContact O-N 3.07Å; K106-T109 PolarHBondContact O-OG1 3.36Å; K106-E110 WeakPolarHBondContact CE-OE1 3.45Å; K106-E110 HydrophobicContact CG-CG 4.42Å; K106-E110 IonicContact NZ-OE1 2.71Å; K106-E110 WeakPolarHBondContact O-CB 3.11Å; K106-E110 WeakPolarHBondContact O-CG 3.29Å; K106-E110 PolarHBondContact O-N 3.1Å
107	Q	88.2	Confident	89.5	Confident	102 Å²	102	93.7 Å²	93.7	48%	0.477	47%	0.472	S	S	.	.	H	α-helix	trans	-61.8	-41.2	178.1	-74.4	177.6	14.7	0	0	112.6	Q103 Q104 E110 K111	Q103-Q107 WeakPolarHBondContact O-CB 3.4Å; Q103-Q107 VanDerWaalsContact O-CG 3.29Å; Q103-Q107 WeakPolarHBondContact O-CG 3.49Å; Q103-Q107 PolarHBondContact O-N 2.87Å; Q104-Q107 PolarHBondContact O-N 2.7Å; Q107-E110 PolarHBondContact O-N 3.12Å; Q107-K111 WeakPolarHBondContact O-CB 3.33Å; Q107-K111 VanDerWaalsContact O-CG 3.23Å; Q107-K111 WeakPolarHBondContact O-CG 3.38Å; Q107-K111 PolarHBondContact O-N 2.64Å
108	E	90.9	Very high	89.4	Confident	139 Å²	139	95 Å²	95	65%	0.65	48%	0.475	S	S	*	.	H	α-helix	trans	-63.7	-45.5	176.8	-72.5	176.3	-177.4	0	0	111.6	Q104 A105 K106 K111 A112	Q104-E108 WeakPolarHBondContact O-CG 3.44Å; Q104-E108 PolarHBondContact O-N 3.43Å; A105-E108 PolarHBondContact O-N 3.4Å; K106-E108 PolarHBondContact O-N 3.08Å; E108-K111 PolarHBondContact O-N 3.41Å; E108-A112 PolarHBondContact O-N 3.21Å
109	T	89.8	Confident	89.4	Confident	70 Å²	70	98.7 Å²	98.7	43%	0.429	50%	0.497	S	S	.	.	H	α-helix	trans	-67.5	-36.6	178.1	62.6	0	0	0	0	112.5	A105 K106 A112 K113	A105-T109 VanDerWaalsContact O-CG2 3.32Å; A105-T109 WeakPolarHBondContact O-CG2 3.41Å; A105-T109 PolarHBondContact O-N 2.83Å; A105-T109 PolarHBondContact O-OG1 3.01Å; K106-T109 PolarHBondContact O-N 3.07Å; K106-T109 PolarHBondContact O-OG1 3.36Å; T109-A112 PolarHBondContact O-N 3.12Å; T109-K113 WeakPolarHBondContact O-CB 3.03Å; T109-K113 VanDerWaalsContact O-CG 3.26Å; T109-K113 WeakPolarHBondContact O-CG 3.37Å; T109-K113 PolarHBondContact O-N 2.8Å
110	E	87.8	Confident	89.5	Confident	91 Å²	91	105.7 Å²	105.7	43%	0.425	52%	0.521	S	S	.	.	H	α-helix	trans	-66.6	-44.7	175.2	-77.7	179.5	172.1	0	0	111.6	K106 Q107 A112 K113 V114	K106-E110 WeakPolarHBondContact CE-OE1 3.45Å; K106-E110 HydrophobicContact CG-CG 4.42Å; K106-E110 IonicContact NZ-OE1 2.71Å; K106-E110 WeakPolarHBondContact O-CB 3.11Å; K106-E110 WeakPolarHBondContact O-CG 3.29Å; K106-E110 PolarHBondContact O-N 3.1Å; Q107-E110 PolarHBondContact O-N 3.12Å; E110-A112 VanDerWaalsContact C-N 3.32Å; E110-A112 PolarHBondContact O-N 3.15Å; E110-K113 PolarHBondContact O-N 2.97Å; E110-V114 WeakPolarHBondContact O-CB 3.38Å; E110-V114 VanDerWaalsContact O-CG2 3.23Å; E110-V114 WeakPolarHBondContact O-CG2 3.39Å; E110-V114 PolarHBondContact O-N 2.72Å
111	K	87.8	Confident	89.5	Confident	137 Å²	137	101.2 Å²	101.2	60%	0.596	53%	0.526	S	S	*	.	H	α-helix	trans	-58.1	-45.5	174.4	-74.6	171.1	-174.7	175.5	0	111.3	Q107 E108 K113 V114 T115	Q107-K111 WeakPolarHBondContact O-CB 3.33Å; Q107-K111 VanDerWaalsContact O-CG 3.23Å; Q107-K111 WeakPolarHBondContact O-CG 3.38Å; Q107-K111 PolarHBondContact O-N 2.64Å; E108-K111 PolarHBondContact O-N 3.41Å; K111-K113 PolarHBondContact O-N 2.91Å; K111-V114 PolarHBondContact O-N 3.04Å; K111-T115 PolarHBondContact O-N 3.35Å; K111-T115 PolarHBondContact O-OG1 2.78Å
112	A	89.8	Confident	89.4	Confident	62 Å²	62	100.8 Å²	100.8	51%	0.512	52%	0.524	S	S	.	.	H	α-helix	trans	-62	-43.5	177.3	0	0	0	0	0	112.3	E108 T109 E110 A116	E108-A112 PolarHBondContact O-N 3.21Å; T109-A112 PolarHBondContact O-N 3.12Å; E110-A112 VanDerWaalsContact C-N 3.32Å; E110-A112 PolarHBondContact O-N 3.15Å; A112-A116 WeakPolarHBondContact O-CB 3.39Å; A112-A116 PolarHBondContact O-N 3.41Å
113	K	87.7	Confident	89	Confident	131 Å²	131	101.3 Å²	101.3	57%	0.57	54%	0.539	S	S	*	.	H	α-helix	trans	-64	-44.2	176.5	-75.3	172.9	-176.4	176.9	0	112.3	T109 E110 K111 A116 L117	T109-K113 WeakPolarHBondContact O-CB 3.03Å; T109-K113 VanDerWaalsContact O-CG 3.26Å; T109-K113 WeakPolarHBondContact O-CG 3.37Å; T109-K113 PolarHBondContact O-N 2.8Å; E110-K113 PolarHBondContact O-N 2.97Å; K111-K113 PolarHBondContact O-N 2.91Å; K113-A116 PolarHBondContact O-N 3.42Å; K113-L117 WeakPolarHBondContact O-CB 3.4Å; K113-L117 VanDerWaalsContact O-CG 3.28Å; K113-L117 WeakPolarHBondContact O-CG 3.31Å; K113-L117 PolarHBondContact O-N 3.35Å
114	V	87.8	Confident	88.5	Confident	76 Å²	76	101.3 Å²	101.3	46%	0.461	54%	0.541	S	S	.	.	H	α-helix	trans	-62.7	-45.1	179.5	169.2	0	0	0	0	110.4	E110 K111 L117 K118 I124	E110-V114 WeakPolarHBondContact O-CB 3.38Å; E110-V114 VanDerWaalsContact O-CG2 3.23Å; E110-V114 WeakPolarHBondContact O-CG2 3.39Å; E110-V114 PolarHBondContact O-N 2.72Å; K111-V114 PolarHBondContact O-N 3.04Å; V114-L117 PolarHBondContact O-N 3.12Å; V114-K118 VanDerWaalsContact O-CB 3.31Å; V114-K118 WeakPolarHBondContact O-CB 3.5Å; V114-K118 PolarHBondContact O-N 3.1Å; V114-I124 HydrophobicContact CG2-CD1 4.34Å
115	T	88.3	Confident	87.6	Confident	80 Å²	80	102.7 Å²	102.7	49%	0.491	56%	0.557	S	S	.	*	H	α-helix	trans	-59.7	-49.7	174.7	-56.7	0	0	0	0	111.2	K111 L117 K118 D119	K111-T115 PolarHBondContact O-N 3.35Å; K111-T115 PolarHBondContact O-OG1 2.78Å; T115-L117 VanDerWaalsContact C-N 3.29Å; T115-L117 PolarHBondContact O-N 3.23Å; T115-K118 PolarHBondContact O-N 2.77Å; T115-D119 PolarHBondContact O-N 3.09Å
116	A	90	Very high	86.3	Confident	49 Å²	49	109 Å²	109	41%	0.405	58%	0.576	S	S	.	*	H	α-helix	trans	-62.4	-32.4	-179.2	0	0	0	0	0	113.9	A112 K113 R120	A112-A116 WeakPolarHBondContact O-CB 3.39Å; A112-A116 PolarHBondContact O-N 3.41Å; K113-A116 PolarHBondContact O-N 3.42Å; A116-R120 WeakPolarHBondContact O-CG 3.49Å
117	L	89.1	Confident	84.9	Confident	48 Å²	48	106.6 Å²	106.6	25%	0.251	58%	0.579	S	S	.	*	H	α-helix	trans	-78.4	-37.4	176.5	-72.4	167.8	0	0	0	112.1	K113 V114 T115 D119 R120 G121 L122 I124	K113-L117 WeakPolarHBondContact O-CB 3.4Å; K113-L117 VanDerWaalsContact O-CG 3.28Å; K113-L117 WeakPolarHBondContact O-CG 3.31Å; K113-L117 PolarHBondContact O-N 3.35Å; V114-L117 PolarHBondContact O-N 3.12Å; T115-L117 VanDerWaalsContact C-N 3.29Å; T115-L117 PolarHBondContact O-N 3.23Å; L117-D119 VanDerWaalsContact C-N 3.31Å; L117-D119 PolarHBondContact O-N 2.98Å; L117-R120 CarbonylContact O-C 3.45Å; L117-R120 WeakPolarHBondContact O-CA 3.41Å; L117-R120 WeakPolarHBondContact O-CB 2.97Å; L117-R120 PolarHBondContact O-N 3.03Å; L117-G121 PolarHBondContact O-N 3.25Å; L117-L122 CarbonylContact C-O 3.34Å; L117-L122 HydrophobicContact CB-CB 4.3Å; L117-L122 HydrophobicContact CD2-CB 4.4Å; L117-L122 HydrophobicContact CD2-CD1 3.91Å; L117-L122 PolarHBondContact O-N 3.44Å; L117-I124 HydrophobicContact CD1-CD1 3.26Å; L117-I124 HydrophobicContact CD1-CG1 3.76Å
118	K	89	Confident	83.2	Confident	163 Å²	163	108.7 Å²	108.7	71%	0.709	59%	0.593	S	S	*	*	H	α-helix	trans	-61.2	-41.6	175.1	-172.4	-179.6	179.4	-176	0	111.3	V114 T115 R120 G121	V114-K118 VanDerWaalsContact O-CB 3.31Å; V114-K118 WeakPolarHBondContact O-CB 3.5Å; V114-K118 PolarHBondContact O-N 3.1Å; T115-K118 PolarHBondContact O-N 2.77Å; K118-R120 PolarHBondContact O-N 3.01Å; K118-G121 PolarHBondContact O-N 3.44Å
119	D	90.9	Very high	81.1	Confident	132 Å²	132	107.7 Å²	107.7	71%	0.706	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.1	-21.9	175	-66.4	-16.5	0	0	0	112.7	T115 L117	T115-D119 PolarHBondContact O-N 3.09Å; L117-D119 VanDerWaalsContact C-N 3.31Å; L117-D119 PolarHBondContact O-N 2.98Å
120	R	93	Very high	79.3	Confident	200 Å²	200	109.4 Å²	109.4	76%	0.755	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.8	7	175.6	-64.6	176.4	-179.2	-170.1	-0.1	113.4	A116 L117 K118 L122	A116-R120 WeakPolarHBondContact O-CG 3.49Å; L117-R120 CarbonylContact O-C 3.45Å; L117-R120 WeakPolarHBondContact O-CA 3.41Å; L117-R120 WeakPolarHBondContact O-CB 2.97Å; L117-R120 PolarHBondContact O-N 3.03Å; K118-R120 PolarHBondContact O-N 3.01Å; R120-L122 VanDerWaalsContact C-N 3.29Å; R120-L122 PolarHBondContact O-N 2.97Å
121	G	89.4	Confident	77.3	Confident	71 Å²	71	112.3 Å²	112.3	73%	0.732	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	74	14.8	-179.6	0	0	0	0	0	114.6	L117 K118	L117-G121 PolarHBondContact O-N 3.25Å; K118-G121 PolarHBondContact O-N 3.44Å
122	L	89.2	Confident	74.7	Confident	106 Å²	106	113.6 Å²	113.6	56%	0.555	63%	0.625	S	S	*	*	P	Polyproline II helix	trans	-100.2	129.6	177	-64.5	172.4	0	0	0	110.1	L117 R120	L117-L122 CarbonylContact C-O 3.34Å; L117-L122 HydrophobicContact CB-CB 4.3Å; L117-L122 HydrophobicContact CD2-CB 4.4Å; L117-L122 HydrophobicContact CD2-CD1 3.91Å; L117-L122 PolarHBondContact O-N 3.44Å; R120-L122 VanDerWaalsContact C-N 3.29Å; R120-L122 PolarHBondContact O-N 2.97Å
123	S	82.1	Confident	72.1	Confident	114 Å²	114	124.6 Å²	124.6	80%	0.797	66%	0.655	S	S	*	*	P	Polyproline II helix	trans	-102.6	129	170.8	52.3	0	0	0	0	110.3
124	I	76.7	Confident	71.4	Confident	100 Å²	100	124.3 Å²	124.3	51%	0.513	66%	0.66	S	S	.	*	P	Polyproline II helix	trans	-87.7	121.5	165.5	-58.3	170.8	0	0	0	106.5	V114 L117 K126	V114-I124 HydrophobicContact CG2-CD1 4.34Å; L117-I124 HydrophobicContact CD1-CD1 3.26Å; L117-I124 HydrophobicContact CD1-CG1 3.76Å; I124-K126 PolarHBondContact O-N 3.46Å
125	P	72.8	Confident	70.5	Confident	110 Å²	110	126.8 Å²	126.8	71%	0.714	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-60	124.7	169.7	24.6	-30.4	0	0	0	108.1	A127	P125-A127 PolarHBondContact O-N 3.38Å
126	K	64.4	Low	69.5	Low	184 Å²	184	129.4 Å²	129.4	80%	0.8	68%	0.68	S	S	*	*	P	Polyproline II helix	trans	-58.2	129.5	171.4	-72.7	-174.9	176.6	-177.7	0	107.1	I124	I124-K126 PolarHBondContact O-N 3.46Å
127	A	59.5	Low	68.3	Low	74 Å²	74	134.1 Å²	134.1	61%	0.612	70%	0.696	S	S	*	*	P	Polyproline II helix	trans	-57.8	140.5	159.6	0	0	0	0	0	106.7	P125 N129	P125-A127 PolarHBondContact O-N 3.38Å; A127-N129 PolarHBondContact O-N 3Å
128	D	51.9	Low	67	Low	146 Å²	146	139.5 Å²	139.5	78%	0.781	72%	0.724	S	S	*	*			trans	-59.6	81.5	174	-68	-35.1	0	0	0	109.1	L130	D128-L130 PolarHBondContact O-N 3.28Å
129	N	46.5	Very low	65.5	Low	118 Å²	118	137.9 Å²	137.9	63%	0.631	73%	0.725	S	S	*	*			trans	-76.6	111.1	169.4	-73.8	-9.3	0	0	0	105.3	A127 D131	A127-N129 PolarHBondContact O-N 3Å; N129-D131 PolarHBondContact O-N 3.18Å
130	L	51	Low	63.7	Low	106 Å²	106	138.4 Å²	138.4	56%	0.555	73%	0.726	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.9	14.8	175.8	-80.8	133.2	0	0	0	114.5	R23 D128 E132	R23-L130 HydrophobicContact CG-CD1 4.42Å; D128-L130 PolarHBondContact O-N 3.28Å; L130-E132 PolarHBondContact O-N 3.4Å
131	D	46.7	Very low	61.5	Low	152 Å²	152	133.6 Å²	133.6	81%	0.813	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.2	0.3	176.9	-64.1	-28.7	0	0	0	112.7	N129	N129-D131 PolarHBondContact O-N 3.18Å
132	E	33.5	Very low	59.1	Low	163 Å²	163	138.8 Å²	138.8	76%	0.762	72%	0.723	S	S	*	*			trans	-114.5	59.3	172.3	-74.2	-176.8	-178.9	0	0	111.4	L130	L130-E132 PolarHBondContact O-N 3.4Å
133	Y	35.3	Very low	56.4	Low	293 Å²	293	141.8 Å²	141.8	100%	1.149	74%	0.739	S	S	*	*			trans	-148.5	0	154.9	-89.3	-75.4	0	0	0	111.5

Retrieved 133 of 133 residues in 775.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).