A0A5K4EFP0_SCHMA Loading...

Putative sugar transporter

AlphaFold DB , UniProt , Accession A0A5K4EFP0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 146 aa.

						>A0A5K4EFP0_SCHMA|A0A5K4EFP0
MRVSRSVQNSELYSASTVVVCSEFLKLLLSTILIFYQEGQIKRSISSIYNQIIVQYNDMIQILIPSTLYIVQNNLLYFAISHLNAVLYQILYQSKIFTTAMFMILLLNHHLRSTQWFSLLLLSTGIILTQVSQHRAVNSIQICMGY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.3	Very low	50.4	Low	234 Å²	234	144.1 Å²	144.1	100%	1.153	74%	0.744	S	S	*	*				0	75.8	0	-158.3	173.3	-160.1	0	0	109.4
2	R	49.5	Very low	50.7	Low	225 Å²	225	141.4 Å²	141.4	85%	0.849	73%	0.731	S	S	*	*			trans	-101	74.3	-178.7	-68.5	-178.6	-175.1	173.6	2	108.9
3	V	58.1	Low	51.3	Low	129 Å²	129	141.7 Å²	141.7	78%	0.782	72%	0.718	S	S	*	*			trans	-122.6	55	176.6	-170.7	0	0	0	0	109.4
4	S	60.1	Low	52.4	Low	109 Å²	109	134.7 Å²	134.7	76%	0.762	69%	0.689	S	S	*	*			trans	-155.7	22.9	172.7	44.1	0	0	0	0	112.4
5	R	50.7	Low	53.8	Low	224 Å²	224	126.4 Å²	126.4	85%	0.845	65%	0.648	S	S	*	*			trans	-103.6	5.3	173	-61.1	-174.4	73.2	98.8	-1.3	113.8
6	S	46.4	Very low	55.4	Low	93 Å²	93	120.6 Å²	120.6	65%	0.65	62%	0.623	S	S	*	*			trans	-113.4	110.4	165	53.7	0	0	0	0	104.9
7	V	52.3	Low	57.1	Low	108 Å²	108	117.6 Å²	117.6	66%	0.655	61%	0.611	S	S	*	*			cis	-151.4	129	48.6	172.3	0	0	0	0	107.6	N9	V7-N9 HydrophobicContact CG1-CB 3.85Å; V7-N9 VanDerWaalsContact CG1-CG 3.5Å; V7-N9 WeakPolarHBondContact CG1-ND2 3.5Å; V7-N9 PolarHBondContact O-N 2.76Å
8	Q	47.1	Very low	58.6	Low	189 Å²	189	115.3 Å²	115.3	88%	0.883	60%	0.603	S	S	*	*			trans	-69.9	49.9	172	-171.5	157.6	-57.9	0	0	111.7
9	N	46.5	Very low	59.9	Low	98 Å²	98	110.2 Å²	110.2	52%	0.524	58%	0.577	S	S	.	*			trans	-117.7	72.9	167.6	-65.5	-13.4	0	0	0	105.7	V7 E11 L12	V7-N9 HydrophobicContact CG1-CB 3.85Å; V7-N9 VanDerWaalsContact CG1-CG 3.5Å; V7-N9 WeakPolarHBondContact CG1-ND2 3.5Å; V7-N9 PolarHBondContact O-N 2.76Å; N9-E11 PolarHBondContact O-N 3.29Å; N9-L12 HydrophobicContact CB-CD1 3.96Å; N9-L12 HydrophobicContact CB-CG 4.3Å; N9-L12 PolarHBondContact O-N 3.07Å
10	S	51.5	Low	61.1	Low	110 Å²	110	109.7 Å²	109.7	77%	0.769	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.3	6.5	-175.9	43.9	0	0	0	0	115.8
11	E	51.8	Low	62.3	Low	66 Å²	66	107.3 Å²	107.3	31%	0.308	57%	0.57	S	S	.	*	T	Hydrogen-bonded Turn	trans	-124.2	-0.9	-167.7	-59.9	-66	136.2	0	0	113.2	N9 Y77 I80 S81	N9-E11 PolarHBondContact O-N 3.29Å; E11-Y77 WeakPolarHBondContact O-CE2 3.37Å; E11-Y77 PolarHBondContact O-OH 3.03Å; E11-I80 VanDerWaalsContact CD-CG2 3.42Å; E11-I80 WeakPolarHBondContact OE1-CG2 3.4Å; E11-I80 VanDerWaalsContact OE2-C 3.24Å; E11-I80 WeakPolarHBondContact OE2-CB 3.41Å; E11-I80 WeakPolarHBondContact OE2-CG2 3.44Å; E11-S81 PolarHBondContact OE2-N 2.85Å
12	L	54.1	Low	64.5	Low	112 Å²	112	98.2 Å²	98.2	59%	0.586	53%	0.529	S	S	*	.			trans	-111.2	1.8	-167.4	-62.4	-179.6	0	0	0	116.5	N9 S14 Y77	N9-L12 HydrophobicContact CB-CD1 3.96Å; N9-L12 HydrophobicContact CB-CG 4.3Å; N9-L12 PolarHBondContact O-N 3.07Å; L12-S14 PolarHBondContact O-N 3.13Å; L12-Y77 WeakPolarHBondContact CD2-OH 3.33Å
13	Y	59.1	Low	66.3	Low	145 Å²	145	90.9 Å²	90.9	57%	0.569	51%	0.505	S	S	*	.	S	Bend	trans	-76	98.1	168.5	-162.7	-87.6	0	0	0	108	A15 T17 V18	Y13-A15 PolarHBondContact O-N 2.97Å; Y13-A15 VanDerWaalsContact O-N 3.14Å; Y13-T17 HydrophobicContact CE1-CG2 4.24Å; Y13-T17 HydrophobicContact CE2-CG2 4.35Å; Y13-V18 HydrophobicContact CD1-CG2 3.45Å; Y13-V18 VanDerWaalsContact CD1-CG2 3.45Å; Y13-V18 HydrophobicContact CE1-CB 4.03Å; Y13-V18 HydrophobicContact CE1-CG2 3.17Å
14	S	66.5	Low	67.9	Low	44 Å²	44	90.8 Å²	90.8	31%	0.308	49%	0.494	S	S	.	.			trans	-54.3	121.5	-179.2	-173.4	0	0	0	0	109	L12 S16 T17 V18	L12-S14 PolarHBondContact O-N 3.13Å; S14-S16 PolarHBondContact O-N 3.41Å; S14-T17 WeakPolarHBondContact O-CA 3.46Å; S14-T17 VanDerWaalsContact O-CB 3.31Å; S14-T17 WeakPolarHBondContact O-CB 3.44Å; S14-T17 PolarHBondContact O-N 3.4Å; S14-V18 PolarHBondContact O-N 3.2Å
15	A	72.8	Confident	69.4	Low	10 Å²	10	90.6 Å²	90.6	8%	0.083	48%	0.484	C	S	.	.	H	α-helix	trans	-56.9	-28	-179.4	0	0	0	0	0	111.4	Y13 T17 V18 V19 N73	Y13-A15 PolarHBondContact O-N 2.97Å; Y13-A15 VanDerWaalsContact O-N 3.14Å; A15-T17 VanDerWaalsContact C-N 3.34Å; A15-T17 PolarHBondContact O-N 2.99Å; A15-V18 PolarHBondContact O-N 3.47Å; A15-V19 WeakPolarHBondContact O-CG2 3.29Å; A15-V19 PolarHBondContact O-N 3.06Å; A15-V19 VanDerWaalsContact O-N 3.16Å; A15-N73 HydrophobicContact CB-CB 3.55Å; A15-N73 VanDerWaalsContact CB-O 3.26Å; A15-N73 WeakPolarHBondContact CB-O 3.42Å
16	S	79	Confident	71.2	Confident	34 Å²	34	85.3 Å²	85.3	24%	0.238	47%	0.467	C	S	.	.	H	α-helix	trans	-59.9	-37.4	170.5	-59	0	0	0	0	113.2	S14 V19 V20 N74	S14-S16 PolarHBondContact O-N 3.41Å; S16-V19 PolarHBondContact O-N 3.43Å; S16-V20 WeakPolarHBondContact O-CB 3.48Å; S16-V20 VanDerWaalsContact O-CG2 3.28Å; S16-V20 WeakPolarHBondContact O-CG2 3.48Å; S16-V20 PolarHBondContact O-N 3.36Å; S16-N74 PolarHBondContact OG-ND2 3.17Å; S16-N74 VanDerWaalsContact OG-ND2 3.1Å; S16-N74 PolarHBondContact OG-OD1 2.92Å
17	T	84.8	Confident	73.2	Confident	70 Å²	70	86 Å²	86	43%	0.429	46%	0.463	S	S	.	.	H	α-helix	trans	-65.6	-40.9	176.3	-51.9	0	0	0	0	111.6	Y13 S14 A15 V19 V20 C21	Y13-T17 HydrophobicContact CE1-CG2 4.24Å; Y13-T17 HydrophobicContact CE2-CG2 4.35Å; S14-T17 WeakPolarHBondContact O-CA 3.46Å; S14-T17 VanDerWaalsContact O-CB 3.31Å; S14-T17 WeakPolarHBondContact O-CB 3.44Å; S14-T17 PolarHBondContact O-N 3.4Å; A15-T17 VanDerWaalsContact C-N 3.34Å; A15-T17 PolarHBondContact O-N 2.99Å; T17-V19 VanDerWaalsContact C-N 3.29Å; T17-V19 PolarHBondContact O-N 2.95Å; T17-V20 PolarHBondContact O-N 3.28Å; T17-C21 VanDerWaalsContact O-CB 3.22Å; T17-C21 WeakPolarHBondContact O-CB 3.2Å; T17-C21 PolarHBondContact O-N 3.14Å
18	V	83.6	Confident	75.1	Confident	75 Å²	75	84.6 Å²	84.6	46%	0.455	45%	0.451	S	S	.	.	H	α-helix	trans	-58.3	-48.7	174.9	-171.4	0	0	0	0	108.9	Y13 S14 A15 C21 S22	Y13-V18 HydrophobicContact CD1-CG2 3.45Å; Y13-V18 VanDerWaalsContact CD1-CG2 3.45Å; Y13-V18 HydrophobicContact CE1-CB 4.03Å; Y13-V18 HydrophobicContact CE1-CG2 3.17Å; S14-V18 PolarHBondContact O-N 3.2Å; A15-V18 PolarHBondContact O-N 3.47Å; V18-C21 PolarHBondContact O-N 3.12Å; V18-S22 WeakPolarHBondContact O-CB 3.37Å; V18-S22 PolarHBondContact O-N 3.34Å
19	V	83.7	Confident	77.2	Confident	18 Å²	18	80.6 Å²	80.6	11%	0.109	44%	0.435	C	S	.	.	H	α-helix	trans	-64.1	-48	-176	179	0	0	0	0	110.5	A15 S16 T17 C21 S22 E23 I70 N73	A15-V19 WeakPolarHBondContact O-CG2 3.29Å; A15-V19 PolarHBondContact O-N 3.06Å; A15-V19 VanDerWaalsContact O-N 3.16Å; S16-V19 PolarHBondContact O-N 3.43Å; T17-V19 VanDerWaalsContact C-N 3.29Å; T17-V19 PolarHBondContact O-N 2.95Å; V19-C21 VanDerWaalsContact C-N 3.32Å; V19-C21 PolarHBondContact O-N 3.17Å; V19-S22 CarbonylContact O-C 3.57Å; V19-S22 WeakPolarHBondContact O-CA 3.38Å; V19-S22 WeakPolarHBondContact O-CB 3.4Å; V19-S22 PolarHBondContact O-N 2.93Å; V19-S22 PolarHBondContact O-OG 3.37Å; V19-E23 HydrophobicContact CG1-CG 4.39Å; V19-E23 WeakPolarHBondContact O-CG 3.42Å; V19-E23 PolarHBondContact O-N 2.81Å; V19-I70 HydrophobicContact CG1-CD1 4.39Å; V19-I70 HydrophobicContact CG1-CG1 3.75Å; V19-N73 HydrophobicContact CG2-CB 4.35Å; V19-N73 WeakPolarHBondContact CG2-ND2 3.48Å
20	V	84.2	Confident	79.2	Confident	100 Å²	100	78.3 Å²	78.3	61%	0.606	43%	0.427	S	S	*	.	H	α-helix	trans	-61.1	-41.6	177.4	172.9	0	0	0	0	111.5	S16 T17 S22 E23 F24	S16-V20 WeakPolarHBondContact O-CB 3.48Å; S16-V20 VanDerWaalsContact O-CG2 3.28Å; S16-V20 WeakPolarHBondContact O-CG2 3.48Å; S16-V20 PolarHBondContact O-N 3.36Å; T17-V20 PolarHBondContact O-N 3.28Å; V20-S22 VanDerWaalsContact C-N 3.3Å; V20-S22 PolarHBondContact O-N 3.38Å; V20-E23 PolarHBondContact O-N 3.1Å; V20-F24 WeakPolarHBondContact O-CB 3.3Å; V20-F24 PolarHBondContact O-N 2.97Å
21	C	87.1	Confident	80.8	Confident	61 Å²	61	77.3 Å²	77.3	41%	0.412	42%	0.417	S	S	.	.	H	α-helix	trans	-61.5	-41	174.3	-171.1	0	0	0	0	111.2	T17 V18 V19 F24 L25	T17-C21 VanDerWaalsContact O-CB 3.22Å; T17-C21 WeakPolarHBondContact O-CB 3.2Å; T17-C21 PolarHBondContact O-N 3.14Å; V18-C21 PolarHBondContact O-N 3.12Å; V19-C21 VanDerWaalsContact C-N 3.32Å; V19-C21 PolarHBondContact O-N 3.17Å; C21-F24 PolarHBondContact O-N 3.46Å; C21-L25 WeakPolarHBondContact O-CG 3.39Å; C21-L25 PolarHBondContact O-N 2.99Å
22	S	86.6	Confident	82.6	Confident	42 Å²	42	78.2 Å²	78.2	29%	0.294	42%	0.423	S	S	.	.	H	α-helix	trans	-65.7	-39	176.2	82.7	0	0	0	0	112.6	V18 V19 V20 L25 K26	V18-S22 WeakPolarHBondContact O-CB 3.37Å; V18-S22 PolarHBondContact O-N 3.34Å; V19-S22 CarbonylContact O-C 3.57Å; V19-S22 WeakPolarHBondContact O-CA 3.38Å; V19-S22 WeakPolarHBondContact O-CB 3.4Å; V19-S22 PolarHBondContact O-N 2.93Å; V19-S22 PolarHBondContact O-OG 3.37Å; V20-S22 VanDerWaalsContact C-N 3.3Å; V20-S22 PolarHBondContact O-N 3.38Å; S22-L25 PolarHBondContact O-N 3.4Å; S22-K26 VanDerWaalsContact O-CG 3.27Å; S22-K26 WeakPolarHBondContact O-CG 3.48Å; S22-K26 PolarHBondContact O-N 3.36Å
23	E	86.9	Confident	84.2	Confident	72 Å²	72	77.8 Å²	77.8	34%	0.336	42%	0.421	S	S	.	.	H	α-helix	trans	-66.4	-41.9	175.2	-69.2	-53.1	132.3	0	0	111	V19 V20 L25 K26 L27	V19-E23 HydrophobicContact CG1-CG 4.39Å; V19-E23 WeakPolarHBondContact O-CG 3.42Å; V19-E23 PolarHBondContact O-N 2.81Å; V20-E23 PolarHBondContact O-N 3.1Å; E23-L25 PolarHBondContact O-N 2.87Å; E23-K26 PolarHBondContact O-N 2.92Å; E23-K26 IonicContact OE1-NZ 2.71Å; E23-K26 PolarHBondContact OE1-NZ 3.35Å; E23-L27 WeakPolarHBondContact O-CG 3.45Å; E23-L27 PolarHBondContact O-N 3.41Å
24	F	90.9	Very high	85.5	Confident	126 Å²	126	72.7 Å²	72.7	55%	0.553	40%	0.403	S	S	*	.	H	α-helix	trans	-62.2	-42.5	175.9	-171.7	-103.2	0	0	0	112.3	V20 C21 L27 L28	V20-F24 WeakPolarHBondContact O-CB 3.3Å; V20-F24 PolarHBondContact O-N 2.97Å; C21-F24 PolarHBondContact O-N 3.46Å; F24-L27 PolarHBondContact O-N 2.88Å; F24-L28 HydrophobicContact CD1-CD1 3.81Å; F24-L28 HydrophobicContact CD1-CG 4.37Å; F24-L28 HydrophobicContact CE1-CD1 3.39Å; F24-L28 HydrophobicContact CE1-CG 4.04Å; F24-L28 HydrophobicContact CZ-CD1 4.05Å; F24-L28 HydrophobicContact CZ-CG 4.29Å; F24-L28 WeakPolarHBondContact O-CG 3.22Å; F24-L28 PolarHBondContact O-N 3.37Å
25	L	91	Very high	86.3	Confident	106 Å²	106	75.9 Å²	75.9	56%	0.555	41%	0.411	S	S	*	.	H	α-helix	trans	-63.9	-41.3	175.2	-74.5	171.8	0	0	0	112.3	C21 S22 E23 L28 L29	C21-L25 WeakPolarHBondContact O-CG 3.39Å; C21-L25 PolarHBondContact O-N 2.99Å; S22-L25 PolarHBondContact O-N 3.4Å; E23-L25 PolarHBondContact O-N 2.87Å; L25-L28 PolarHBondContact O-N 2.92Å; L25-L29 WeakPolarHBondContact O-CB 3.29Å; L25-L29 PolarHBondContact O-N 3.24Å
26	K	89.2	Confident	86.9	Confident	112 Å²	112	84.4 Å²	84.4	49%	0.487	44%	0.442	S	S	.	.	H	α-helix	trans	-61.6	-43.8	174.9	-71.5	170.6	-161.2	169.3	0	111.4	S22 E23 L29 S30	S22-K26 VanDerWaalsContact O-CG 3.27Å; S22-K26 WeakPolarHBondContact O-CG 3.48Å; S22-K26 PolarHBondContact O-N 3.36Å; E23-K26 PolarHBondContact O-N 2.92Å; E23-K26 IonicContact OE1-NZ 2.71Å; E23-K26 PolarHBondContact OE1-NZ 3.35Å; K26-L29 PolarHBondContact O-N 2.88Å; K26-S30 WeakPolarHBondContact O-CB 3.22Å; K26-S30 PolarHBondContact O-N 3.48Å; K26-S30 PolarHBondContact O-OG 2.96Å
27	L	88.5	Confident	87	Confident	107 Å²	107	90.4 Å²	90.4	56%	0.56	47%	0.467	S	S	*	.	H	α-helix	trans	-63.9	-42.3	178	-73.2	174.8	0	0	0	112.2	E23 F24 S30 T31	E23-L27 WeakPolarHBondContact O-CG 3.45Å; E23-L27 PolarHBondContact O-N 3.41Å; F24-L27 PolarHBondContact O-N 2.88Å; L27-S30 PolarHBondContact O-OG 2.7Å; L27-S30 VanDerWaalsContact O-OG 3.1Å; L27-T31 VanDerWaalsContact O-CB 3.29Å; L27-T31 WeakPolarHBondContact O-CB 3.11Å; L27-T31 PolarHBondContact O-N 2.86Å; L27-T31 PolarHBondContact O-OG1 3.49Å
28	L	92.3	Very high	86.6	Confident	79 Å²	79	90.1 Å²	90.1	41%	0.414	46%	0.461	S	S	.	.	H	α-helix	trans	-62.4	-48.2	174.2	-78.2	177	0	0	0	111.2	F24 L25 T31 I32	F24-L28 HydrophobicContact CD1-CD1 3.81Å; F24-L28 HydrophobicContact CD1-CG 4.37Å; F24-L28 HydrophobicContact CE1-CD1 3.39Å; F24-L28 HydrophobicContact CE1-CG 4.04Å; F24-L28 HydrophobicContact CZ-CD1 4.05Å; F24-L28 HydrophobicContact CZ-CG 4.29Å; F24-L28 WeakPolarHBondContact O-CG 3.22Å; F24-L28 PolarHBondContact O-N 3.37Å; L25-L28 PolarHBondContact O-N 2.92Å; L28-T31 PolarHBondContact O-N 3.02Å; L28-I32 WeakPolarHBondContact O-CB 3.07Å; L28-I32 WeakPolarHBondContact O-CD1 3.26Å; L28-I32 WeakPolarHBondContact O-CG1 3.5Å; L28-I32 PolarHBondContact O-N 2.88Å
29	L	91.8	Very high	86	Confident	105 Å²	105	89.3 Å²	89.3	55%	0.55	47%	0.467	S	S	.	.	H	α-helix	trans	-63.7	-44.1	-178.6	-175.2	64.1	0	0	0	111.9	L25 K26 I32 L33	L25-L29 WeakPolarHBondContact O-CB 3.29Å; L25-L29 PolarHBondContact O-N 3.24Å; K26-L29 PolarHBondContact O-N 2.88Å; L29-I32 PolarHBondContact O-N 3.02Å; L29-L33 HydrophobicContact CD1-CD1 4.45Å; L29-L33 HydrophobicContact CD1-CG 4.42Å; L29-L33 HydrophobicContact CG-CD1 4.08Å; L29-L33 HydrophobicContact CG-CG 4.47Å; L29-L33 WeakPolarHBondContact O-CB 3.42Å; L29-L33 VanDerWaalsContact O-CG 3.3Å; L29-L33 WeakPolarHBondContact O-CG 3.31Å; L29-L33 PolarHBondContact O-N 3.17Å
30	S	87.5	Confident	85.6	Confident	50 Å²	50	93.3 Å²	93.3	35%	0.35	49%	0.485	S	S	.	.	H	α-helix	trans	-64.8	-40.7	177.7	66.5	0	0	0	0	111.5	K26 L27 L33 I34	K26-S30 WeakPolarHBondContact O-CB 3.22Å; K26-S30 PolarHBondContact O-N 3.48Å; K26-S30 PolarHBondContact O-OG 2.96Å; L27-S30 PolarHBondContact O-OG 2.7Å; L27-S30 VanDerWaalsContact O-OG 3.1Å; S30-L33 PolarHBondContact O-N 3.1Å; S30-I34 WeakPolarHBondContact O-CB 3.49Å; S30-I34 WeakPolarHBondContact O-CG1 3.27Å; S30-I34 PolarHBondContact O-N 2.86Å
31	T	86.3	Confident	85.1	Confident	89 Å²	89	93.7 Å²	93.7	55%	0.546	48%	0.482	S	S	.	.	H	α-helix	trans	-61.7	-45.9	175.4	-57.6	0	0	0	0	111.3	L27 L28 F35	L27-T31 VanDerWaalsContact O-CB 3.29Å; L27-T31 WeakPolarHBondContact O-CB 3.11Å; L27-T31 PolarHBondContact O-N 2.86Å; L27-T31 PolarHBondContact O-OG1 3.49Å; L28-T31 PolarHBondContact O-N 3.02Å; T31-F35 WeakPolarHBondContact O-CB 3.45Å; T31-F35 PolarHBondContact O-N 3.27Å
32	I	89.5	Confident	84.4	Confident	85 Å²	85	99.5 Å²	99.5	44%	0.436	50%	0.5	S	S	.	.	H	α-helix	trans	-62.5	-47.9	177.5	-69.9	165.6	0	0	0	110.7	L28 L29 I34 F35 Y36	L28-I32 WeakPolarHBondContact O-CB 3.07Å; L28-I32 WeakPolarHBondContact O-CD1 3.26Å; L28-I32 WeakPolarHBondContact O-CG1 3.5Å; L28-I32 PolarHBondContact O-N 2.88Å; L29-I32 PolarHBondContact O-N 3.02Å; I32-I34 PolarHBondContact O-N 3.42Å; I32-F35 WeakPolarHBondContact O-CB 3.34Å; I32-F35 PolarHBondContact O-N 3Å; I32-Y36 HydrophobicContact CG2-CD2 3.58Å; I32-Y36 HydrophobicContact CG2-CE2 3.57Å; I32-Y36 VanDerWaalsContact O-CD2 3.29Å; I32-Y36 WeakPolarHBondContact O-CD2 3.4Å; I32-Y36 PolarHBondContact O-N 3.45Å
33	L	87.4	Confident	83.8	Confident	104 Å²	104	104.4 Å²	104.4	55%	0.545	51%	0.512	S	S	.	.	H	α-helix	trans	-59.4	-44.1	179.6	-77.3	172.7	0	0	0	112.2	L29 S30 F35 Y36 Q37	L29-L33 HydrophobicContact CD1-CD1 4.45Å; L29-L33 HydrophobicContact CD1-CG 4.42Å; L29-L33 HydrophobicContact CG-CD1 4.08Å; L29-L33 HydrophobicContact CG-CG 4.47Å; L29-L33 WeakPolarHBondContact O-CB 3.42Å; L29-L33 VanDerWaalsContact O-CG 3.3Å; L29-L33 WeakPolarHBondContact O-CG 3.31Å; L29-L33 PolarHBondContact O-N 3.17Å; S30-L33 PolarHBondContact O-N 3.1Å; L33-F35 VanDerWaalsContact C-N 3.32Å; L33-F35 PolarHBondContact O-N 3.46Å; L33-Y36 PolarHBondContact O-N 2.96Å; L33-Q37 WeakPolarHBondContact O-CB 3.43Å; L33-Q37 PolarHBondContact O-N 3.34Å
34	I	85.1	Confident	83	Confident	38 Å²	38	101.4 Å²	101.4	20%	0.195	50%	0.499	C	S	.	.	H	α-helix	trans	-66.6	-36.4	178.5	-65.6	169	0	0	0	111.1	S30 I32 Q37 E38 S44 I48	S30-I34 WeakPolarHBondContact O-CB 3.49Å; S30-I34 WeakPolarHBondContact O-CG1 3.27Å; S30-I34 PolarHBondContact O-N 2.86Å; I32-I34 PolarHBondContact O-N 3.42Å; I34-Q37 PolarHBondContact O-N 2.9Å; I34-E38 PolarHBondContact O-N 3.37Å; I34-E38 VanDerWaalsContact O-N 3.14Å; I34-S44 PolarHBondContact O-OG 3.06Å; I34-I48 HydrophobicContact CD1-CD1 3.84Å; I34-I48 HydrophobicContact CD1-CG1 3.61Å; I34-I48 HydrophobicContact CG2-CD1 4.09Å; I34-I48 HydrophobicContact CG2-CG1 4.26Å
35	F	83.7	Confident	82.2	Confident	110 Å²	110	100.4 Å²	100.4	48%	0.482	50%	0.499	S	S	.	.	H	α-helix	trans	-64.9	-41.1	174.7	-174.2	-97	0	0	0	111.9	T31 I32 L33 G39 I41	T31-F35 WeakPolarHBondContact O-CB 3.45Å; T31-F35 PolarHBondContact O-N 3.27Å; I32-F35 WeakPolarHBondContact O-CB 3.34Å; I32-F35 PolarHBondContact O-N 3Å; L33-F35 VanDerWaalsContact C-N 3.32Å; L33-F35 PolarHBondContact O-N 3.46Å; F35-G39 WeakPolarHBondContact O-CA 3.36Å; F35-G39 PolarHBondContact O-N 3.29Å; F35-G39 VanDerWaalsContact O-N 3.13Å; F35-I41 HydrophobicContact CD2-CG1 4.07Å; F35-I41 HydrophobicContact CE2-CD1 4.16Å; F35-I41 HydrophobicContact CE2-CG1 3.63Å
36	Y	85.7	Confident	81.4	Confident	189 Å²	189	98.3 Å²	98.3	74%	0.741	49%	0.493	S	S	*	.	H	α-helix	trans	-67.1	-35.7	174.5	-88.2	-74	0	0	0	113.2	I32 L33	I32-Y36 HydrophobicContact CG2-CD2 3.58Å; I32-Y36 HydrophobicContact CG2-CE2 3.57Å; I32-Y36 VanDerWaalsContact O-CD2 3.29Å; I32-Y36 WeakPolarHBondContact O-CD2 3.4Å; I32-Y36 PolarHBondContact O-N 3.45Å; L33-Y36 PolarHBondContact O-N 2.96Å
37	Q	82.4	Confident	80.7	Confident	160 Å²	160	95.1 Å²	95.1	75%	0.748	49%	0.485	S	S	*	.	H	α-helix	trans	-75.2	-43.1	-175.6	-171.9	169.4	20.8	0	0	113	L33 I34	L33-Q37 WeakPolarHBondContact O-CB 3.43Å; L33-Q37 PolarHBondContact O-N 3.34Å; I34-Q37 PolarHBondContact O-N 2.9Å
38	E	74.6	Confident	79.9	Confident	65 Å²	65	92.9 Å²	92.9	30%	0.304	47%	0.473	S	S	.	.	H	α-helix	trans	-96	-20	-173.6	-68.4	-75.7	177.8	0	0	113.1	I34 Q40 R43 S44 S47	I34-E38 PolarHBondContact O-N 3.37Å; I34-E38 VanDerWaalsContact O-N 3.14Å; E38-Q40 PolarHBondContact O-N 2.94Å; E38-R43 HydrophobicContact CB-CB 4.36Å; E38-S44 WeakPolarHBondContact CB-OG 3.48Å; E38-S47 PolarHBondContact OE1-OG 3.05Å; E38-S47 VanDerWaalsContact OE1-OG 3.12Å
39	G	71.8	Confident	79	Confident	57 Å²	57	96.5 Å²	96.5	59%	0.588	48%	0.482	S	S	*	.	S	Bend	trans	62.5	-15.6	-178.6	0	0	0	0	0	115.7	F35	F35-G39 WeakPolarHBondContact O-CA 3.36Å; F35-G39 PolarHBondContact O-N 3.29Å; F35-G39 VanDerWaalsContact O-N 3.13Å
40	Q	75.4	Confident	78.1	Confident	103 Å²	103	95.8 Å²	95.8	48%	0.481	48%	0.479	S	S	.	.	S	Bend	trans	-125.4	115.3	-177.9	-63.2	-177	-1.9	0	0	110.3	E38 K42 R43 S44	E38-Q40 PolarHBondContact O-N 2.94Å; Q40-K42 PolarHBondContact O-N 3.46Å; Q40-R43 HydrophobicContact CB-CB 4.4Å; Q40-R43 HydrophobicContact CB-CG 4.36Å; Q40-R43 PolarHBondContact O-N 3.14Å; Q40-R43 VanDerWaalsContact OE1-NE 3.15Å; Q40-S44 PolarHBondContact O-N 2.87Å; Q40-S44 PolarHBondContact O-OG 3.29Å
41	I	72.5	Confident	77.4	Confident	107 Å²	107	98.7 Å²	98.7	55%	0.549	49%	0.487	S	S	.	.	H	α-helix	trans	-49.7	-39.8	-178.4	-61.8	165.2	0	0	0	112.6	F35 S44 I45	F35-I41 HydrophobicContact CD2-CG1 4.07Å; F35-I41 HydrophobicContact CE2-CD1 4.16Å; F35-I41 HydrophobicContact CE2-CG1 3.63Å; I41-S44 WeakPolarHBondContact O-CB 3.36Å; I41-S44 PolarHBondContact O-N 2.84Å; I41-I45 HydrophobicContact CG2-CD1 3.79Å; I41-I45 HydrophobicContact CG2-CG1 4.44Å; I41-I45 WeakPolarHBondContact O-CG1 3.47Å; I41-I45 PolarHBondContact O-N 2.68Å
42	K	74	Confident	76.7	Confident	183 Å²	183	98.5 Å²	98.5	80%	0.796	48%	0.482	S	S	*	.	H	α-helix	trans	-66.5	-38.8	-178.8	-65.7	-172.2	179.8	-176.1	0	112.6	Q40 S46	Q40-K42 PolarHBondContact O-N 3.46Å; K42-S46 PolarHBondContact O-N 3.45Å; K42-S46 VanDerWaalsContact O-N 3.17Å
43	R	72.7	Confident	76	Confident	145 Å²	145	99 Å²	99	55%	0.547	48%	0.484	S	S	.	.	H	α-helix	trans	-71.3	-43.2	175.3	-68.9	-175.4	-177.3	174.6	1.3	110.5	E38 Q40 I45 S46 S47	E38-R43 HydrophobicContact CB-CB 4.36Å; Q40-R43 HydrophobicContact CB-CB 4.4Å; Q40-R43 HydrophobicContact CB-CG 4.36Å; Q40-R43 PolarHBondContact O-N 3.14Å; Q40-R43 VanDerWaalsContact OE1-NE 3.15Å; R43-I45 VanDerWaalsContact C-N 3.34Å; R43-I45 PolarHBondContact O-N 2.84Å; R43-S46 PolarHBondContact O-N 2.71Å; R43-S46 VanDerWaalsContact O-N 3.1Å; R43-S47 WeakPolarHBondContact O-CB 3.44Å; R43-S47 PolarHBondContact O-N 3.26Å; R43-S47 PolarHBondContact O-OG 3.2Å
44	S	71.4	Confident	75.2	Confident	9 Å²	9	99.6 Å²	99.6	6%	0.063	49%	0.492	C	S	.	.	H	α-helix	trans	-50.3	-50.9	172.8	-60.1	0	0	0	0	112.6	I34 E38 Q40 I41 S47 I48	I34-S44 PolarHBondContact O-OG 3.06Å; E38-S44 WeakPolarHBondContact CB-OG 3.48Å; Q40-S44 PolarHBondContact O-N 2.87Å; Q40-S44 PolarHBondContact O-OG 3.29Å; I41-S44 WeakPolarHBondContact O-CB 3.36Å; I41-S44 PolarHBondContact O-N 2.84Å; S44-S47 PolarHBondContact O-N 3.46Å; S44-I48 WeakPolarHBondContact O-CB 3.43Å; S44-I48 WeakPolarHBondContact O-CD1 3.47Å; S44-I48 WeakPolarHBondContact O-CG1 3.27Å; S44-I48 PolarHBondContact O-N 3.5Å
45	I	73.7	Confident	74.8	Confident	105 Å²	105	101.7 Å²	101.7	54%	0.538	50%	0.501	S	S	.	.	H	α-helix	trans	-65.4	-40.9	179.6	-65.9	165.7	0	0	0	111.1	I41 R43 I48 Y49	I41-I45 HydrophobicContact CG2-CD1 3.79Å; I41-I45 HydrophobicContact CG2-CG1 4.44Å; I41-I45 WeakPolarHBondContact O-CG1 3.47Å; I41-I45 PolarHBondContact O-N 2.68Å; R43-I45 VanDerWaalsContact C-N 3.34Å; R43-I45 PolarHBondContact O-N 2.84Å; I45-I48 PolarHBondContact O-N 3.01Å; I45-Y49 WeakPolarHBondContact O-CB 3.09Å; I45-Y49 PolarHBondContact O-N 3.49Å
46	S	75	Confident	74.6	Confident	62 Å²	62	103.5 Å²	103.5	43%	0.434	51%	0.506	S	S	.	.	H	α-helix	trans	-64.9	-40.3	177.5	-168.3	0	0	0	0	112.1	K42 R43 Y49 N50	K42-S46 PolarHBondContact O-N 3.45Å; K42-S46 VanDerWaalsContact O-N 3.17Å; R43-S46 PolarHBondContact O-N 2.71Å; R43-S46 VanDerWaalsContact O-N 3.1Å; S46-Y49 PolarHBondContact O-N 3.49Å; S46-N50 WeakPolarHBondContact O-CB 3.45Å; S46-N50 VanDerWaalsContact O-CG 3.3Å; S46-N50 PolarHBondContact O-N 3.06Å; S46-N50 PolarHBondContact O-ND2 3.18Å
47	S	73.1	Confident	74.5	Confident	46 Å²	46	100 Å²	100	32%	0.322	50%	0.5	S	S	.	.	H	α-helix	trans	-65.5	-42.2	175.8	-64	0	0	0	0	110.9	E38 R43 S44 Q51	E38-S47 PolarHBondContact OE1-OG 3.05Å; E38-S47 VanDerWaalsContact OE1-OG 3.12Å; R43-S47 WeakPolarHBondContact O-CB 3.44Å; R43-S47 PolarHBondContact O-N 3.26Å; R43-S47 PolarHBondContact O-OG 3.2Å; S44-S47 PolarHBondContact O-N 3.46Å; S47-Q51 VanDerWaalsContact O-CB 3.27Å; S47-Q51 WeakPolarHBondContact O-CB 3.5Å; S47-Q51 PolarHBondContact O-N 3.07Å
48	I	71.7	Confident	74.6	Confident	60 Å²	60	95.7 Å²	95.7	31%	0.308	48%	0.482	S	S	.	.	H	α-helix	trans	-61	-48.6	174.1	-70.6	162.5	0	0	0	110.9	I34 S44 I45 N50 Q51 I52	I34-I48 HydrophobicContact CD1-CD1 3.84Å; I34-I48 HydrophobicContact CD1-CG1 3.61Å; I34-I48 HydrophobicContact CG2-CD1 4.09Å; I34-I48 HydrophobicContact CG2-CG1 4.26Å; S44-I48 WeakPolarHBondContact O-CB 3.43Å; S44-I48 WeakPolarHBondContact O-CD1 3.47Å; S44-I48 WeakPolarHBondContact O-CG1 3.27Å; S44-I48 PolarHBondContact O-N 3.5Å; I45-I48 PolarHBondContact O-N 3.01Å; I48-N50 PolarHBondContact O-N 3.03Å; I48-Q51 PolarHBondContact O-N 3.32Å; I48-I52 HydrophobicContact CG2-CD1 3.46Å; I48-I52 VanDerWaalsContact CG2-CD1 3.46Å; I48-I52 HydrophobicContact CG2-CG1 4.22Å; I48-I52 WeakPolarHBondContact O-CB 3.42Å; I48-I52 VanDerWaalsContact O-CG1 3.26Å; I48-I52 WeakPolarHBondContact O-CG1 3.22Å; I48-I52 PolarHBondContact O-N 2.9Å
49	Y	72.9	Confident	75.1	Confident	155 Å²	155	96 Å²	96	61%	0.608	48%	0.484	S	S	*	.	H	α-helix	trans	-62	-45.2	-178.8	-174.3	-101.6	0	0	0	111.6	I45 S46 I52 I53	I45-Y49 WeakPolarHBondContact O-CB 3.09Å; I45-Y49 PolarHBondContact O-N 3.49Å; S46-Y49 PolarHBondContact O-N 3.49Å; Y49-I52 PolarHBondContact O-N 3.4Å; Y49-I53 HydrophobicContact CD1-CD1 3.68Å; Y49-I53 HydrophobicContact CD2-CD1 3.86Å; Y49-I53 HydrophobicContact CE1-CD1 3.18Å; Y49-I53 HydrophobicContact CE2-CD1 3.38Å; Y49-I53 HydrophobicContact CG-CD1 4Å; Y49-I53 WeakPolarHBondContact O-CB 3.5Å; Y49-I53 PolarHBondContact O-N 3.45Å; Y49-I53 VanDerWaalsContact OH-CD1 3.31Å; Y49-I53 WeakPolarHBondContact OH-CD1 3.43Å
50	N	73.6	Confident	75.8	Confident	90 Å²	90	96.4 Å²	96.4	48%	0.481	47%	0.472	S	S	.	.	H	α-helix	trans	-62.3	-43.7	175	-74.7	-18.8	0	0	0	111.3	S46 I48 V54	S46-N50 WeakPolarHBondContact O-CB 3.45Å; S46-N50 VanDerWaalsContact O-CG 3.3Å; S46-N50 PolarHBondContact O-N 3.06Å; S46-N50 PolarHBondContact O-ND2 3.18Å; I48-N50 PolarHBondContact O-N 3.03Å; N50-V54 WeakPolarHBondContact O-CB 3.41Å; N50-V54 WeakPolarHBondContact O-CG2 3.38Å; N50-V54 PolarHBondContact O-N 3.27Å
51	Q	71.9	Confident	76.5	Confident	111 Å²	111	97.7 Å²	97.7	52%	0.519	48%	0.478	S	S	.	.	H	α-helix	trans	-67.4	-40.3	-179.5	-168.9	166.3	88.4	0	0	112.5	S47 I48 Q55	S47-Q51 VanDerWaalsContact O-CB 3.27Å; S47-Q51 WeakPolarHBondContact O-CB 3.5Å; S47-Q51 PolarHBondContact O-N 3.07Å; I48-Q51 PolarHBondContact O-N 3.32Å; Q51-Q55 WeakPolarHBondContact O-CB 3.31Å; Q51-Q55 PolarHBondContact O-N 3.48Å; Q51-Q55 VanDerWaalsContact O-N 3.14Å
52	I	73	Confident	77.3	Confident	85 Å²	85	97.3 Å²	97.3	44%	0.436	48%	0.476	S	S	.	.	H	α-helix	trans	-66.5	-43.1	177.8	-69.4	171.6	0	0	0	111.3	I48 Y49 Y56 M59	I48-I52 HydrophobicContact CG2-CD1 3.46Å; I48-I52 VanDerWaalsContact CG2-CD1 3.46Å; I48-I52 HydrophobicContact CG2-CG1 4.22Å; I48-I52 WeakPolarHBondContact O-CB 3.42Å; I48-I52 VanDerWaalsContact O-CG1 3.26Å; I48-I52 WeakPolarHBondContact O-CG1 3.22Å; I48-I52 PolarHBondContact O-N 2.9Å; Y49-I52 PolarHBondContact O-N 3.4Å; I52-Y56 PolarHBondContact O-N 3.05Å; I52-M59 HydrophobicContact CG1-CE 4.48Å
53	I	74.2	Confident	78	Confident	94 Å²	94	93.4 Å²	93.4	48%	0.482	46%	0.464	S	S	.	.	H	α-helix	trans	-76.7	-42.3	-177.9	-75	165.4	0	0	0	111.9	Y49 Q55	Y49-I53 HydrophobicContact CD1-CD1 3.68Å; Y49-I53 HydrophobicContact CD2-CD1 3.86Å; Y49-I53 HydrophobicContact CE1-CD1 3.18Å; Y49-I53 HydrophobicContact CE2-CD1 3.38Å; Y49-I53 HydrophobicContact CG-CD1 4Å; Y49-I53 WeakPolarHBondContact O-CB 3.5Å; Y49-I53 PolarHBondContact O-N 3.45Å; Y49-I53 VanDerWaalsContact OH-CD1 3.31Å; Y49-I53 WeakPolarHBondContact OH-CD1 3.43Å; I53-Q55 VanDerWaalsContact C-N 3.31Å; I53-Q55 PolarHBondContact O-N 2.9Å
54	V	71.4	Confident	78.9	Confident	117 Å²	117	91.2 Å²	91.2	71%	0.709	46%	0.462	S	S	*	.	H	α-helix	trans	-68.9	-32.8	-177.5	174.2	0	0	0	0	111.1	N50	N50-V54 WeakPolarHBondContact O-CB 3.41Å; N50-V54 WeakPolarHBondContact O-CG2 3.38Å; N50-V54 PolarHBondContact O-N 3.27Å
55	Q	75	Confident	79.7	Confident	83 Å²	83	93.5 Å²	93.5	39%	0.388	48%	0.476	S	S	.	.	T	Hydrogen-bonded Turn	trans	-115.6	30.8	-175.2	-57.8	-167.5	-80.9	0	0	113.9	Q51 I53 N57 D58 M59	Q51-Q55 WeakPolarHBondContact O-CB 3.31Å; Q51-Q55 PolarHBondContact O-N 3.48Å; Q51-Q55 VanDerWaalsContact O-N 3.14Å; I53-Q55 VanDerWaalsContact C-N 3.31Å; I53-Q55 PolarHBondContact O-N 2.9Å; Q55-N57 PolarHBondContact O-N 2.82Å; Q55-D58 HydrophobicContact CB-CB 4.19Å; Q55-D58 PolarHBondContact NE2-OD2 3.1Å; Q55-D58 WeakPolarHBondContact O-CB 3.28Å; Q55-D58 PolarHBondContact O-N 3.16Å; Q55-M59 WeakPolarHBondContact O-CG 3.39Å; Q55-M59 PolarHBondContact O-N 3.24Å; Q55-M59 VanDerWaalsContact O-N 3.07Å
56	Y	79.9	Confident	80.3	Confident	147 Å²	147	90.6 Å²	90.6	58%	0.576	47%	0.466	S	S	*	.	H	α-helix	trans	-55.3	-36.1	179.3	-179.9	-105.9	0	0	0	113.3	I52 D58 M59 I60	I52-Y56 PolarHBondContact O-N 3.05Å; Y56-D58 PolarHBondContact O-N 3.31Å; Y56-M59 WeakPolarHBondContact O-CB 3.3Å; Y56-M59 PolarHBondContact O-N 2.88Å; Y56-I60 HydrophobicContact CD1-CD1 3.71Å; Y56-I60 HydrophobicContact CD1-CG1 4.44Å; Y56-I60 HydrophobicContact CE1-CD1 3.14Å; Y56-I60 HydrophobicContact CE1-CG1 3.98Å; Y56-I60 HydrophobicContact CE2-CD1 4.43Å; Y56-I60 HydrophobicContact CE2-CG1 4.44Å; Y56-I60 PolarHBondContact O-N 3.41Å
57	N	83.8	Confident	81	Confident	116 Å²	116	90.9 Å²	90.9	62%	0.62	47%	0.465	S	S	*	.	H	α-helix	trans	-63.5	-41.1	175.9	-75.2	-14.3	0	0	0	112.3	Q55 M59 I60 Q61	Q55-N57 PolarHBondContact O-N 2.82Å; N57-M59 VanDerWaalsContact C-N 3.28Å; N57-M59 PolarHBondContact O-N 3.35Å; N57-I60 PolarHBondContact O-N 3.43Å; N57-Q61 WeakPolarHBondContact O-CG 3.47Å; N57-Q61 PolarHBondContact O-N 3.4Å
58	D	84.8	Confident	81.8	Confident	70 Å²	70	93.4 Å²	93.4	37%	0.374	47%	0.474	S	S	.	.	H	α-helix	trans	-66.2	-36.3	177.6	-56.9	-24.2	0	0	0	110.2	Q55 Y56 I60 Q61 I62	Q55-D58 HydrophobicContact CB-CB 4.19Å; Q55-D58 PolarHBondContact NE2-OD2 3.1Å; Q55-D58 WeakPolarHBondContact O-CB 3.28Å; Q55-D58 PolarHBondContact O-N 3.16Å; Y56-D58 PolarHBondContact O-N 3.31Å; D58-I60 PolarHBondContact O-N 3.28Å; D58-Q61 WeakPolarHBondContact O-CB 3.32Å; D58-Q61 PolarHBondContact O-N 3.5Å; D58-I62 PolarHBondContact O-N 3.44Å
59	M	84.8	Confident	82.5	Confident	71 Å²	71	97.5 Å²	97.5	35%	0.35	49%	0.487	S	S	.	.	H	α-helix	trans	-61.5	-42.3	174.1	-63.6	-70.3	174.4	0	0	112.2	I52 Q55 Y56 N57 Q61 I62 L63	I52-M59 HydrophobicContact CG1-CE 4.48Å; Q55-M59 WeakPolarHBondContact O-CG 3.39Å; Q55-M59 PolarHBondContact O-N 3.24Å; Q55-M59 VanDerWaalsContact O-N 3.07Å; Y56-M59 WeakPolarHBondContact O-CB 3.3Å; Y56-M59 PolarHBondContact O-N 2.88Å; N57-M59 VanDerWaalsContact C-N 3.28Å; N57-M59 PolarHBondContact O-N 3.35Å; M59-Q61 VanDerWaalsContact C-N 3.35Å; M59-I62 WeakPolarHBondContact O-CG1 3.38Å; M59-I62 PolarHBondContact O-N 3.43Å; M59-I62 HydrophobicContact SD-CD1 4.02Å; M59-L63 WeakPolarHBondContact O-CB 3.02Å; M59-L63 PolarHBondContact O-N 3.34Å
60	I	87.9	Confident	83.2	Confident	65 Å²	65	93.5 Å²	93.5	33%	0.333	48%	0.475	S	S	.	.	H	α-helix	trans	-66	-39.9	174.8	-65.3	166	0	0	0	110.6	Y56 N57 D58 I62 L63 I64	Y56-I60 HydrophobicContact CD1-CD1 3.71Å; Y56-I60 HydrophobicContact CD1-CG1 4.44Å; Y56-I60 HydrophobicContact CE1-CD1 3.14Å; Y56-I60 HydrophobicContact CE1-CG1 3.98Å; Y56-I60 HydrophobicContact CE2-CD1 4.43Å; Y56-I60 HydrophobicContact CE2-CG1 4.44Å; Y56-I60 PolarHBondContact O-N 3.41Å; N57-I60 PolarHBondContact O-N 3.43Å; D58-I60 PolarHBondContact O-N 3.28Å; I60-I62 VanDerWaalsContact C-N 3.33Å; I60-I62 PolarHBondContact O-N 2.86Å; I60-L63 WeakPolarHBondContact O-CB 3.39Å; I60-L63 PolarHBondContact O-N 3.13Å; I60-L63 VanDerWaalsContact O-N 3.13Å; I60-I64 PolarHBondContact O-N 3.01Å
61	Q	89.1	Confident	84	Confident	130 Å²	130	92.7 Å²	92.7	61%	0.607	47%	0.473	S	S	*	.	H	α-helix	trans	-61.7	-38.9	179	-72.8	-179.6	3.4	0	0	112.5	N57 D58 M59 P65	N57-Q61 WeakPolarHBondContact O-CG 3.47Å; N57-Q61 PolarHBondContact O-N 3.4Å; D58-Q61 WeakPolarHBondContact O-CB 3.32Å; D58-Q61 PolarHBondContact O-N 3.5Å; M59-Q61 VanDerWaalsContact C-N 3.35Å; Q61-P65 WeakPolarHBondContact O-CD 3.35Å
62	I	88.4	Confident	84.6	Confident	100 Å²	100	90.9 Å²	90.9	51%	0.513	47%	0.465	S	S	.	.	H	α-helix	trans	-77.9	-20.1	175.2	65	173.7	0	0	0	113.3	D58 M59 I60 P65 S66	D58-I62 PolarHBondContact O-N 3.44Å; M59-I62 WeakPolarHBondContact O-CG1 3.38Å; M59-I62 PolarHBondContact O-N 3.43Å; M59-I62 HydrophobicContact SD-CD1 4.02Å; I60-I62 VanDerWaalsContact C-N 3.33Å; I60-I62 PolarHBondContact O-N 2.86Å; I62-P65 WeakPolarHBondContact O-CD 3.43Å; I62-P65 VanDerWaalsContact O-CG 3.3Å; I62-P65 WeakPolarHBondContact O-CG 3.44Å; I62-S66 PolarHBondContact O-N 3.33Å; I62-S66 PolarHBondContact O-OG 2.8Å
63	L	88.9	Confident	85.2	Confident	101 Å²	101	88.9 Å²	88.9	53%	0.529	46%	0.455	S	S	.	.	H	α-helix	trans	-69.4	-36.5	176.7	-178.9	64	0	0	0	112	M59 I60 S66 T67	M59-L63 WeakPolarHBondContact O-CB 3.02Å; M59-L63 PolarHBondContact O-N 3.34Å; I60-L63 WeakPolarHBondContact O-CB 3.39Å; I60-L63 PolarHBondContact O-N 3.13Å; I60-L63 VanDerWaalsContact O-N 3.13Å; L63-S66 PolarHBondContact O-N 2.79Å; L63-T67 WeakPolarHBondContact O-CB 3.44Å; L63-T67 PolarHBondContact O-N 2.92Å; L63-T67 PolarHBondContact O-OG1 2.85Å
64	I	91.7	Very high	85.7	Confident	98 Å²	98	87.5 Å²	87.5	50%	0.503	45%	0.449	S	S	.	.	H	α-helix	trans	-56.6	-57.1	178.9	-62.3	161.1	0	0	0	111.9	I60 S66 T67 L68	I60-I64 PolarHBondContact O-N 3.01Å; I64-S66 VanDerWaalsContact C-N 3.32Å; I64-S66 PolarHBondContact O-N 3.06Å; I64-T67 PolarHBondContact O-N 3.35Å; I64-L68 HydrophobicContact CG2-CD1 4.1Å; I64-L68 WeakPolarHBondContact O-CG 3.23Å; I64-L68 PolarHBondContact O-N 3.41Å
65	P	88.1	Confident	86.4	Confident	57 Å²	57	87.4 Å²	87.4	37%	0.37	44%	0.444	S	S	.	.	H	α-helix	trans	-63	-39	178.4	23.8	-32.5	0	0	0	111.6	Q61 I62 T67 L68 Y69	Q61-P65 WeakPolarHBondContact O-CD 3.35Å; I62-P65 WeakPolarHBondContact O-CD 3.43Å; I62-P65 VanDerWaalsContact O-CG 3.3Å; I62-P65 WeakPolarHBondContact O-CG 3.44Å; P65-T67 PolarHBondContact O-N 3.29Å; P65-L68 PolarHBondContact O-N 3.14Å; P65-Y69 WeakPolarHBondContact O-CD2 3.35Å; P65-Y69 PolarHBondContact O-N 3.43Å
66	S	87.6	Confident	86.8	Confident	45 Å²	45	86.4 Å²	86.4	32%	0.315	44%	0.44	S	S	.	.	H	α-helix	trans	-59.9	-44.8	178.5	-56.8	0	0	0	0	112	I62 L63 I64 Y69 I70	I62-S66 PolarHBondContact O-N 3.33Å; I62-S66 PolarHBondContact O-OG 2.8Å; L63-S66 PolarHBondContact O-N 2.79Å; I64-S66 VanDerWaalsContact C-N 3.32Å; I64-S66 PolarHBondContact O-N 3.06Å; S66-Y69 WeakPolarHBondContact O-CB 3.08Å; S66-Y69 PolarHBondContact O-N 3.1Å; S66-I70 PolarHBondContact O-N 3.3Å; S66-I70 VanDerWaalsContact O-N 3.1Å
67	T	88.4	Confident	86.9	Confident	68 Å²	68	82.9 Å²	82.9	42%	0.417	43%	0.426	S	S	.	.	H	α-helix	trans	-65.6	-44.1	176.3	-54.7	0	0	0	0	111.4	L63 I64 P65 Y69 I70 V71	L63-T67 WeakPolarHBondContact O-CB 3.44Å; L63-T67 PolarHBondContact O-N 2.92Å; L63-T67 PolarHBondContact O-OG1 2.85Å; I64-T67 PolarHBondContact O-N 3.35Å; P65-T67 PolarHBondContact O-N 3.29Å; T67-Y69 VanDerWaalsContact C-N 3.25Å; T67-Y69 PolarHBondContact O-N 2.86Å; T67-I70 WeakPolarHBondContact O-CB 3.42Å; T67-I70 PolarHBondContact O-N 3.26Å; T67-I70 VanDerWaalsContact O-N 3.09Å; T67-V71 PolarHBondContact O-N 3Å
68	L	90.1	Very high	86.8	Confident	99 Å²	99	83.3 Å²	83.3	52%	0.518	42%	0.423	S	S	.	.	H	α-helix	trans	-60.6	-35.5	174.4	-73.8	171.1	0	0	0	111.9	I64 P65 V71 Q72	I64-L68 HydrophobicContact CG2-CD1 4.1Å; I64-L68 WeakPolarHBondContact O-CG 3.23Å; I64-L68 PolarHBondContact O-N 3.41Å; P65-L68 PolarHBondContact O-N 3.14Å; L68-V71 PolarHBondContact O-N 3.09Å; L68-Q72 WeakPolarHBondContact O-CB 3.31Å; L68-Q72 VanDerWaalsContact O-CG 3.23Å; L68-Q72 WeakPolarHBondContact O-CG 3.49Å; L68-Q72 PolarHBondContact O-N 2.82Å; L68-Q72 PolarHBondContact O-NE2 3.35Å
69	Y	87.5	Confident	86.7	Confident	145 Å²	145	81 Å²	81	57%	0.569	41%	0.414	S	S	*	.	H	α-helix	trans	-64.6	-39	173.3	-87	-69.3	0	0	0	112	P65 S66 T67 Q72 N73	P65-Y69 WeakPolarHBondContact O-CD2 3.35Å; P65-Y69 PolarHBondContact O-N 3.43Å; S66-Y69 WeakPolarHBondContact O-CB 3.08Å; S66-Y69 PolarHBondContact O-N 3.1Å; T67-Y69 VanDerWaalsContact C-N 3.25Å; T67-Y69 PolarHBondContact O-N 2.86Å; Y69-Q72 PolarHBondContact O-N 3.42Å; Y69-N73 VanDerWaalsContact O-CB 3.31Å; Y69-N73 WeakPolarHBondContact O-CB 3.46Å; Y69-N73 PolarHBondContact O-N 2.77Å; Y69-N73 PolarHBondContact O-ND2 3.17Å
70	I	87.7	Confident	86.5	Confident	72 Å²	72	80.4 Å²	80.4	37%	0.369	41%	0.411	S	S	.	.	H	α-helix	trans	-61.9	-46.8	174.6	-66.2	165.3	0	0	0	110.5	V19 S66 T67 N73 N74	V19-I70 HydrophobicContact CG1-CD1 4.39Å; V19-I70 HydrophobicContact CG1-CG1 3.75Å; S66-I70 PolarHBondContact O-N 3.3Å; S66-I70 VanDerWaalsContact O-N 3.1Å; T67-I70 WeakPolarHBondContact O-CB 3.42Å; T67-I70 PolarHBondContact O-N 3.26Å; T67-I70 VanDerWaalsContact O-N 3.09Å; I70-N73 WeakPolarHBondContact O-CB 3.26Å; I70-N73 PolarHBondContact O-N 3.04Å; I70-N74 PolarHBondContact O-N 3.06Å; I70-N74 PolarHBondContact O-ND2 3.33Å
71	V	88.9	Confident	86.1	Confident	73 Å²	73	80 Å²	80	44%	0.442	41%	0.414	S	S	.	.	H	α-helix	trans	-61.5	-46.8	177.3	175	0	0	0	0	110.7	T67 L68 N73 N74 L75	T67-V71 PolarHBondContact O-N 3Å; L68-V71 PolarHBondContact O-N 3.09Å; V71-N73 VanDerWaalsContact C-N 3.29Å; V71-N73 PolarHBondContact O-N 3.04Å; V71-N74 PolarHBondContact O-N 2.93Å; V71-N74 VanDerWaalsContact O-N 3.17Å; V71-L75 HydrophobicContact CG1-CD1 3.93Å; V71-L75 WeakPolarHBondContact O-CD1 2.81Å; V71-L75 PolarHBondContact O-N 3.38Å
72	Q	86.2	Confident	85.6	Confident	73 Å²	73	79.8 Å²	79.8	34%	0.341	41%	0.413	S	S	.	.	H	α-helix	trans	-57.8	-41.8	176.8	-78.5	-179.2	85.5	0	0	112.4	L68 Y69 L75 L76	L68-Q72 WeakPolarHBondContact O-CB 3.31Å; L68-Q72 VanDerWaalsContact O-CG 3.23Å; L68-Q72 WeakPolarHBondContact O-CG 3.49Å; L68-Q72 PolarHBondContact O-N 2.82Å; L68-Q72 PolarHBondContact O-NE2 3.35Å; Y69-Q72 PolarHBondContact O-N 3.42Å; Q72-L75 PolarHBondContact O-N 3.44Å; Q72-L76 VanDerWaalsContact O-CB 3.31Å; Q72-L76 WeakPolarHBondContact O-CB 3.47Å; Q72-L76 PolarHBondContact O-N 3.15Å
73	N	84.1	Confident	85.3	Confident	43 Å²	43	77.5 Å²	77.5	23%	0.23	40%	0.401	C	S	.	.	H	α-helix	trans	-63.2	-41.7	177.1	-88.7	-60.4	0	0	0	112	A15 V19 Y69 I70 V71 L76 Y77	A15-N73 HydrophobicContact CB-CB 3.55Å; A15-N73 VanDerWaalsContact CB-O 3.26Å; A15-N73 WeakPolarHBondContact CB-O 3.42Å; V19-N73 HydrophobicContact CG2-CB 4.35Å; V19-N73 WeakPolarHBondContact CG2-ND2 3.48Å; Y69-N73 VanDerWaalsContact O-CB 3.31Å; Y69-N73 WeakPolarHBondContact O-CB 3.46Å; Y69-N73 PolarHBondContact O-N 2.77Å; Y69-N73 PolarHBondContact O-ND2 3.17Å; I70-N73 WeakPolarHBondContact O-CB 3.26Å; I70-N73 PolarHBondContact O-N 3.04Å; V71-N73 VanDerWaalsContact C-N 3.29Å; V71-N73 PolarHBondContact O-N 3.04Å; N73-L76 WeakPolarHBondContact O-CB 3.31Å; N73-L76 PolarHBondContact O-N 3.43Å; N73-Y77 PolarHBondContact O-N 2.84Å
74	N	85.3	Confident	85	Confident	65 Å²	65	77.7 Å²	77.7	35%	0.348	40%	0.403	S	S	.	.	H	α-helix	trans	-68.4	-41.4	176.2	-78.3	-85.2	0	0	0	112.5	S16 I70 V71 L76 Y77 F78	S16-N74 PolarHBondContact OG-ND2 3.17Å; S16-N74 VanDerWaalsContact OG-ND2 3.1Å; S16-N74 PolarHBondContact OG-OD1 2.92Å; I70-N74 PolarHBondContact O-N 3.06Å; I70-N74 PolarHBondContact O-ND2 3.33Å; V71-N74 PolarHBondContact O-N 2.93Å; V71-N74 VanDerWaalsContact O-N 3.17Å; N74-L76 VanDerWaalsContact C-N 3.31Å; N74-L76 PolarHBondContact O-N 3.05Å; N74-Y77 WeakPolarHBondContact O-CB 3Å; N74-Y77 PolarHBondContact O-N 3.36Å; N74-F78 PolarHBondContact O-N 3.34Å
75	L	86.2	Confident	84.3	Confident	115 Å²	115	76 Å²	76	60%	0.602	40%	0.404	S	S	*	.	H	α-helix	trans	-64	-38.1	174.6	-95.7	65	0	0	0	111.8	V71 Q72 F78 A79	V71-L75 HydrophobicContact CG1-CD1 3.93Å; V71-L75 WeakPolarHBondContact O-CD1 2.81Å; V71-L75 PolarHBondContact O-N 3.38Å; Q72-L75 PolarHBondContact O-N 3.44Å; L75-F78 PolarHBondContact O-N 3.04Å; L75-A79 WeakPolarHBondContact O-CB 3.42Å; L75-A79 PolarHBondContact O-N 3.39Å
76	L	83.6	Confident	84	Confident	61 Å²	61	76 Å²	76	32%	0.319	40%	0.402	S	S	.	.	H	α-helix	trans	-60.8	-48.3	174.9	-168	87	0	0	0	110.4	Q72 N73 N74 F78 A79 I80 Y88	Q72-L76 VanDerWaalsContact O-CB 3.31Å; Q72-L76 WeakPolarHBondContact O-CB 3.47Å; Q72-L76 PolarHBondContact O-N 3.15Å; N73-L76 WeakPolarHBondContact O-CB 3.31Å; N73-L76 PolarHBondContact O-N 3.43Å; N74-L76 VanDerWaalsContact C-N 3.31Å; N74-L76 PolarHBondContact O-N 3.05Å; L76-F78 VanDerWaalsContact C-N 3.33Å; L76-F78 PolarHBondContact O-N 2.89Å; L76-A79 WeakPolarHBondContact O-CB 3.14Å; L76-A79 PolarHBondContact O-N 2.97Å; L76-I80 HydrophobicContact CD2-CD1 4.45Å; L76-I80 HydrophobicContact CG-CD1 4.32Å; L76-I80 WeakPolarHBondContact O-CG1 3.42Å; L76-I80 PolarHBondContact O-N 2.88Å; L76-Y88 HydrophobicContact CD1-CE2 3.67Å; L76-Y88 HydrophobicContact CG-CE2 4.15Å
77	Y	81.1	Confident	83.8	Confident	73 Å²	73	78.3 Å²	78.3	29%	0.286	41%	0.411	S	S	.	.	H	α-helix	trans	-57.7	-46.7	177	-179	-86.7	0	0	0	111.6	E11 L12 N73 N74 A79 I80 S81	E11-Y77 WeakPolarHBondContact O-CE2 3.37Å; E11-Y77 PolarHBondContact O-OH 3.03Å; L12-Y77 WeakPolarHBondContact CD2-OH 3.33Å; N73-Y77 PolarHBondContact O-N 2.84Å; N74-Y77 WeakPolarHBondContact O-CB 3Å; N74-Y77 PolarHBondContact O-N 3.36Å; Y77-A79 VanDerWaalsContact C-N 3.25Å; Y77-A79 PolarHBondContact O-N 3.49Å; Y77-I80 PolarHBondContact O-N 3.45Å; Y77-S81 PolarHBondContact O-N 3.32Å; Y77-S81 VanDerWaalsContact O-N 3.15Å; Y77-S81 PolarHBondContact O-OG 2.99Å
78	F	82.6	Confident	83.6	Confident	125 Å²	125	77.8 Å²	77.8	55%	0.548	40%	0.401	S	S	.	.	H	α-helix	trans	-60.2	-36.1	174.5	-179	-92.7	0	0	0	112.5	N74 L75 L76 S81 H82	N74-F78 PolarHBondContact O-N 3.34Å; L75-F78 PolarHBondContact O-N 3.04Å; L76-F78 VanDerWaalsContact C-N 3.33Å; L76-F78 PolarHBondContact O-N 2.89Å; F78-S81 PolarHBondContact O-OG 2.95Å; F78-S81 VanDerWaalsContact O-OG 3.04Å; F78-H82 AromaticContact CD2-CE1 3.44Å; F78-H82 VanDerWaalsContact CD2-CE1 3.44Å; F78-H82 WeakPolarHBondContact CD2-CE1 3.42Å; F78-H82 AromaticContact CD2-ND1 3.55Å; F78-H82 AromaticContact CE1-ND1 3.9Å; F78-H82 AromaticContact CE2-CE1 3.11Å; F78-H82 WeakPolarHBondContact CE2-CE1 3.39Å; F78-H82 AromaticContact CE2-ND1 3.42Å; F78-H82 WeakPolarHBondContact CE2-ND1 3.11Å; F78-H82 AromaticContact CE2-NE2 3.85Å; F78-H82 AromaticContact CG-ND1 3.85Å; F78-H82 AromaticContact CZ-CE1 3.63Å; F78-H82 AromaticContact CZ-ND1 3.6Å; F78-H82 PolarHBondContact O-N 3.44Å; F78-H82 PolarHBondContact O-ND1 3.12Å
79	A	83.3	Confident	83.1	Confident	21 Å²	21	75 Å²	75	17%	0.174	39%	0.386	C	S	.	.	H	α-helix	trans	-69	-44.8	179.3	0	0	0	0	0	111.8	L75 L76 Y77 S81 H82 L83	L75-A79 WeakPolarHBondContact O-CB 3.42Å; L75-A79 PolarHBondContact O-N 3.39Å; L76-A79 WeakPolarHBondContact O-CB 3.14Å; L76-A79 PolarHBondContact O-N 2.97Å; Y77-A79 VanDerWaalsContact C-N 3.25Å; Y77-A79 PolarHBondContact O-N 3.49Å; A79-S81 VanDerWaalsContact C-N 3.31Å; A79-S81 PolarHBondContact O-N 3.26Å; A79-H82 PolarHBondContact O-N 3.31Å; A79-L83 HydrophobicContact CB-CD1 4.19Å; A79-L83 WeakPolarHBondContact O-CA 3.42Å; A79-L83 WeakPolarHBondContact O-CB 3.26Å; A79-L83 VanDerWaalsContact O-CD1 3.23Å; A79-L83 WeakPolarHBondContact O-CD1 3.41Å; A79-L83 PolarHBondContact O-N 3.48Å
80	I	79.4	Confident	82.8	Confident	59 Å²	59	73 Å²	73	30%	0.303	38%	0.384	S	S	.	.	H	α-helix	trans	-65.4	-38.4	-179.9	-52.9	166.4	0	0	0	110.3	E11 L76 Y77 H82 Y88	E11-I80 VanDerWaalsContact CD-CG2 3.42Å; E11-I80 WeakPolarHBondContact OE1-CG2 3.4Å; E11-I80 VanDerWaalsContact OE2-C 3.24Å; E11-I80 WeakPolarHBondContact OE2-CB 3.41Å; E11-I80 WeakPolarHBondContact OE2-CG2 3.44Å; L76-I80 HydrophobicContact CD2-CD1 4.45Å; L76-I80 HydrophobicContact CG-CD1 4.32Å; L76-I80 WeakPolarHBondContact O-CG1 3.42Å; L76-I80 PolarHBondContact O-N 2.88Å; Y77-I80 PolarHBondContact O-N 3.45Å; I80-H82 VanDerWaalsContact C-N 3.29Å; I80-H82 PolarHBondContact O-N 3.04Å; I80-Y88 HydrophobicContact CD1-CE2 4.13Å; I80-Y88 HydrophobicContact CG1-CD2 3.8Å; I80-Y88 HydrophobicContact CG1-CE2 3.61Å
81	S	79.1	Confident	82.8	Confident	56 Å²	56	73.8 Å²	73.8	39%	0.392	39%	0.389	S	S	.	.	H	α-helix	trans	-69.4	-22.8	-179.8	72.9	0	0	0	0	114.4	E11 Y77 F78 A79	E11-S81 PolarHBondContact OE2-N 2.85Å; Y77-S81 PolarHBondContact O-N 3.32Å; Y77-S81 VanDerWaalsContact O-N 3.15Å; Y77-S81 PolarHBondContact O-OG 2.99Å; F78-S81 PolarHBondContact O-OG 2.95Å; F78-S81 VanDerWaalsContact O-OG 3.04Å; A79-S81 VanDerWaalsContact C-N 3.31Å; A79-S81 PolarHBondContact O-N 3.26Å
82	H	80	Confident	82.5	Confident	126 Å²	126	75.6 Å²	75.6	58%	0.583	39%	0.388	S	S	*	.	H	α-helix	trans	-112.8	-21.9	-177.4	-65.4	91	0	0	0	114	F78 A79 I80	F78-H82 AromaticContact CD2-CE1 3.44Å; F78-H82 VanDerWaalsContact CD2-CE1 3.44Å; F78-H82 WeakPolarHBondContact CD2-CE1 3.42Å; F78-H82 AromaticContact CD2-ND1 3.55Å; F78-H82 AromaticContact CE1-ND1 3.9Å; F78-H82 AromaticContact CE2-CE1 3.11Å; F78-H82 WeakPolarHBondContact CE2-CE1 3.39Å; F78-H82 AromaticContact CE2-ND1 3.42Å; F78-H82 WeakPolarHBondContact CE2-ND1 3.11Å; F78-H82 AromaticContact CE2-NE2 3.85Å; F78-H82 AromaticContact CG-ND1 3.85Å; F78-H82 AromaticContact CZ-CE1 3.63Å; F78-H82 AromaticContact CZ-ND1 3.6Å; F78-H82 PolarHBondContact O-N 3.44Å; F78-H82 PolarHBondContact O-ND1 3.12Å; A79-H82 PolarHBondContact O-N 3.31Å; I80-H82 VanDerWaalsContact C-N 3.29Å; I80-H82 PolarHBondContact O-N 3.04Å
83	L	81.2	Confident	82.3	Confident	52 Å²	52	73 Å²	73	27%	0.272	38%	0.376	S	S	.	.	S	Bend	trans	-105.9	137.6	-177.1	-73.2	77.4	0	0	0	110.7	A79 L87 L91	A79-L83 HydrophobicContact CB-CD1 4.19Å; A79-L83 WeakPolarHBondContact O-CA 3.42Å; A79-L83 WeakPolarHBondContact O-CB 3.26Å; A79-L83 VanDerWaalsContact O-CD1 3.23Å; A79-L83 WeakPolarHBondContact O-CD1 3.41Å; A79-L83 PolarHBondContact O-N 3.48Å; L83-L87 HydrophobicContact CB-CB 4.3Å; L83-L87 HydrophobicContact CD2-CB 4.03Å; L83-L91 HydrophobicContact CD2-CD1 3.24Å
84	N	82.2	Confident	82.2	Confident	106 Å²	106	73.5 Å²	73.5	57%	0.567	38%	0.383	S	S	*	.			trans	-58.3	142.6	167.5	-178.3	-30.8	0	0	0	109.9	V86 L87 Y88	N84-V86 PolarHBondContact O-N 2.75Å; N84-V86 PolarHBondContact OD1-N 3.01Å; N84-V86 VanDerWaalsContact OD1-N 3.1Å; N84-L87 PolarHBondContact O-N 3.29Å; N84-Y88 PolarHBondContact O-N 2.77Å; N84-Y88 VanDerWaalsContact O-N 3.13Å
85	A	78.3	Confident	82.2	Confident	62 Å²	62	74.8 Å²	74.8	51%	0.512	39%	0.385	S	S	.	.	H	α-helix	trans	-42.3	-35.9	174.5	0	0	0	0	0	114.4	Q89	A85-Q89 PolarHBondContact O-N 3.33Å; A85-Q89 VanDerWaalsContact O-N 3.07Å
86	V	80.9	Confident	82	Confident	56 Å²	56	72.9 Å²	72.9	34%	0.339	38%	0.375	S	S	.	.	H	α-helix	trans	-61.8	-49.1	175.9	-179.9	0	0	0	0	112.1	N84 Y88 Q89 I90 H134	N84-V86 PolarHBondContact O-N 2.75Å; N84-V86 PolarHBondContact OD1-N 3.01Å; N84-V86 VanDerWaalsContact OD1-N 3.1Å; V86-Y88 VanDerWaalsContact C-N 3.34Å; V86-Q89 PolarHBondContact O-N 3.49Å; V86-I90 HydrophobicContact CG1-CD1 4.04Å; V86-I90 WeakPolarHBondContact O-CG1 3.37Å; V86-I90 PolarHBondContact O-N 3Å; V86-H134 WeakPolarHBondContact CG2-CE1 3.34Å; V86-H134 VanDerWaalsContact CG2-NE2 3.34Å; V86-H134 WeakPolarHBondContact CG2-NE2 3.31Å
87	L	84.4	Confident	82	Confident	94 Å²	94	74.6 Å²	74.6	49%	0.492	38%	0.38	S	S	.	.	H	α-helix	trans	-68.1	-38.2	-178.9	-66.8	175.7	0	0	0	111	L83 N84 Q89 I90 L91	L83-L87 HydrophobicContact CB-CB 4.3Å; L83-L87 HydrophobicContact CD2-CB 4.03Å; N84-L87 PolarHBondContact O-N 3.29Å; L87-Q89 VanDerWaalsContact C-N 3.3Å; L87-Q89 PolarHBondContact O-N 2.92Å; L87-I90 PolarHBondContact O-N 3.23Å; L87-L91 WeakPolarHBondContact O-CB 3.44Å; L87-L91 WeakPolarHBondContact O-CG 3.48Å; L87-L91 PolarHBondContact O-N 2.88Å
88	Y	82.7	Confident	82.2	Confident	57 Å²	57	74 Å²	74	22%	0.224	38%	0.384	C	S	.	.	H	α-helix	trans	-55.9	-46.2	173.6	176.3	-95.1	0	0	0	111.5	L76 I80 N84 V86 I90 L91 Y92	L76-Y88 HydrophobicContact CD1-CE2 3.67Å; L76-Y88 HydrophobicContact CG-CE2 4.15Å; I80-Y88 HydrophobicContact CD1-CE2 4.13Å; I80-Y88 HydrophobicContact CG1-CD2 3.8Å; I80-Y88 HydrophobicContact CG1-CE2 3.61Å; N84-Y88 PolarHBondContact O-N 2.77Å; N84-Y88 VanDerWaalsContact O-N 3.13Å; V86-Y88 VanDerWaalsContact C-N 3.34Å; Y88-I90 PolarHBondContact O-N 3.4Å; Y88-L91 PolarHBondContact O-N 3.26Å; Y88-Y92 WeakPolarHBondContact O-CB 3.42Å; Y88-Y92 PolarHBondContact O-N 3.04Å
89	Q	80.7	Confident	82.4	Confident	40 Å²	40	71.9 Å²	71.9	19%	0.187	38%	0.381	C	S	.	.	H	α-helix	trans	-62.4	-43.6	179.9	-156.2	75.4	-35.3	0	0	112.7	A85 V86 L87 Y92 Q93 Q130	A85-Q89 PolarHBondContact O-N 3.33Å; A85-Q89 VanDerWaalsContact O-N 3.07Å; V86-Q89 PolarHBondContact O-N 3.49Å; L87-Q89 VanDerWaalsContact C-N 3.3Å; L87-Q89 PolarHBondContact O-N 2.92Å; Q89-Y92 PolarHBondContact O-N 2.88Å; Q89-Q93 WeakPolarHBondContact O-CG 3.41Å; Q89-Q93 PolarHBondContact O-N 3.44Å; Q89-Q93 VanDerWaalsContact O-N 3.15Å; Q89-Q130 HydrophobicContact CG-CB 3.81Å; Q89-Q130 HydrophobicContact CG-CG 4.33Å; Q89-Q130 PolarHBondContact NE2-O 3.38Å; Q89-Q130 VanDerWaalsContact NE2-OE1 3.09Å
90	I	82.2	Confident	82.4	Confident	103 Å²	103	71.6 Å²	71.6	53%	0.528	38%	0.379	S	S	.	.	H	α-helix	trans	-64.4	-44.1	178.6	-64.9	165.8	0	0	0	110.2	V86 L87 Y88 Q93 S94	V86-I90 HydrophobicContact CG1-CD1 4.04Å; V86-I90 WeakPolarHBondContact O-CG1 3.37Å; V86-I90 PolarHBondContact O-N 3Å; L87-I90 PolarHBondContact O-N 3.23Å; Y88-I90 PolarHBondContact O-N 3.4Å; I90-Q93 PolarHBondContact O-N 3.46Å; I90-S94 PolarHBondContact O-N 2.77Å
91	L	86.1	Confident	82.6	Confident	90 Å²	90	71.9 Å²	71.9	47%	0.471	38%	0.38	S	S	.	.	H	α-helix	trans	-65.2	-37.1	177.5	-72.8	171.6	0	0	0	112.7	L83 L87 Y88 S94 K95	L83-L91 HydrophobicContact CD2-CD1 3.24Å; L87-L91 WeakPolarHBondContact O-CB 3.44Å; L87-L91 WeakPolarHBondContact O-CG 3.48Å; L87-L91 PolarHBondContact O-N 2.88Å; Y88-L91 PolarHBondContact O-N 3.26Å; L91-S94 WeakPolarHBondContact CA-OG 3.2Å; L91-S94 PolarHBondContact O-N 3.25Å; L91-S94 PolarHBondContact O-OG 3.46Å; L91-K95 WeakPolarHBondContact O-CB 3.17Å; L91-K95 PolarHBondContact O-N 2.96Å
92	Y	83.8	Confident	82.9	Confident	111 Å²	111	75.7 Å²	75.7	44%	0.435	39%	0.39	S	S	.	.	H	α-helix	trans	-64.4	-42.8	176.9	-168.6	-97.3	0	0	0	111.6	Y88 Q89 K95 I96	Y88-Y92 WeakPolarHBondContact O-CB 3.42Å; Y88-Y92 PolarHBondContact O-N 3.04Å; Q89-Y92 PolarHBondContact O-N 2.88Å; Y92-K95 WeakPolarHBondContact O-CB 3.44Å; Y92-K95 PolarHBondContact O-N 3.46Å; Y92-I96 PolarHBondContact O-N 2.87Å
93	Q	82	Confident	83.1	Confident	19 Å²	19	74.2 Å²	74.2	9%	0.089	38%	0.384	C	S	.	.	H	α-helix	trans	-68.9	-36.2	176.3	-65	-54.5	91.7	0	0	113.1	Q89 I90 K95 I96 F97 I126 I127 Q130	Q89-Q93 WeakPolarHBondContact O-CG 3.41Å; Q89-Q93 PolarHBondContact O-N 3.44Å; Q89-Q93 VanDerWaalsContact O-N 3.15Å; I90-Q93 PolarHBondContact O-N 3.46Å; Q93-K95 VanDerWaalsContact C-N 3.31Å; Q93-I96 WeakPolarHBondContact O-CG2 3.23Å; Q93-F97 PolarHBondContact O-N 3.45Å; Q93-I126 VanDerWaalsContact NE2-CG2 3.29Å; Q93-I127 HydrophobicContact CB-CG1 4.4Å; Q93-I127 HydrophobicContact CG-CG1 4.02Å; Q93-I127 VanDerWaalsContact NE2-N 3.15Å; Q93-Q130 VanDerWaalsContact CG-NE2 3.26Å
94	S	82	Confident	83.1	Confident	52 Å²	52	73.7 Å²	73.7	36%	0.364	38%	0.381	S	S	.	.	H	α-helix	trans	-68.1	-32.9	174	74.9	0	0	0	0	111.6	I90 L91 F97 T98	I90-S94 PolarHBondContact O-N 2.77Å; L91-S94 WeakPolarHBondContact CA-OG 3.2Å; L91-S94 PolarHBondContact O-N 3.25Å; L91-S94 PolarHBondContact O-OG 3.46Å; S94-F97 WeakPolarHBondContact O-CB 3.19Å; S94-F97 PolarHBondContact O-N 3.46Å; S94-T98 WeakPolarHBondContact O-CG2 3.45Å; S94-T98 PolarHBondContact O-N 3.12Å; S94-T98 PolarHBondContact O-OG1 3.41Å
95	K	84.2	Confident	83.1	Confident	93 Å²	93	74.9 Å²	74.9	40%	0.404	39%	0.387	S	S	.	.	H	α-helix	trans	-61.3	-44.4	177.8	-172.5	-178.2	179.7	-176.3	0	113.1	L91 Y92 Q93 F97 T98 T99	L91-K95 WeakPolarHBondContact O-CB 3.17Å; L91-K95 PolarHBondContact O-N 2.96Å; Y92-K95 WeakPolarHBondContact O-CB 3.44Å; Y92-K95 PolarHBondContact O-N 3.46Å; Q93-K95 VanDerWaalsContact C-N 3.31Å; K95-F97 VanDerWaalsContact C-N 3.31Å; K95-T98 WeakPolarHBondContact CA-OG1 3.18Å; K95-T98 PolarHBondContact O-OG1 3.17Å; K95-T99 WeakPolarHBondContact O-CB 3.27Å; K95-T99 PolarHBondContact O-N 3.2Å; K95-T99 PolarHBondContact O-OG1 2.87Å
96	I	83.3	Confident	83.2	Confident	74 Å²	74	79 Å²	79	38%	0.379	40%	0.4	S	S	.	.	H	α-helix	trans	-66.4	-38.2	177.1	-174.2	62.1	0	0	0	111	Y92 Q93 T99 A100	Y92-I96 PolarHBondContact O-N 2.87Å; Q93-I96 WeakPolarHBondContact O-CG2 3.23Å; I96-T99 PolarHBondContact O-N 3.39Å; I96-A100 PolarHBondContact O-N 3.44Å
97	F	82.8	Confident	83.1	Confident	98 Å²	98	81.7 Å²	81.7	43%	0.43	41%	0.411	S	S	.	.	H	α-helix	trans	-65.4	-45	177.5	-176.6	-98.4	0	0	0	112.3	Q93 S94 K95 A100 M101	Q93-F97 PolarHBondContact O-N 3.45Å; S94-F97 WeakPolarHBondContact O-CB 3.19Å; S94-F97 PolarHBondContact O-N 3.46Å; K95-F97 VanDerWaalsContact C-N 3.31Å; F97-A100 PolarHBondContact O-N 3.45Å; F97-M101 HydrophobicContact CD1-CG 4.41Å; F97-M101 HydrophobicContact CE1-CE 4.27Å; F97-M101 HydrophobicContact CE1-CG 4.02Å; F97-M101 HydrophobicContact CE2-CE 4.15Å; F97-M101 HydrophobicContact CZ-CE 3.64Å; F97-M101 HydrophobicContact CZ-CG 4.26Å; F97-M101 PolarHBondContact O-N 2.92Å
98	T	85.7	Confident	82.3	Confident	61 Å²	61	82.9 Å²	82.9	37%	0.374	42%	0.418	S	S	.	.	H	α-helix	trans	-65.4	-40.1	177	53.8	0	0	0	0	111.2	S94 K95 A100 M101 F102	S94-T98 WeakPolarHBondContact O-CG2 3.45Å; S94-T98 PolarHBondContact O-N 3.12Å; S94-T98 PolarHBondContact O-OG1 3.41Å; K95-T98 WeakPolarHBondContact CA-OG1 3.18Å; K95-T98 PolarHBondContact O-OG1 3.17Å; T98-A100 VanDerWaalsContact C-N 3.3Å; T98-A100 PolarHBondContact O-N 2.83Å; T98-M101 PolarHBondContact O-N 2.9Å; T98-M101 VanDerWaalsContact O-N 3.15Å; T98-F102 WeakPolarHBondContact O-CB 3.35Å; T98-F102 WeakPolarHBondContact O-CD2 3.34Å; T98-F102 PolarHBondContact O-N 3.27Å
99	T	86	Confident	81.7	Confident	79 Å²	79	84.3 Å²	84.3	49%	0.485	43%	0.427	S	S	.	.	H	α-helix	trans	-58.8	-42.4	175.2	-54.1	0	0	0	0	111.5	K95 I96 F102 M103	K95-T99 WeakPolarHBondContact O-CB 3.27Å; K95-T99 PolarHBondContact O-N 3.2Å; K95-T99 PolarHBondContact O-OG1 2.87Å; I96-T99 PolarHBondContact O-N 3.39Å; T99-F102 PolarHBondContact O-N 2.96Å; T99-M103 WeakPolarHBondContact O-CB 3.42Å; T99-M103 PolarHBondContact O-N 3.23Å
100	A	83.5	Confident	80.9	Confident	16 Å²	16	90.4 Å²	90.4	13%	0.132	46%	0.455	C	S	.	.	H	α-helix	trans	-64.1	-42.8	175.1	0	0	0	0	0	112.2	I96 F97 T98 M103 I104 L119	I96-A100 PolarHBondContact O-N 3.44Å; F97-A100 PolarHBondContact O-N 3.45Å; T98-A100 VanDerWaalsContact C-N 3.3Å; T98-A100 PolarHBondContact O-N 2.83Å; A100-M103 PolarHBondContact O-N 3.41Å; A100-I104 WeakPolarHBondContact O-CG1 3.38Å; A100-I104 PolarHBondContact O-N 3.21Å; A100-L119 HydrophobicContact CB-CD1 3.87Å; A100-L119 HydrophobicContact CB-CD2 3.77Å; A100-L119 HydrophobicContact CB-CG 4.46Å
101	M	83.1	Confident	80	Confident	65 Å²	65	86.9 Å²	86.9	32%	0.32	44%	0.437	S	S	.	.	H	α-helix	trans	-63.4	-45.8	175.8	-78.2	-68.8	167.1	0	0	112.4	F97 T98 M103 I104 L105 W116	F97-M101 HydrophobicContact CD1-CG 4.41Å; F97-M101 HydrophobicContact CE1-CE 4.27Å; F97-M101 HydrophobicContact CE1-CG 4.02Å; F97-M101 HydrophobicContact CE2-CE 4.15Å; F97-M101 HydrophobicContact CZ-CE 3.64Å; F97-M101 HydrophobicContact CZ-CG 4.26Å; F97-M101 PolarHBondContact O-N 2.92Å; T98-M101 PolarHBondContact O-N 2.9Å; T98-M101 VanDerWaalsContact O-N 3.15Å; M101-M103 VanDerWaalsContact C-N 3.31Å; M101-M103 PolarHBondContact O-N 3.49Å; M101-I104 PolarHBondContact O-N 3.02Å; M101-L105 WeakPolarHBondContact O-CG 3.49Å; M101-L105 PolarHBondContact O-N 3.46Å; M101-W116 HydrophobicContact CE-CH2 3.68Å; M101-W116 HydrophobicContact CE-CZ2 4.27Å
102	F	85.6	Confident	79.2	Confident	136 Å²	136	91.5 Å²	91.5	60%	0.596	45%	0.448	S	S	*	.	H	α-helix	trans	-62.4	-37	175.9	-85.9	-72.7	0	0	0	112.1	T98 T99 L105 L106	T98-F102 WeakPolarHBondContact O-CB 3.35Å; T98-F102 WeakPolarHBondContact O-CD2 3.34Å; T98-F102 PolarHBondContact O-N 3.27Å; T99-F102 PolarHBondContact O-N 2.96Å; F102-L105 PolarHBondContact O-N 3.3Å; F102-L106 WeakPolarHBondContact O-CB 3.3Å; F102-L106 PolarHBondContact O-N 3.07Å
103	M	83.3	Confident	78.6	Confident	94 Å²	94	91 Å²	91	46%	0.463	46%	0.461	S	S	.	.	H	α-helix	trans	-61.4	-44	175.4	-175	-177.4	-176.3	0	0	111.9	T99 A100 M101 L107	T99-M103 WeakPolarHBondContact O-CB 3.42Å; T99-M103 PolarHBondContact O-N 3.23Å; A100-M103 PolarHBondContact O-N 3.41Å; M101-M103 VanDerWaalsContact C-N 3.31Å; M101-M103 PolarHBondContact O-N 3.49Å; M103-L107 VanDerWaalsContact O-CB 3.26Å; M103-L107 WeakPolarHBondContact O-CB 3.44Å; M103-L107 PolarHBondContact O-N 3.36Å; M103-L107 VanDerWaalsContact O-N 3.12Å
104	I	82.5	Confident	78.5	Confident	41 Å²	41	94 Å²	94	21%	0.21	48%	0.481	C	S	.	.	H	α-helix	trans	-66.8	-43.3	177.9	-63.1	166.1	0	0	0	110.6	A100 M101 N108 L111 W116	A100-I104 WeakPolarHBondContact O-CG1 3.38Å; A100-I104 PolarHBondContact O-N 3.21Å; M101-I104 PolarHBondContact O-N 3.02Å; I104-N108 WeakPolarHBondContact O-CA 3.39Å; I104-N108 PolarHBondContact O-N 2.68Å; I104-L111 HydrophobicContact CD1-CD1 4.07Å; I104-L111 HydrophobicContact CG1-CD1 3.81Å; I104-L111 HydrophobicContact CG1-CG 4.46Å; I104-W116 HydrophobicContact CD1-CZ2 3.65Å
105	L	82.7	Confident	78.3	Confident	132 Å²	132	95.6 Å²	95.6	69%	0.691	48%	0.483	S	S	*	.	H	α-helix	trans	-70.6	-46	-178	-70.6	170.8	0	0	0	113.2	M101 F102	M101-L105 WeakPolarHBondContact O-CG 3.49Å; M101-L105 PolarHBondContact O-N 3.46Å; F102-L105 PolarHBondContact O-N 3.3Å
106	L	80.1	Confident	78.1	Confident	149 Å²	149	95.6 Å²	95.6	78%	0.78	48%	0.48	S	S	*	.	H	α-helix	trans	-80.5	-46.1	-172.9	-168.3	159.6	0	0	0	111.8	F102 N108	F102-L106 WeakPolarHBondContact O-CB 3.3Å; F102-L106 PolarHBondContact O-N 3.07Å; L106-N108 VanDerWaalsContact C-N 3.27Å
107	L	77.7	Confident	78	Confident	111 Å²	111	98.6 Å²	98.6	58%	0.581	49%	0.491	S	S	*	.	H	α-helix	trans	-82.8	-10	-179.1	-160.9	60.1	0	0	0	112.1	M103 H109	M103-L107 VanDerWaalsContact O-CB 3.26Å; M103-L107 WeakPolarHBondContact O-CB 3.44Å; M103-L107 PolarHBondContact O-N 3.36Å; M103-L107 VanDerWaalsContact O-N 3.12Å; L107-H109 HydrophobicContact CB-CB 4.12Å; L107-H109 HydrophobicContact CD2-CB 3.99Å; L107-H109 HydrophobicContact CG-CB 3.99Å; L107-H109 PolarHBondContact O-N 2.95Å
108	N	68.1	Low	78.1	Confident	120 Å²	120	97.4 Å²	97.4	64%	0.642	49%	0.494	S	S	*	.			trans	46.6	27.3	-171.4	-140.7	-11.3	0	0	0	112.5	I104 L106 H110	I104-N108 WeakPolarHBondContact O-CA 3.39Å; I104-N108 PolarHBondContact O-N 2.68Å; L106-N108 VanDerWaalsContact C-N 3.27Å; N108-H110 PolarHBondContact O-N 3.47Å
109	H	70	Confident	77.9	Confident	87 Å²	87	97.2 Å²	97.2	40%	0.403	49%	0.491	S	S	.	.			trans	-81.6	107.6	-175.4	-175.4	-80.8	0	0	0	107.1	L107 L111	L107-H109 HydrophobicContact CB-CB 4.12Å; L107-H109 HydrophobicContact CD2-CB 3.99Å; L107-H109 HydrophobicContact CG-CB 3.99Å; L107-H109 PolarHBondContact O-N 2.95Å; H109-L111 VanDerWaalsContact C-N 3.3Å; H109-L111 PolarHBondContact O-N 2.95Å
110	H	63.3	Low	77.8	Confident	167 Å²	167	97.1 Å²	97.1	77%	0.773	49%	0.487	S	S	*	.			trans	-64.9	91.6	173.8	-73.6	-73.3	0	0	0	109.6	N108 R112	N108-H110 PolarHBondContact O-N 3.47Å; H110-R112 PolarHBondContact O-N 3.44Å
111	L	65.1	Low	78	Confident	30 Å²	30	101.4 Å²	101.4	16%	0.157	51%	0.507	C	S	.	.			trans	-60	124.2	169	-69.6	171.2	0	0	0	108.1	I104 H109 Q115	I104-L111 HydrophobicContact CD1-CD1 4.07Å; I104-L111 HydrophobicContact CG1-CD1 3.81Å; I104-L111 HydrophobicContact CG1-CG 4.46Å; H109-L111 VanDerWaalsContact C-N 3.3Å; H109-L111 PolarHBondContact O-N 2.95Å; L111-Q115 VanDerWaalsContact CA-OE1 3.27Å; L111-Q115 HydrophobicContact CB-CB 4.22Å; L111-Q115 HydrophobicContact CD2-CB 4.29Å; L111-Q115 VanDerWaalsContact CD2-OE1 3.25Å
112	R	68.7	Low	78	Confident	186 Å²	186	103.5 Å²	103.5	70%	0.702	52%	0.519	S	S	*	.			trans	-56.1	145	176.8	-155.2	174.3	-153.1	-114.1	2.8	108.5	H110 T114 Q115 W116	H110-R112 PolarHBondContact O-N 3.44Å; R112-T114 PolarHBondContact O-N 3.33Å; R112-Q115 HydrophobicContact CB-CG 4.4Å; R112-Q115 WeakPolarHBondContact O-CA 3.45Å; R112-Q115 WeakPolarHBondContact O-CB 3.45Å; R112-Q115 PolarHBondContact O-N 3.37Å; R112-W116 PolarHBondContact O-N 2.91Å
113	S	71.1	Confident	77.9	Confident	102 Å²	102	97.8 Å²	97.8	71%	0.713	50%	0.496	S	S	*	.	H	α-helix	trans	-53	-29.1	-178.3	-172.8	0	0	0	0	113.2	W116 F117	S113-W116 VanDerWaalsContact O-CB 3.28Å; S113-W116 WeakPolarHBondContact O-CB 3.18Å; S113-W116 PolarHBondContact O-N 3.06Å; S113-F117 PolarHBondContact O-N 3.29Å
114	T	79	Confident	78	Confident	81 Å²	81	96.7 Å²	96.7	50%	0.497	49%	0.494	S	S	.	.	H	α-helix	trans	-65.5	-35.7	172.1	53.8	0	0	0	0	114.2	R112 F117 S118	R112-T114 PolarHBondContact O-N 3.33Å; T114-F117 PolarHBondContact O-N 2.99Å; T114-S118 PolarHBondContact O-N 3.36Å; T114-S118 PolarHBondContact O-OG 3.18Å
115	Q	78.2	Confident	78.1	Confident	86 Å²	86	96.3 Å²	96.3	40%	0.402	50%	0.501	S	S	.	.	H	α-helix	trans	-71	-37	174.2	-66.6	173.8	-36.5	0	0	110.6	L111 R112 S118 L119	L111-Q115 VanDerWaalsContact CA-OE1 3.27Å; L111-Q115 HydrophobicContact CB-CB 4.22Å; L111-Q115 HydrophobicContact CD2-CB 4.29Å; L111-Q115 VanDerWaalsContact CD2-OE1 3.25Å; R112-Q115 HydrophobicContact CB-CG 4.4Å; R112-Q115 WeakPolarHBondContact O-CA 3.45Å; R112-Q115 WeakPolarHBondContact O-CB 3.45Å; R112-Q115 PolarHBondContact O-N 3.37Å; Q115-S118 WeakPolarHBondContact O-CB 3.37Å; Q115-S118 PolarHBondContact O-N 3.42Å; Q115-L119 WeakPolarHBondContact O-CB 3.17Å; Q115-L119 PolarHBondContact O-N 3.39Å
116	W	80.8	Confident	78.1	Confident	92 Å²	92	92.2 Å²	92.2	35%	0.348	48%	0.479	S	S	.	.	H	α-helix	trans	-57.6	-47.9	170.3	-103.6	91.8	0	0	0	111.9	M101 I104 R112 S113 S118 L119 L120	M101-W116 HydrophobicContact CE-CH2 3.68Å; M101-W116 HydrophobicContact CE-CZ2 4.27Å; I104-W116 HydrophobicContact CD1-CZ2 3.65Å; R112-W116 PolarHBondContact O-N 2.91Å; S113-W116 VanDerWaalsContact O-CB 3.28Å; S113-W116 WeakPolarHBondContact O-CB 3.18Å; S113-W116 PolarHBondContact O-N 3.06Å; W116-S118 VanDerWaalsContact C-N 3.32Å; W116-S118 PolarHBondContact O-N 2.94Å; W116-L119 PolarHBondContact O-N 2.97Å; W116-L120 HydrophobicContact CE3-CD1 4.01Å; W116-L120 HydrophobicContact CE3-CG 4.11Å; W116-L120 HydrophobicContact CZ3-CD1 4.45Å; W116-L120 HydrophobicContact CZ3-CD2 4.42Å; W116-L120 HydrophobicContact CZ3-CG 4.48Å; W116-L120 WeakPolarHBondContact O-CB 3.42Å; W116-L120 WeakPolarHBondContact O-CG 3.2Å; W116-L120 PolarHBondContact O-N 3.26Å
117	F	80.8	Confident	78.2	Confident	138 Å²	138	88.7 Å²	88.7	61%	0.605	46%	0.46	S	S	*	.	H	α-helix	trans	-60.4	-43.6	175.9	-173.9	-99.8	0	0	0	111.7	S113 T114 L119 L120 L121	S113-F117 PolarHBondContact O-N 3.29Å; T114-F117 PolarHBondContact O-N 2.99Å; F117-L119 VanDerWaalsContact C-N 3.3Å; F117-L119 PolarHBondContact O-N 3.18Å; F117-L120 PolarHBondContact O-N 3.38Å; F117-L121 HydrophobicContact CE1-CD2 4.28Å; F117-L121 WeakPolarHBondContact O-CB 3.25Å; F117-L121 PolarHBondContact O-N 3.43Å
118	S	84.5	Confident	78.6	Confident	72 Å²	72	89 Å²	89	50%	0.503	46%	0.462	S	S	.	.	H	α-helix	trans	-60.6	-41.1	177.1	-55.7	0	0	0	0	111.8	T114 Q115 W116 L121 L122	T114-S118 PolarHBondContact O-N 3.36Å; T114-S118 PolarHBondContact O-OG 3.18Å; Q115-S118 WeakPolarHBondContact O-CB 3.37Å; Q115-S118 PolarHBondContact O-N 3.42Å; W116-S118 VanDerWaalsContact C-N 3.32Å; W116-S118 PolarHBondContact O-N 2.94Å; S118-L121 PolarHBondContact O-N 3.15Å; S118-L122 VanDerWaalsContact O-CB 3.27Å; S118-L122 WeakPolarHBondContact O-CB 3.33Å; S118-L122 PolarHBondContact O-N 2.99Å
119	L	82.5	Confident	79.2	Confident	58 Å²	58	86.9 Å²	86.9	30%	0.304	45%	0.453	S	S	.	.	H	α-helix	trans	-71.5	-41.8	-179.4	-160.8	149.7	0	0	0	111.8	A100 Q115 W116 F117 L122 S123	A100-L119 HydrophobicContact CB-CD1 3.87Å; A100-L119 HydrophobicContact CB-CD2 3.77Å; A100-L119 HydrophobicContact CB-CG 4.46Å; Q115-L119 WeakPolarHBondContact O-CB 3.17Å; Q115-L119 PolarHBondContact O-N 3.39Å; W116-L119 PolarHBondContact O-N 2.97Å; F117-L119 VanDerWaalsContact C-N 3.3Å; F117-L119 PolarHBondContact O-N 3.18Å; L119-L122 PolarHBondContact O-N 3.48Å; L119-S123 VanDerWaalsContact O-CB 3.3Å; L119-S123 WeakPolarHBondContact O-CB 3.15Å; L119-S123 PolarHBondContact O-N 3.02Å
120	L	83.5	Confident	79.7	Confident	77 Å²	77	83.9 Å²	83.9	40%	0.403	44%	0.439	S	S	.	.	H	α-helix	trans	-63.9	-42.6	173	-73.5	175.1	0	0	0	111.6	W116 F117 S123 T124	W116-L120 HydrophobicContact CE3-CD1 4.01Å; W116-L120 HydrophobicContact CE3-CG 4.11Å; W116-L120 HydrophobicContact CZ3-CD1 4.45Å; W116-L120 HydrophobicContact CZ3-CD2 4.42Å; W116-L120 HydrophobicContact CZ3-CG 4.48Å; W116-L120 WeakPolarHBondContact O-CB 3.42Å; W116-L120 WeakPolarHBondContact O-CG 3.2Å; W116-L120 PolarHBondContact O-N 3.26Å; F117-L120 PolarHBondContact O-N 3.38Å; L120-S123 PolarHBondContact O-N 3.24Å; L120-T124 VanDerWaalsContact O-CB 3.29Å; L120-T124 WeakPolarHBondContact O-CB 3.29Å; L120-T124 PolarHBondContact O-N 2.98Å; L120-T124 PolarHBondContact O-OG1 3.01Å
121	L	86.8	Confident	80.3	Confident	105 Å²	105	79.4 Å²	79.4	55%	0.55	42%	0.424	S	S	.	.	H	α-helix	trans	-62.5	-44.9	177.2	-173.9	69.2	0	0	0	110.9	F117 S118 T124 G125	F117-L121 HydrophobicContact CE1-CD2 4.28Å; F117-L121 WeakPolarHBondContact O-CB 3.25Å; F117-L121 PolarHBondContact O-N 3.43Å; S118-L121 PolarHBondContact O-N 3.15Å; L121-T124 PolarHBondContact O-N 3.4Å; L121-G125 PolarHBondContact O-N 3.5Å
122	L	83.9	Confident	81.1	Confident	109 Å²	109	81.4 Å²	81.4	57%	0.571	44%	0.44	S	S	*	.	H	α-helix	trans	-63.5	-48.4	177.2	-158.6	167.3	0	0	0	110.7	S118 L119 T124 G125 I126	S118-L122 VanDerWaalsContact O-CB 3.27Å; S118-L122 WeakPolarHBondContact O-CB 3.33Å; S118-L122 PolarHBondContact O-N 2.99Å; L119-L122 PolarHBondContact O-N 3.48Å; L122-T124 PolarHBondContact O-N 3.06Å; L122-G125 PolarHBondContact O-N 3.39Å; L122-I126 HydrophobicContact CD2-CD1 3.37Å; L122-I126 HydrophobicContact CD2-CG1 3.96Å; L122-I126 WeakPolarHBondContact O-CG1 3.45Å; L122-I126 PolarHBondContact O-N 2.99Å
123	S	83.1	Confident	81.5	Confident	16 Å²	16	78.1 Å²	78.1	11%	0.112	43%	0.433	C	S	.	.	H	α-helix	trans	-57.9	-48.5	176.3	-176.6	0	0	0	0	111.7	L119 L120 G125 I126 I127	L119-S123 VanDerWaalsContact O-CB 3.3Å; L119-S123 WeakPolarHBondContact O-CB 3.15Å; L119-S123 PolarHBondContact O-N 3.02Å; L120-S123 PolarHBondContact O-N 3.24Å; S123-G125 VanDerWaalsContact C-N 3.32Å; S123-G125 PolarHBondContact O-N 3.44Å; S123-I126 PolarHBondContact O-N 3.35Å; S123-I127 WeakPolarHBondContact O-CG1 3.41Å; S123-I127 PolarHBondContact O-N 3.46Å
124	T	85.4	Confident	81.7	Confident	71 Å²	71	75.9 Å²	75.9	44%	0.436	41%	0.411	S	S	.	.	H	α-helix	trans	-59.7	-43	176.8	-55.7	0	0	0	0	111.3	L120 L121 L122 I126 I127 L128	L120-T124 VanDerWaalsContact O-CB 3.29Å; L120-T124 WeakPolarHBondContact O-CB 3.29Å; L120-T124 PolarHBondContact O-N 2.98Å; L120-T124 PolarHBondContact O-OG1 3.01Å; L121-T124 PolarHBondContact O-N 3.4Å; L122-T124 PolarHBondContact O-N 3.06Å; T124-I126 PolarHBondContact O-N 3.03Å; T124-I127 PolarHBondContact O-N 3.49Å; T124-L128 HydrophobicContact CG2-CD1 4.08Å; T124-L128 HydrophobicContact CG2-CG 4.4Å; T124-L128 WeakPolarHBondContact O-CG 3.5Å; T124-L128 PolarHBondContact O-N 3.18Å
125	G	85.1	Confident	81.5	Confident	33 Å²	33	80.7 Å²	80.7	34%	0.34	42%	0.42	S	S	.	.	H	α-helix	trans	-57.7	-45.8	175.2	0	0	0	0	0	112.3	L121 L122 S123 L128 T129	L121-G125 PolarHBondContact O-N 3.5Å; L122-G125 PolarHBondContact O-N 3.39Å; S123-G125 VanDerWaalsContact C-N 3.32Å; S123-G125 PolarHBondContact O-N 3.44Å; G125-L128 PolarHBondContact O-N 2.81Å; G125-T129 WeakPolarHBondContact O-CG2 3.48Å; G125-T129 PolarHBondContact O-N 3.43Å; G125-T129 VanDerWaalsContact O-N 3.12Å; G125-T129 PolarHBondContact O-OG1 3.5Å
126	I	82.9	Confident	81.5	Confident	46 Å²	46	78.7 Å²	78.7	24%	0.236	42%	0.418	C	S	.	.	H	α-helix	trans	-65	-43.6	175.7	-57.5	164.4	0	0	0	110.5	Q93 L122 S123 T124 L128 T129 Q130	Q93-I126 VanDerWaalsContact NE2-CG2 3.29Å; L122-I126 HydrophobicContact CD2-CD1 3.37Å; L122-I126 HydrophobicContact CD2-CG1 3.96Å; L122-I126 WeakPolarHBondContact O-CG1 3.45Å; L122-I126 PolarHBondContact O-N 2.99Å; S123-I126 PolarHBondContact O-N 3.35Å; T124-I126 PolarHBondContact O-N 3.03Å; I126-L128 VanDerWaalsContact C-N 3.32Å; I126-L128 PolarHBondContact O-N 3.04Å; I126-T129 PolarHBondContact O-N 3.44Å; I126-T129 PolarHBondContact O-OG1 3.15Å; I126-Q130 HydrophobicContact CG2-CG 4.03Å; I126-Q130 WeakPolarHBondContact O-CB 3.38Å; I126-Q130 WeakPolarHBondContact O-CG 3.21Å; I126-Q130 PolarHBondContact O-N 3.44Å
127	I	82.3	Confident	81.1	Confident	76 Å²	76	78.2 Å²	78.2	39%	0.39	43%	0.425	S	S	.	.	H	α-helix	trans	-59.4	-45.8	179.3	-62.8	171	0	0	0	110.4	Q93 S123 T124 Q130 V131	Q93-I127 HydrophobicContact CB-CG1 4.4Å; Q93-I127 HydrophobicContact CG-CG1 4.02Å; Q93-I127 VanDerWaalsContact NE2-N 3.15Å; S123-I127 WeakPolarHBondContact O-CG1 3.41Å; S123-I127 PolarHBondContact O-N 3.46Å; T124-I127 PolarHBondContact O-N 3.49Å; I127-Q130 PolarHBondContact O-N 3.15Å; I127-V131 HydrophobicContact CG2-CG2 4.34Å; I127-V131 WeakPolarHBondContact O-CG2 3.42Å; I127-V131 PolarHBondContact O-N 3.25Å
128	L	84.6	Confident	80.8	Confident	118 Å²	118	74.4 Å²	74.4	62%	0.618	41%	0.411	S	S	*	.	H	α-helix	trans	-62.6	-46.6	-178.7	-74.8	172.2	0	0	0	112.3	T124 G125 I126 Q130 V131 S132	T124-L128 HydrophobicContact CG2-CD1 4.08Å; T124-L128 HydrophobicContact CG2-CG 4.4Å; T124-L128 WeakPolarHBondContact O-CG 3.5Å; T124-L128 PolarHBondContact O-N 3.18Å; G125-L128 PolarHBondContact O-N 2.81Å; I126-L128 VanDerWaalsContact C-N 3.32Å; I126-L128 PolarHBondContact O-N 3.04Å; L128-Q130 VanDerWaalsContact C-N 3.29Å; L128-Q130 PolarHBondContact O-N 3.38Å; L128-V131 PolarHBondContact O-N 3.41Å; L128-S132 PolarHBondContact O-N 2.93Å; L128-S132 VanDerWaalsContact O-N 3.07Å; L128-S132 PolarHBondContact O-OG 3.41Å
129	T	81.9	Confident	80.3	Confident	74 Å²	74	74 Å²	74	45%	0.454	41%	0.408	S	S	.	.	H	α-helix	trans	-63.9	-40.1	178.1	56.7	0	0	0	0	110.9	G125 I126 S132 Q133	G125-T129 WeakPolarHBondContact O-CG2 3.48Å; G125-T129 PolarHBondContact O-N 3.43Å; G125-T129 VanDerWaalsContact O-N 3.12Å; G125-T129 PolarHBondContact O-OG1 3.5Å; I126-T129 PolarHBondContact O-N 3.44Å; I126-T129 PolarHBondContact O-OG1 3.15Å; T129-S132 PolarHBondContact O-N 3.16Å; T129-S132 PolarHBondContact O-OG 2.96Å; T129-Q133 WeakPolarHBondContact O-CG 3.35Å; T129-Q133 PolarHBondContact O-N 3.48Å
130	Q	80.1	Confident	79.6	Confident	24 Å²	24	76.4 Å²	76.4	11%	0.112	42%	0.42	C	S	.	.	H	α-helix	trans	-67.2	-39	-179.9	-77.2	-146.2	130.4	0	0	113.9	Q89 Q93 I126 I127 L128 H134	Q89-Q130 HydrophobicContact CG-CB 3.81Å; Q89-Q130 HydrophobicContact CG-CG 4.33Å; Q89-Q130 PolarHBondContact NE2-O 3.38Å; Q89-Q130 VanDerWaalsContact NE2-OE1 3.09Å; Q93-Q130 VanDerWaalsContact CG-NE2 3.26Å; I126-Q130 HydrophobicContact CG2-CG 4.03Å; I126-Q130 WeakPolarHBondContact O-CB 3.38Å; I126-Q130 WeakPolarHBondContact O-CG 3.21Å; I126-Q130 PolarHBondContact O-N 3.44Å; I127-Q130 PolarHBondContact O-N 3.15Å; L128-Q130 VanDerWaalsContact C-N 3.29Å; L128-Q130 PolarHBondContact O-N 3.38Å; Q130-H134 PolarHBondContact O-N 2.82Å; Q130-H134 VanDerWaalsContact O-N 3.15Å
131	V	77	Confident	79	Confident	74 Å²	74	77.6 Å²	77.6	45%	0.448	42%	0.424	S	S	.	.	H	α-helix	trans	-67.5	-40.8	173.2	171.3	0	0	0	0	111.1	I127 L128 Q133 H134 R135	I127-V131 HydrophobicContact CG2-CG2 4.34Å; I127-V131 WeakPolarHBondContact O-CG2 3.42Å; I127-V131 PolarHBondContact O-N 3.25Å; L128-V131 PolarHBondContact O-N 3.41Å; V131-Q133 PolarHBondContact O-N 2.8Å; V131-H134 PolarHBondContact O-N 3.39Å; V131-R135 HydrophobicContact CG1-CG 4.47Å; V131-R135 WeakPolarHBondContact O-CG 3.49Å; V131-R135 PolarHBondContact O-N 3.27Å
132	S	80.4	Confident	78.2	Confident	71 Å²	71	78.8 Å²	78.8	50%	0.497	43%	0.43	S	S	.	.	H	α-helix	trans	-63.4	-41.4	179.5	72.4	0	0	0	0	112.3	L128 T129 R135 A136	L128-S132 PolarHBondContact O-N 2.93Å; L128-S132 VanDerWaalsContact O-N 3.07Å; L128-S132 PolarHBondContact O-OG 3.41Å; T129-S132 PolarHBondContact O-N 3.16Å; T129-S132 PolarHBondContact O-OG 2.96Å; S132-R135 PolarHBondContact O-N 2.85Å; S132-A136 WeakPolarHBondContact O-CB 3.38Å; S132-A136 PolarHBondContact O-N 3.29Å
133	Q	78.5	Confident	77.3	Confident	117 Å²	117	79.3 Å²	79.3	55%	0.547	44%	0.441	S	S	.	.	H	α-helix	trans	-64.1	-45.9	175.5	-74.2	177.1	-11.8	0	0	111.6	T129 V131 R135 A136 V137	T129-Q133 WeakPolarHBondContact O-CG 3.35Å; T129-Q133 PolarHBondContact O-N 3.48Å; V131-Q133 PolarHBondContact O-N 2.8Å; Q133-R135 VanDerWaalsContact C-N 3.34Å; Q133-R135 PolarHBondContact O-N 3.14Å; Q133-A136 PolarHBondContact O-N 3.46Å; Q133-V137 WeakPolarHBondContact O-CG2 3.33Å; Q133-V137 PolarHBondContact O-N 2.96Å
134	H	74.5	Confident	76.6	Confident	56 Å²	56	85.6 Å²	85.6	26%	0.259	47%	0.47	S	S	.	.	H	α-helix	trans	-62.1	-41.1	177.8	-174.1	63.9	0	0	0	112.1	V86 Q130 V131 V137 N138	V86-H134 WeakPolarHBondContact CG2-CE1 3.34Å; V86-H134 VanDerWaalsContact CG2-NE2 3.34Å; V86-H134 WeakPolarHBondContact CG2-NE2 3.31Å; Q130-H134 PolarHBondContact O-N 2.82Å; Q130-H134 VanDerWaalsContact O-N 3.15Å; V131-H134 PolarHBondContact O-N 3.39Å; H134-V137 PolarHBondContact O-N 3.1Å; H134-N138 PolarHBondContact CD2-ND2 3.12Å; H134-N138 PolarHBondContact CE1-OD1 3.41Å; H134-N138 PolarHBondContact NE2-ND2 3.49Å; H134-N138 VanDerWaalsContact O-CG 3.3Å; H134-N138 PolarHBondContact O-N 2.98Å; H134-N138 PolarHBondContact O-OD1 3.31Å
135	R	75.6	Confident	74.7	Confident	181 Å²	181	85.5 Å²	85.5	68%	0.683	48%	0.483	S	S	*	.	H	α-helix	trans	-63.8	-41.2	174.2	-72	-151.7	-156.8	-136.1	9.7	112.8	V131 S132 Q133 N138 S139	V131-R135 HydrophobicContact CG1-CG 4.47Å; V131-R135 WeakPolarHBondContact O-CG 3.49Å; V131-R135 PolarHBondContact O-N 3.27Å; S132-R135 PolarHBondContact O-N 2.85Å; Q133-R135 VanDerWaalsContact C-N 3.34Å; Q133-R135 PolarHBondContact O-N 3.14Å; R135-N138 PolarHBondContact O-N 3.31Å; R135-S139 WeakPolarHBondContact O-CB 3.48Å; R135-S139 PolarHBondContact O-N 3.13Å; R135-S139 PolarHBondContact O-OG 3.31Å
136	A	77	Confident	72.8	Confident	45 Å²	45	95.7 Å²	95.7	37%	0.372	51%	0.513	S	S	.	.	H	α-helix	trans	-63.2	-41.4	179.1	0	0	0	0	0	111.9	S132 Q133 S139 I140	S132-A136 WeakPolarHBondContact O-CB 3.38Å; S132-A136 PolarHBondContact O-N 3.29Å; Q133-A136 PolarHBondContact O-N 3.46Å; A136-S139 WeakPolarHBondContact CA-OG 3.28Å; A136-S139 PolarHBondContact O-N 2.88Å; A136-S139 PolarHBondContact O-OG 2.95Å; A136-I140 WeakPolarHBondContact O-CD1 3.39Å; A136-I140 WeakPolarHBondContact O-CG1 3.46Å; A136-I140 PolarHBondContact O-N 3.45Å
137	V	73.2	Confident	72.3	Confident	81 Å²	81	98.2 Å²	98.2	49%	0.491	53%	0.527	S	S	.	.	H	α-helix	trans	-63.7	-47.7	174.5	175.8	0	0	0	0	110.7	Q133 H134 S139 I140 Q141	Q133-V137 WeakPolarHBondContact O-CG2 3.33Å; Q133-V137 PolarHBondContact O-N 2.96Å; H134-V137 PolarHBondContact O-N 3.1Å; V137-S139 VanDerWaalsContact C-N 3.32Å; V137-S139 PolarHBondContact O-N 3.2Å; V137-I140 PolarHBondContact O-N 3.31Å; V137-Q141 PolarHBondContact O-N 3.41Å
138	N	74.2	Confident	71.7	Confident	59 Å²	59	99.3 Å²	99.3	32%	0.316	53%	0.534	S	S	.	.	H	α-helix	trans	-62.3	-38.8	177.8	-68.5	-1.7	0	0	0	111.9	H134 R135 I140 Q141 I142	H134-N138 PolarHBondContact CD2-ND2 3.12Å; H134-N138 PolarHBondContact CE1-OD1 3.41Å; H134-N138 PolarHBondContact NE2-ND2 3.49Å; H134-N138 VanDerWaalsContact O-CG 3.3Å; H134-N138 PolarHBondContact O-N 2.98Å; H134-N138 PolarHBondContact O-OD1 3.31Å; R135-N138 PolarHBondContact O-N 3.31Å; N138-I140 VanDerWaalsContact C-N 3.33Å; N138-I140 PolarHBondContact O-N 2.96Å; N138-Q141 PolarHBondContact O-N 3Å; N138-I142 VanDerWaalsContact O-CG1 3.29Å; N138-I142 WeakPolarHBondContact O-CG1 3.46Å; N138-I142 PolarHBondContact O-N 3.07Å
139	S	73.8	Confident	71	Confident	62 Å²	62	98.3 Å²	98.3	43%	0.434	53%	0.529	S	S	.	.	H	α-helix	trans	-67.9	-33.8	177.3	66.2	0	0	0	0	112.2	R135 A136 V137 I142 C143	R135-S139 WeakPolarHBondContact O-CB 3.48Å; R135-S139 PolarHBondContact O-N 3.13Å; R135-S139 PolarHBondContact O-OG 3.31Å; A136-S139 WeakPolarHBondContact CA-OG 3.28Å; A136-S139 PolarHBondContact O-N 2.88Å; A136-S139 PolarHBondContact O-OG 2.95Å; V137-S139 VanDerWaalsContact C-N 3.32Å; V137-S139 PolarHBondContact O-N 3.2Å; S139-I142 PolarHBondContact O-N 2.89Å; S139-C143 PolarHBondContact O-N 3.18Å
140	I	68.6	Low	70.4	Confident	109 Å²	109	99.7 Å²	99.7	56%	0.559	53%	0.534	S	S	*	.	H	α-helix	trans	-65.4	-42.1	171.7	-68.2	161.6	0	0	0	110.5	A136 V137 N138 C143 M144	A136-I140 WeakPolarHBondContact O-CD1 3.39Å; A136-I140 WeakPolarHBondContact O-CG1 3.46Å; A136-I140 PolarHBondContact O-N 3.45Å; V137-I140 PolarHBondContact O-N 3.31Å; N138-I140 VanDerWaalsContact C-N 3.33Å; N138-I140 PolarHBondContact O-N 2.96Å; I140-C143 PolarHBondContact O-N 2.96Å; I140-M144 HydrophobicContact CG2-CG 4.4Å; I140-M144 WeakPolarHBondContact O-CB 3.37Å; I140-M144 VanDerWaalsContact O-CG 3.25Å; I140-M144 WeakPolarHBondContact O-CG 3.29Å; I140-M144 PolarHBondContact O-N 2.83Å
141	Q	69.2	Low	69.8	Low	102 Å²	102	104.4 Å²	104.4	48%	0.477	56%	0.56	S	S	.	*	H	α-helix	trans	-61.1	-43.6	175.2	-100.7	176.7	-80.7	0	0	112.6	V137 N138 C143 M144 G145 Y146	V137-Q141 PolarHBondContact O-N 3.41Å; N138-Q141 PolarHBondContact O-N 3Å; Q141-C143 PolarHBondContact O-N 2.72Å; Q141-M144 CarbonylContact O-C 3.5Å; Q141-M144 PolarHBondContact O-N 3.21Å; Q141-M144 VanDerWaalsContact O-N 3.14Å; Q141-G145 PolarHBondContact O-N 2.83Å; Q141-G145 VanDerWaalsContact O-N 3.12Å; Q141-Y146 PolarHBondContact O-N 3.31Å
142	I	70	Confident	69.3	Low	131 Å²	131	106.5 Å²	106.5	67%	0.672	57%	0.568	S	S	*	*	H	α-helix	trans	-65	-39.5	178.7	-64.2	164.7	0	0	0	111.5	N138 S139 M144 G145	N138-I142 VanDerWaalsContact O-CG1 3.29Å; N138-I142 WeakPolarHBondContact O-CG1 3.46Å; N138-I142 PolarHBondContact O-N 3.07Å; S139-I142 PolarHBondContact O-N 2.89Å; I142-M144 VanDerWaalsContact C-N 3.32Å; I142-M144 PolarHBondContact O-N 2.93Å; I142-G145 PolarHBondContact O-N 2.87Å
143	C	66.2	Low	68.5	Low	120 Å²	120	109 Å²	109	81%	0.811	57%	0.573	S	S	*	*	H	α-helix	trans	-69.1	-27.8	173.7	-80.8	0	0	0	0	113.5	S139 I140 Q141 G145	S139-C143 PolarHBondContact O-N 3.18Å; I140-C143 PolarHBondContact O-N 2.96Å; Q141-C143 PolarHBondContact O-N 2.72Å; C143-G145 VanDerWaalsContact C-N 3.29Å
144	M	67.8	Low	67.7	Low	148 Å²	148	108.4 Å²	108.4	73%	0.729	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.8	2.3	175.9	-66.4	-67.9	-69.8	0	0	113.1	I140 Q141 I142	I140-M144 HydrophobicContact CG2-CG 4.4Å; I140-M144 WeakPolarHBondContact O-CB 3.37Å; I140-M144 VanDerWaalsContact O-CG 3.25Å; I140-M144 WeakPolarHBondContact O-CG 3.29Å; I140-M144 PolarHBondContact O-N 2.83Å; Q141-M144 CarbonylContact O-C 3.5Å; Q141-M144 PolarHBondContact O-N 3.21Å; Q141-M144 VanDerWaalsContact O-N 3.14Å; I142-M144 VanDerWaalsContact C-N 3.32Å; I142-M144 PolarHBondContact O-N 2.93Å
145	G	46.1	Very low	67.2	Low	68 Å²	68	112.8 Å²	112.8	70%	0.701	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	72.8	35.8	171.2	0	0	0	0	0	115.2	Q141 I142 C143	Q141-G145 PolarHBondContact O-N 2.83Å; Q141-G145 VanDerWaalsContact O-N 3.12Å; I142-G145 PolarHBondContact O-N 2.87Å; C143-G145 VanDerWaalsContact C-N 3.29Å
146	Y	44.3	Very low	66.4	Low	247 Å²	247	106.5 Å²	106.5	97%	0.969	59%	0.594	S	S	*	*			trans	-109.9	0	166.7	-90	-85.4	0	0	0	111.6	Q141	Q141-Y146 PolarHBondContact O-N 3.31Å

Retrieved 146 of 146 residues in 91.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).