A0A5K4ECC1_SCHMA Loading...

40S ribosomal protein S26 AlphaSync

AlphaFold DB , UniProt , Accession A0A5K4ECC1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 63 aa.

						>A0A5K4ECC1_SCHMA|A0A5K4ECC1
MTRKRRNHGRSKKGRGHVGFIRCTNCGRACPKDKSVWKLVTRSMVEAAAVKDLEDASVYGSWL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	77.8	Confident	88.2	Confident	246 Å²	246	139.3 Å²	139.3	100%	1.212	66%	0.661	S	S	*	*				0	127.4	0	-172.6	179.7	-105.4	0	0	108.3
2	T	90.5	Very high	87.9	Confident	136 Å²	136	134.9 Å²	134.9	83%	0.834	64%	0.638	S	S	*	*			trans	-87.9	147.9	-177	52.9	0	0	0	0	111.8	K4	T2-K4 PolarHBondContact O-N 3.31Å
3	R	89.6	Confident	87.8	Confident	160 Å²	160	137.9 Å²	137.9	60%	0.604	65%	0.647	S	S	*	*			trans	-77.1	105.2	176	-176.6	-178.6	-178	-166.6	11	109.7	R5 R6 H8	R3-R5 PolarHBondContact NE-O 2.78Å; R3-R5 PolarHBondContact O-N 2.95Å; R3-R6 PolarHBondContact NH2-O 3.25Å; R3-H8 PolarHBondContact NE-NE2 2.76Å
4	K	91.9	Very high	87.5	Confident	201 Å²	201	134.5 Å²	134.5	87%	0.874	67%	0.667	S	S	*	*			trans	-64.1	-37.8	-179.9	-169.7	174.8	-179.1	170.9	0	114.1	T2	T2-K4 PolarHBondContact O-N 3.31Å
5	R	90.9	Very high	87	Confident	176 Å²	176	135 Å²	135	66%	0.664	66%	0.658	S	S	*	*			trans	-145.5	144.2	-176.5	-57.6	-178.7	82.3	129.8	-0.1	112.1	R3 N7 H8	R3-R5 PolarHBondContact NE-O 2.78Å; R3-R5 PolarHBondContact O-N 2.95Å; R5-N7 VanDerWaalsContact C-N 3.34Å; R5-N7 PolarHBondContact O-N 3.21Å; R5-H8 PolarHBondContact O-N 3.48Å
6	R	89.9	Confident	87	Confident	207 Å²	207	129.8 Å²	129.8	78%	0.781	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.3	-45.3	177.3	-167	175.7	-175.2	160.7	1.4	112.5	R3	R3-R6 PolarHBondContact NH2-O 3.25Å
7	N	87.8	Confident	87	Confident	102 Å²	102	130.1 Å²	130.1	55%	0.545	65%	0.649	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.2	5.1	-176.3	-65.3	-14.8	0	0	0	114.7	R5 G9 R10	R5-N7 VanDerWaalsContact C-N 3.34Å; R5-N7 PolarHBondContact O-N 3.21Å; N7-G9 PolarHBondContact O-N 3.42Å; N7-R10 PolarHBondContact O-N 3.12Å
8	H	87.7	Confident	87.1	Confident	118 Å²	118	124.1 Å²	124.1	55%	0.546	62%	0.62	S	S	.	*	T	Hydrogen-bonded Turn	trans	54.1	16.9	-176.1	-55.8	-87.1	0	0	0	115.6	R3 R5 R10	R3-H8 PolarHBondContact NE-NE2 2.76Å; R5-H8 PolarHBondContact O-N 3.48Å; H8-R10 VanDerWaalsContact C-N 3.32Å
9	G	86.1	Confident	87.2	Confident	45 Å²	45	120.3 Å²	120.3	46%	0.464	62%	0.616	S	S	.	*	T	Hydrogen-bonded Turn	trans	70.6	24.5	-173.6	0	0	0	0	0	113.8	N7	N7-G9 PolarHBondContact O-N 3.42Å
10	R	90.5	Very high	87.5	Confident	74 Å²	74	120.6 Å²	120.6	28%	0.279	61%	0.612	S	S	.	*			trans	-126.2	137.6	-174.2	-72.4	-169.3	73.7	167.7	7.2	111.2	N7 H8 K12 D33 K34	N7-R10 PolarHBondContact O-N 3.12Å; H8-R10 VanDerWaalsContact C-N 3.32Å; R10-K12 HydrophobicContact CB-CB 4.28Å; R10-K12 PolarHBondContact O-N 3.4Å; R10-D33 WeakPolarHBondContact CB-OD2 3.46Å; R10-D33 VanDerWaalsContact CG-OD2 3.27Å; R10-D33 WeakPolarHBondContact CG-OD2 3.36Å; R10-D33 IonicContact CZ-OD1 3.68Å; R10-D33 IonicContact CZ-OD2 3.44Å; R10-D33 IonicContact NE-OD1 3.67Å; R10-D33 IonicContact NE-OD2 2.67Å; R10-D33 PolarHBondContact NE-OD2 3.23Å; R10-D33 IonicContact NH2-OD1 2.82Å; R10-D33 PolarHBondContact NH2-OD1 2.9Å; R10-D33 IonicContact NH2-OD2 3.35Å; R10-D33 PolarHBondContact NH2-OD2 3.33Å; R10-K34 HydrophobicContact CG-CB 4.27Å; R10-K34 HydrophobicContact CG-CD 4.16Å; R10-K34 HydrophobicContact CG-CG 4.24Å
11	S	87.4	Confident	87.7	Confident	67 Å²	67	118.4 Å²	118.4	47%	0.469	60%	0.602	S	S	.	*			trans	-87.5	55.5	167.8	-168	0	0	0	0	110.9	R15 D33	S11-R15 PolarHBondContact O-NH2 3.3Å; S11-D33 PolarHBondContact N-O 2.73Å; S11-D33 VanDerWaalsContact N-O 3.15Å
12	K	84.5	Confident	88.5	Confident	87 Å²	87	115.1 Å²	115.1	38%	0.378	58%	0.576	S	S	.	*			trans	-113.9	82.1	-179	-173.9	169.5	156	159.3	0	109.2	R10 R15 G16	R10-K12 HydrophobicContact CB-CB 4.28Å; R10-K12 PolarHBondContact O-N 3.4Å; K12-R15 WeakPolarHBondContact CE-O 3.23Å; K12-R15 WeakPolarHBondContact CG-O 3.41Å; K12-G16 WeakPolarHBondContact CD-O 3.5Å; K12-G16 WeakPolarHBondContact CE-O 3.14Å; K12-G16 PolarHBondContact NZ-O 3.39Å
13	K	86.2	Confident	88.7	Confident	174 Å²	174	110.8 Å²	110.8	76%	0.757	55%	0.551	S	S	*	*	S	Bend	trans	-105.4	97.2	176.9	-62.6	-176.2	-178.6	-179	0	109	R15	K13-R15 PolarHBondContact O-N 2.98Å; K13-R15 VanDerWaalsContact O-N 3.07Å
14	G	84.2	Confident	88.8	Confident	90 Å²	90	109.7 Å²	109.7	93%	0.928	56%	0.562	S	S	*	*	S	Bend	trans	71.4	-2.8	-179.5	0	0	0	0	0	115.9
15	R	80.7	Confident	88.9	Confident	142 Å²	142	107.3 Å²	107.3	54%	0.536	56%	0.559	S	S	.	*			trans	-81.3	136.6	171.8	-63.5	-165.9	-72.6	-139.4	0.2	109.7	S11 K12 K13 V18	S11-R15 PolarHBondContact O-NH2 3.3Å; K12-R15 WeakPolarHBondContact CE-O 3.23Å; K12-R15 WeakPolarHBondContact CG-O 3.41Å; K13-R15 PolarHBondContact O-N 2.98Å; K13-R15 VanDerWaalsContact O-N 3.07Å; R15-V18 HydrophobicContact CB-CG2 4.36Å
16	G	86.2	Confident	89.1	Confident	52 Å²	52	103.2 Å²	103.2	54%	0.536	56%	0.556	S	S	.	*			trans	-69	-128.9	174.3	0	0	0	0	0	112.4	K12	K12-G16 WeakPolarHBondContact CD-O 3.5Å; K12-G16 WeakPolarHBondContact CE-O 3.14Å; K12-G16 PolarHBondContact NZ-O 3.39Å
17	H	87.4	Confident	89.2	Confident	134 Å²	134	95.1 Å²	95.1	62%	0.62	54%	0.537	S	S	*	.	S	Bend	trans	-72	132.9	172.8	-166.3	-80.2	0	0	0	110.2	F20	H17-F20 AromaticContact CE1-CD2 3.75Å; H17-F20 AromaticContact CE1-CE2 3.13Å; H17-F20 WeakPolarHBondContact CE1-CE2 3.2Å; H17-F20 AromaticContact CE1-CZ 3.35Å; H17-F20 WeakPolarHBondContact CE1-CZ 3.46Å; H17-F20 AromaticContact NE2-CE2 3.35Å; H17-F20 VanDerWaalsContact NE2-CE2 3.35Å; H17-F20 WeakPolarHBondContact NE2-CE2 3.38Å; H17-F20 AromaticContact NE2-CZ 3.14Å; H17-F20 WeakPolarHBondContact NE2-CZ 3.31Å
18	V	88	Confident	89.4	Confident	22 Å²	22	99 Å²	99	13%	0.133	54%	0.544	C	S	.	.	P	Polyproline II helix	trans	-103.2	140.4	177	-178.5	0	0	0	0	107.8	R15 K32	R15-V18 HydrophobicContact CB-CG2 4.36Å; V18-K32 HydrophobicContact CG1-CB 3.92Å
19	G	90.4	Very high	89.7	Confident	52 Å²	52	95.5 Å²	95.5	54%	0.536	54%	0.535	S	S	.	.	P	Polyproline II helix	trans	-50.9	144.6	176.7	0	0	0	0	0	113.2	K32	G19-K32 PolarHBondContact O-N 3.13Å; G19-K32 VanDerWaalsContact O-N 3.16Å
20	F	92.3	Very high	89.9	Confident	126 Å²	126	95.5 Å²	95.5	55%	0.553	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.8	146.7	177	-66.4	-71.5	0	0	0	111.3	H17 P31	H17-F20 AromaticContact CE1-CD2 3.75Å; H17-F20 AromaticContact CE1-CE2 3.13Å; H17-F20 WeakPolarHBondContact CE1-CE2 3.2Å; H17-F20 AromaticContact CE1-CZ 3.35Å; H17-F20 WeakPolarHBondContact CE1-CZ 3.46Å; H17-F20 AromaticContact NE2-CE2 3.35Å; H17-F20 VanDerWaalsContact NE2-CE2 3.35Å; H17-F20 WeakPolarHBondContact NE2-CE2 3.38Å; H17-F20 AromaticContact NE2-CZ 3.14Å; H17-F20 WeakPolarHBondContact NE2-CZ 3.31Å; F20-P31 HydrophobicContact CD1-CB 4.29Å; F20-P31 HydrophobicContact CE1-CB 4.3Å
21	I	92.4	Very high	89.9	Confident	75 Å²	75	93 Å²	93	39%	0.385	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	146.6	170.9	-62.1	177.2	0	0	0	107.7	C30 K32	I21-C30 PolarHBondContact N-O 3.13Å; I21-C30 PolarHBondContact O-N 3.49Å; I21-C30 VanDerWaalsContact O-O 3.06Å; I21-K32 HydrophobicContact CD1-CB 3.61Å; I21-K32 HydrophobicContact CD1-CD 3.94Å; I21-K32 HydrophobicContact CD1-CG 3.53Å; I21-K32 HydrophobicContact CG1-CB 4.07Å; I21-K32 HydrophobicContact CG1-CG 4.48Å
22	R	94.4	Very high	90.1	Very high	177 Å²	177	96.3 Å²	96.3	67%	0.668	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.5	133.1	175.2	-66.3	-72.3	-176.9	170.9	3.5	110.1	G27	R22-G27 WeakPolarHBondContact CD-O 3.28Å; R22-G27 PolarHBondContact NH1-O 3.21Å
23	C	93.8	Very high	90.4	Very high	46 Å²	46	93.1 Å²	93.1	31%	0.311	51%	0.514	S	S	.	.			trans	-65.7	137.3	173.7	-178.1	0	0	0	0	110.7	N25 G27 R28	C23-N25 VanDerWaalsContact C-N 3.31Å; C23-N25 PolarHBondContact O-N 3.45Å; C23-G27 VanDerWaalsContact O-CA 3.28Å; C23-G27 WeakPolarHBondContact O-CA 3.11Å; C23-G27 PolarHBondContact O-N 3.08Å; C23-R28 PolarHBondContact N-O 3.11Å
24	T	92.6	Very high	90.6	Very high	137 Å²	137	90.4 Å²	90.4	84%	0.84	50%	0.502	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.8	-31.4	178.5	52.6	0	0	0	0	113.2
25	N	93.5	Very high	90.9	Very high	151 Å²	151	88 Å²	88	81%	0.807	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.8	-37.2	-172.9	-62.2	6.2	0	0	0	112.7	C23	C23-N25 VanDerWaalsContact C-N 3.31Å; C23-N25 PolarHBondContact O-N 3.45Å
26	C	94.5	Very high	91.3	Very high	90 Å²	90	88.2 Å²	88.2	61%	0.608	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-124.1	-1.2	-172.7	64.4	0	0	0	0	114.6	R28	C26-R28 PolarHBondContact O-N 3.35Å
27	G	91.9	Very high	91.4	Very high	36 Å²	36	95.5 Å²	95.5	37%	0.371	50%	0.499	S	S	.	.			trans	65.8	2.3	179.5	0	0	0	0	0	115.5	R22 C23	R22-G27 WeakPolarHBondContact CD-O 3.28Å; R22-G27 PolarHBondContact NH1-O 3.21Å; C23-G27 VanDerWaalsContact O-CA 3.28Å; C23-G27 WeakPolarHBondContact O-CA 3.11Å; C23-G27 PolarHBondContact O-N 3.08Å
28	R	93.8	Very high	91.7	Very high	185 Å²	185	97.3 Å²	97.3	70%	0.698	51%	0.505	S	S	*	.			trans	-65.7	139.5	-179.8	-167.7	171.7	-177.5	173.4	3	110.8	C23 C26 C30	C23-R28 PolarHBondContact N-O 3.11Å; C26-R28 PolarHBondContact O-N 3.35Å; R28-C30 PolarHBondContact O-N 3.23Å
29	A	93.2	Very high	91.9	Very high	43 Å²	43	102.8 Å²	102.8	36%	0.355	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.5	119.3	172.6	0	0	0	0	0	109.9
30	C	90.2	Very high	92	Very high	45 Å²	45	103.6 Å²	103.6	30%	0.304	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	137.6	176.2	-71.6	0	0	0	0	108.7	I21 R28	I21-C30 PolarHBondContact N-O 3.13Å; I21-C30 PolarHBondContact O-N 3.49Å; I21-C30 VanDerWaalsContact O-O 3.06Å; R28-C30 PolarHBondContact O-N 3.23Å
31	P	91.3	Very high	92	Very high	22 Å²	22	103.7 Å²	103.7	14%	0.143	54%	0.538	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.9	138.2	175.7	27.9	-31.6	0	0	0	109.8	F20 D33 K34 S35	F20-P31 HydrophobicContact CD1-CB 4.29Å; F20-P31 HydrophobicContact CE1-CB 4.3Å; P31-D33 PolarHBondContact O-N 3.1Å; P31-K34 HydrophobicContact CG-CB 3.75Å; P31-K34 HydrophobicContact CG-CD 4.46Å; P31-K34 PolarHBondContact O-N 2.69Å; P31-S35 PolarHBondContact O-N 3.47Å; P31-S35 VanDerWaalsContact O-N 3.08Å
32	K	90.3	Very high	91.9	Very high	137 Å²	137	110 Å²	110	60%	0.596	56%	0.557	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.6	-32.9	-176.2	178.2	173.6	-174.4	178.3	0	113.7	V18 G19 I21 K34 S35	V18-K32 HydrophobicContact CG1-CB 3.92Å; G19-K32 PolarHBondContact O-N 3.13Å; G19-K32 VanDerWaalsContact O-N 3.16Å; I21-K32 HydrophobicContact CD1-CB 3.61Å; I21-K32 HydrophobicContact CD1-CD 3.94Å; I21-K32 HydrophobicContact CD1-CG 3.53Å; I21-K32 HydrophobicContact CG1-CB 4.07Å; I21-K32 HydrophobicContact CG1-CG 4.48Å; K32-K34 PolarHBondContact O-N 3.45Å; K32-S35 PolarHBondContact O-OG 3.45Å
33	D	90.2	Very high	91.7	Very high	19 Å²	19	106 Å²	106	10%	0.102	56%	0.556	C	S	.	*	T	Hydrogen-bonded Turn	trans	-77.7	-8.7	-178.9	66.8	-84	0	0	0	114.1	R10 S11 P31	R10-D33 WeakPolarHBondContact CB-OD2 3.46Å; R10-D33 VanDerWaalsContact CG-OD2 3.27Å; R10-D33 WeakPolarHBondContact CG-OD2 3.36Å; R10-D33 IonicContact CZ-OD1 3.68Å; R10-D33 IonicContact CZ-OD2 3.44Å; R10-D33 IonicContact NE-OD1 3.67Å; R10-D33 IonicContact NE-OD2 2.67Å; R10-D33 PolarHBondContact NE-OD2 3.23Å; R10-D33 IonicContact NH2-OD1 2.82Å; R10-D33 PolarHBondContact NH2-OD1 2.9Å; R10-D33 IonicContact NH2-OD2 3.35Å; R10-D33 PolarHBondContact NH2-OD2 3.33Å; S11-D33 PolarHBondContact N-O 2.73Å; S11-D33 VanDerWaalsContact N-O 3.15Å; P31-D33 PolarHBondContact O-N 3.1Å
34	K	91.3	Very high	91.4	Very high	118 Å²	118	113.3 Å²	113.3	51%	0.513	59%	0.588	S	S	.	*	T	Hydrogen-bonded Turn	trans	-114.8	-9.1	176.2	-156.7	174.6	-157.6	-176.9	0	112.7	R10 P31 K32	R10-K34 HydrophobicContact CG-CB 4.27Å; R10-K34 HydrophobicContact CG-CD 4.16Å; R10-K34 HydrophobicContact CG-CG 4.24Å; P31-K34 HydrophobicContact CG-CB 3.75Å; P31-K34 HydrophobicContact CG-CD 4.46Å; P31-K34 PolarHBondContact O-N 2.69Å; K32-K34 PolarHBondContact O-N 3.45Å
35	S	90.3	Very high	91.2	Very high	38 Å²	38	109.1 Å²	109.1	27%	0.266	56%	0.562	S	S	.	*			trans	-66.8	136.6	178	54.4	0	0	0	0	110.2	P31 K32 W37	P31-S35 PolarHBondContact O-N 3.47Å; P31-S35 VanDerWaalsContact O-N 3.08Å; K32-S35 PolarHBondContact O-OG 3.45Å; S35-W37 PolarHBondContact O-N 3.46Å
36	V	90.2	Very high	91	Very high	147 Å²	147	107.6 Å²	107.6	89%	0.891	55%	0.55	S	S	*	*			trans	-83.8	109.3	167.2	-177.7	0	0	0	0	106.4
37	W	88.3	Confident	90.7	Very high	205 Å²	205	107.1 Å²	107.1	78%	0.777	55%	0.553	S	S	*	*			trans	-95.3	141.5	174.2	70.1	-81.2	0	0	0	108.8	S35 L39	S35-W37 PolarHBondContact O-N 3.46Å; W37-L39 HydrophobicContact CE3-CB 4.4Å; W37-L39 HydrophobicContact CZ3-CB 3.9Å
38	K	92.5	Very high	90.6	Very high	173 Å²	173	108.7 Å²	108.7	75%	0.752	56%	0.562	S	S	*	*			trans	-132.1	115.5	175.3	-170.2	-175.9	-179.3	179.9	0	107.2	V40	K38-V40 HydrophobicContact CB-CG2 4.34Å; K38-V40 HydrophobicContact CD-CG2 3.63Å; K38-V40 HydrophobicContact CG-CG2 3.65Å
39	L	93.1	Very high	90.4	Very high	137 Å²	137	101.3 Å²	101.3	72%	0.717	54%	0.541	S	S	*	.			trans	-78.5	119.6	166.9	-176.1	67.6	0	0	0	107.3	W37	W37-L39 HydrophobicContact CE3-CB 4.4Å; W37-L39 HydrophobicContact CZ3-CB 3.9Å
40	V	92.8	Very high	90.1	Very high	68 Å²	68	102 Å²	102	41%	0.412	54%	0.541	S	S	.	.			trans	-120.6	99.7	176.7	-168.3	0	0	0	0	107.1	K38 R42	K38-V40 HydrophobicContact CB-CG2 4.34Å; K38-V40 HydrophobicContact CD-CG2 3.63Å; K38-V40 HydrophobicContact CG-CG2 3.65Å; V40-R42 HydrophobicContact CG1-CG 3.78Å; V40-R42 PolarHBondContact O-N 3.33Å
41	T	91.7	Very high	89.8	Confident	129 Å²	129	106.4 Å²	106.4	79%	0.791	56%	0.555	S	S	*	*			trans	-79.9	115.1	168.6	-49.7	0	0	0	0	107.4
42	R	90.7	Very high	89.7	Confident	207 Å²	207	110.8 Å²	110.8	78%	0.781	58%	0.577	S	S	*	*			trans	-115.8	145.2	171.1	-63.5	-176.4	168.8	153	-6.6	107.7	V40	V40-R42 HydrophobicContact CG1-CG 3.78Å; V40-R42 PolarHBondContact O-N 3.33Å
43	S	88.9	Confident	89.5	Confident	92 Å²	92	108.9 Å²	108.9	64%	0.643	57%	0.573	S	S	*	*			trans	-55.7	146.4	165	48.9	0	0	0	0	109.1	V45	S43-V45 VanDerWaalsContact CB-O 3.31Å; S43-V45 WeakPolarHBondContact CB-O 3.27Å; S43-V45 PolarHBondContact O-N 3.22Å; S43-V45 PolarHBondContact OG-O 2.62Å
44	M	87.8	Confident	89.3	Confident	200 Å²	200	113.7 Å²	113.7	99%	0.985	60%	0.595	S	S	*	*	S	Bend	trans	-65.1	-32.9	175.2	-65.9	-173.1	-70.1	0	0	111.1
45	V	88.8	Confident	89	Confident	49 Å²	49	113.9 Å²	113.9	30%	0.297	60%	0.602	S	S	.	*	S	Bend	trans	-101.1	140	179.9	-172	0	0	0	0	109.3	S43 A49 V50 L53	S43-V45 VanDerWaalsContact CB-O 3.31Å; S43-V45 WeakPolarHBondContact CB-O 3.27Å; S43-V45 PolarHBondContact O-N 3.22Å; S43-V45 PolarHBondContact OG-O 2.62Å; V45-A49 HydrophobicContact CG1-CB 3.86Å; V45-V50 HydrophobicContact CB-CG2 4.24Å; V45-V50 HydrophobicContact CG1-CG2 3.96Å; V45-L53 HydrophobicContact CB-CD1 4.22Å; V45-L53 HydrophobicContact CG1-CD1 3.46Å; V45-L53 VanDerWaalsContact CG1-CD1 3.46Å; V45-L53 HydrophobicContact CG1-CG 4.49Å; V45-L53 HydrophobicContact CG2-CD1 3.62Å
46	E	89.7	Confident	88.9	Confident	119 Å²	119	116.2 Å²	116.2	56%	0.556	62%	0.623	S	S	*	*			trans	-66.6	146.4	170.5	-172.8	-75.5	134.7	0	0	110.1	A48 A49 V50	E46-A48 VanDerWaalsContact C-N 3.3Å; E46-A48 VanDerWaalsContact CD-N 3.27Å; E46-A48 PolarHBondContact O-N 3.08Å; E46-A48 PolarHBondContact OE1-N 2.92Å; E46-A48 VanDerWaalsContact OE1-N 3.13Å; E46-A48 WeakPolarHBondContact OE2-CA 3.2Å; E46-A48 WeakPolarHBondContact OE2-CB 3.08Å; E46-A48 PolarHBondContact OE2-N 3.43Å; E46-A49 HydrophobicContact CB-CB 4.49Å; E46-A49 PolarHBondContact O-N 3.18Å; E46-A49 VanDerWaalsContact O-N 3.1Å; E46-A49 PolarHBondContact OE2-N 2.75Å; E46-A49 VanDerWaalsContact OE2-N 3.13Å; E46-V50 WeakPolarHBondContact O-CG2 3.5Å; E46-V50 PolarHBondContact O-N 2.92Å
47	A	87.7	Confident	88.7	Confident	80 Å²	80	110.9 Å²	110.9	66%	0.661	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.1	-34.1	-167.7	0	0	0	0	0	114.1
48	A	89.6	Confident	88.5	Confident	69 Å²	69	107.4 Å²	107.4	57%	0.57	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.2	-36.6	176.5	0	0	0	0	0	112.1	E46 V50	E46-A48 VanDerWaalsContact C-N 3.3Å; E46-A48 VanDerWaalsContact CD-N 3.27Å; E46-A48 PolarHBondContact O-N 3.08Å; E46-A48 PolarHBondContact OE1-N 2.92Å; E46-A48 VanDerWaalsContact OE1-N 3.13Å; E46-A48 WeakPolarHBondContact OE2-CA 3.2Å; E46-A48 WeakPolarHBondContact OE2-CB 3.08Å; E46-A48 PolarHBondContact OE2-N 3.43Å; A48-V50 VanDerWaalsContact C-N 3.25Å; A48-V50 PolarHBondContact O-N 2.95Å
49	A	89.6	Confident	88	Confident	31 Å²	31	106.5 Å²	106.5	26%	0.256	59%	0.586	S	S	.	*	H	α-helix	trans	-73.3	-10.1	-178.8	0	0	0	0	0	114.8	V45 E46 K51 D52 L53	V45-A49 HydrophobicContact CG1-CB 3.86Å; E46-A49 HydrophobicContact CB-CB 4.49Å; E46-A49 PolarHBondContact O-N 3.18Å; E46-A49 VanDerWaalsContact O-N 3.1Å; E46-A49 PolarHBondContact OE2-N 2.75Å; E46-A49 VanDerWaalsContact OE2-N 3.13Å; A49-K51 VanDerWaalsContact C-N 3.31Å; A49-K51 PolarHBondContact O-N 2.67Å; A49-D52 PolarHBondContact O-N 3.15Å; A49-L53 WeakPolarHBondContact O-CB 2.96Å; A49-L53 WeakPolarHBondContact O-CG 3.1Å; A49-L53 PolarHBondContact O-N 3.37Å; A49-L53 VanDerWaalsContact O-N 3.08Å
50	V	86.9	Confident	87.1	Confident	57 Å²	57	104.3 Å²	104.3	35%	0.345	60%	0.597	S	S	.	*	H	α-helix	trans	-57.4	-46.6	179.9	178	0	0	0	0	110.9	V45 E46 A48 L53 E54	V45-V50 HydrophobicContact CB-CG2 4.24Å; V45-V50 HydrophobicContact CG1-CG2 3.96Å; E46-V50 WeakPolarHBondContact O-CG2 3.5Å; E46-V50 PolarHBondContact O-N 2.92Å; A48-V50 VanDerWaalsContact C-N 3.25Å; A48-V50 PolarHBondContact O-N 2.95Å; V50-L53 PolarHBondContact O-N 2.88Å; V50-E54 WeakPolarHBondContact CG1-OE1 3.35Å; V50-E54 WeakPolarHBondContact O-CG 3.35Å; V50-E54 PolarHBondContact O-N 3.35Å
51	K	84.9	Confident	86.1	Confident	138 Å²	138	105.7 Å²	105.7	60%	0.6	61%	0.61	S	S	*	*	H	α-helix	trans	-68.5	-43.1	-177.2	-177.4	166.9	177.8	144.5	0	112.6	A49 L53 E54 D55	A49-K51 VanDerWaalsContact C-N 3.31Å; A49-K51 PolarHBondContact O-N 2.67Å; K51-L53 PolarHBondContact O-N 3.06Å; K51-E54 PolarHBondContact O-N 3.16Å; K51-D55 PolarHBondContact O-N 3.47Å
52	D	88.3	Confident	84.9	Confident	113 Å²	113	107.1 Å²	107.1	60%	0.604	60%	0.601	S	S	*	*	H	α-helix	trans	-62.4	-36.4	178.5	-62.3	-43.6	0	0	0	111.4	A49 A56	A49-D52 PolarHBondContact O-N 3.15Å; D52-A56 VanDerWaalsContact O-CB 3.23Å; D52-A56 WeakPolarHBondContact O-CB 3.14Å; D52-A56 PolarHBondContact O-N 2.82Å; D52-A56 VanDerWaalsContact O-N 3.11Å
53	L	86.4	Confident	83.4	Confident	98 Å²	98	108.7 Å²	108.7	51%	0.513	62%	0.623	S	S	.	*	H	α-helix	trans	-72.1	-39.4	175.3	-73.4	-179.5	0	0	0	112.6	V45 A49 V50 K51 A56 S57	V45-L53 HydrophobicContact CB-CD1 4.22Å; V45-L53 HydrophobicContact CG1-CD1 3.46Å; V45-L53 VanDerWaalsContact CG1-CD1 3.46Å; V45-L53 HydrophobicContact CG1-CG 4.49Å; V45-L53 HydrophobicContact CG2-CD1 3.62Å; A49-L53 WeakPolarHBondContact O-CB 2.96Å; A49-L53 WeakPolarHBondContact O-CG 3.1Å; A49-L53 PolarHBondContact O-N 3.37Å; A49-L53 VanDerWaalsContact O-N 3.08Å; V50-L53 PolarHBondContact O-N 2.88Å; K51-L53 PolarHBondContact O-N 3.06Å; L53-A56 PolarHBondContact O-N 2.82Å; L53-S57 WeakPolarHBondContact O-CB 3.13Å; L53-S57 PolarHBondContact O-N 3.42Å; L53-S57 PolarHBondContact O-OG 2.98Å
54	E	86.1	Confident	83.1	Confident	120 Å²	120	109.5 Å²	109.5	56%	0.561	62%	0.622	S	S	*	*	H	α-helix	trans	-60.5	-48.7	175.1	-75.7	172.8	-180	0	0	110.9	V50 K51 A56 S57	V50-E54 WeakPolarHBondContact CG1-OE1 3.35Å; V50-E54 WeakPolarHBondContact O-CG 3.35Å; V50-E54 PolarHBondContact O-N 3.35Å; K51-E54 PolarHBondContact O-N 3.16Å; E54-A56 PolarHBondContact O-N 3.07Å; E54-S57 PolarHBondContact O-N 3.23Å; E54-S57 PolarHBondContact O-OG 2.96Å
55	D	85.7	Confident	82.8	Confident	122 Å²	122	104.7 Å²	104.7	65%	0.652	60%	0.603	S	S	*	*	H	α-helix	trans	-66	-33.7	-179.2	-71.4	-22.8	0	0	0	112.8	K51 S57	K51-D55 PolarHBondContact O-N 3.47Å; D55-S57 VanDerWaalsContact C-N 3.32Å
56	A	88	Confident	82.5	Confident	86 Å²	86	107.8 Å²	107.8	71%	0.711	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.9	-6	179.3	0	0	0	0	0	114	D52 L53 E54	D52-A56 VanDerWaalsContact O-CB 3.23Å; D52-A56 WeakPolarHBondContact O-CB 3.14Å; D52-A56 PolarHBondContact O-N 2.82Å; D52-A56 VanDerWaalsContact O-N 3.11Å; L53-A56 PolarHBondContact O-N 2.82Å; E54-A56 PolarHBondContact O-N 3.07Å
57	S	86.1	Confident	82.1	Confident	35 Å²	35	107.2 Å²	107.2	25%	0.245	62%	0.624	C	S	.	*			trans	-96.8	146.9	-170.8	72.3	0	0	0	0	113.5	L53 E54 D55 Y59 W62	L53-S57 WeakPolarHBondContact O-CB 3.13Å; L53-S57 PolarHBondContact O-N 3.42Å; L53-S57 PolarHBondContact O-OG 2.98Å; E54-S57 PolarHBondContact O-N 3.23Å; E54-S57 PolarHBondContact O-OG 2.96Å; D55-S57 VanDerWaalsContact C-N 3.32Å; S57-Y59 VanDerWaalsContact C-N 3.35Å; S57-Y59 PolarHBondContact O-N 3.37Å; S57-Y59 PolarHBondContact OG-O 2.83Å; S57-W62 PolarHBondContact OG-NE1 2.84Å
58	V	84.1	Confident	81.7	Confident	133 Å²	133	108.9 Å²	108.9	81%	0.806	62%	0.622	S	S	*	*	S	Bend	trans	-72.3	-28.6	-174.7	178.4	0	0	0	0	112.7
59	Y	80.8	Confident	81.2	Confident	153 Å²	153	111.5 Å²	111.5	60%	0.6	63%	0.625	S	S	*	*	S	Bend	trans	-109.5	134.9	-178	-59.9	-102.9	0	0	0	108.7	S57 S61 W62	S57-Y59 VanDerWaalsContact C-N 3.35Å; S57-Y59 PolarHBondContact O-N 3.37Å; S57-Y59 PolarHBondContact OG-O 2.83Å; Y59-S61 PolarHBondContact O-N 2.72Å; Y59-S61 VanDerWaalsContact O-N 3.12Å; Y59-W62 AromaticContact CD2-CH2 2.97Å; Y59-W62 HydrophobicContact CD2-CH2 2.97Å; Y59-W62 AromaticContact CD2-CZ2 3.28Å; Y59-W62 HydrophobicContact CD2-CZ2 3.28Å; Y59-W62 AromaticContact CD2-CZ3 3.68Å; Y59-W62 HydrophobicContact CD2-CZ3 3.68Å; Y59-W62 AromaticContact CE2-CH2 3.6Å; Y59-W62 HydrophobicContact CE2-CH2 3.6Å; Y59-W62 HydrophobicContact CE2-CZ2 4.27Å; Y59-W62 HydrophobicContact CE2-CZ3 4.2Å; Y59-W62 AromaticContact CG-CH2 3.77Å; Y59-W62 HydrophobicContact CG-CH2 3.77Å; Y59-W62 AromaticContact CG-CZ2 3.86Å; Y59-W62 HydrophobicContact CG-CZ2 3.86Å; Y59-W62 HydrophobicContact CG-CZ3 4.17Å; Y59-W62 PolarHBondContact O-NE1 2.91Å
60	G	73.8	Confident	80.6	Confident	92 Å²	92	117.3 Å²	117.3	95%	0.948	65%	0.651	S	S	*	*	S	Bend	trans	-72.5	-0.4	-176.3	0	0	0	0	0	115.3
61	S	73.4	Confident	80.1	Confident	97 Å²	97	121.9 Å²	121.9	68%	0.678	68%	0.675	S	S	*	*			trans	-152.7	123.2	178.7	61.8	0	0	0	0	110.2	Y59	Y59-S61 PolarHBondContact O-N 2.72Å; Y59-S61 VanDerWaalsContact O-N 3.12Å
62	W	66.5	Low	79.7	Confident	159 Å²	159	120.6 Å²	120.6	60%	0.602	68%	0.681	S	S	*	*			trans	-120.5	16.4	179.7	-60.7	99.7	0	0	0	114	S57 Y59	S57-W62 PolarHBondContact OG-NE1 2.84Å; Y59-W62 AromaticContact CD2-CH2 2.97Å; Y59-W62 HydrophobicContact CD2-CH2 2.97Å; Y59-W62 AromaticContact CD2-CZ2 3.28Å; Y59-W62 HydrophobicContact CD2-CZ2 3.28Å; Y59-W62 AromaticContact CD2-CZ3 3.68Å; Y59-W62 HydrophobicContact CD2-CZ3 3.68Å; Y59-W62 AromaticContact CE2-CH2 3.6Å; Y59-W62 HydrophobicContact CE2-CH2 3.6Å; Y59-W62 HydrophobicContact CE2-CZ2 4.27Å; Y59-W62 HydrophobicContact CE2-CZ3 4.2Å; Y59-W62 AromaticContact CG-CH2 3.77Å; Y59-W62 HydrophobicContact CG-CH2 3.77Å; Y59-W62 AromaticContact CG-CZ2 3.86Å; Y59-W62 HydrophobicContact CG-CZ2 3.86Å; Y59-W62 HydrophobicContact CG-CZ3 4.17Å; Y59-W62 PolarHBondContact O-NE1 2.91Å
63	L	57.4	Low	78.9	Confident	239 Å²	239	121.3 Å²	121.3	100%	1.251	69%	0.688	S	S	*	*			trans	-134.5	0	-175.3	-113.8	145	0	0	0	111.4

Retrieved 63 of 63 residues in 58.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).