A0A5K4EK00_SCHMA Loading...

Synaptobrevin, putative

AlphaFold DB , UniProt , Accession A0A5K4EK00, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 96 aa.

						>A0A5K4EK00_SCHMA|A0A5K4EK00
MTDKAPIKTNKRLQQTQAQVNEVVDIMRVNVDKVLERDKNLSELDGRADALQAGASQFEASAGKLKRKFWWKNCKYGSFLNKKIKLNKVNIHLIIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.1	Very low	65.7	Low	233 Å²	233	135.1 Å²	135.1	100%	1.148	70%	0.704	S	S	*	*				0	126.2	0	-58.1	102.2	151.5	0	0	106.8
2	T	51.9	Low	67.5	Low	122 Å²	122	139.1 Å²	139.1	75%	0.748	70%	0.703	S	S	*	*				-154.2	122	55.2	50.6	0	0	0	0	110.1	K4	T2-K4 PolarHBondContact O-N 3.07Å
3	D	57.6	Low	69.3	Low	157 Å²	157	136.9 Å²	136.9	84%	0.84	69%	0.693	S	S	*	*			trans	-56.4	106.5	173.4	-74.1	-59.2	0	0	0	111.5	A5	D3-A5 PolarHBondContact O-N 2.89Å
4	K	57.1	Low	70.8	Confident	209 Å²	209	135.7 Å²	135.7	91%	0.909	68%	0.684	S	S	*	*			trans	-75.7	63.5	170.6	-77.5	-168.6	178.6	-177.7	0	110.8	T2	T2-K4 PolarHBondContact O-N 3.07Å
5	A	62.6	Low	72.1	Confident	64 Å²	64	135.3 Å²	135.3	53%	0.529	68%	0.679	S	S	.	*			trans	-135.6	21.1	168.2	0	0	0	0	0	118.7	D3 T9	D3-A5 PolarHBondContact O-N 2.89Å; A5-T9 PolarHBondContact O-OG1 2.94Å
6	P	63.7	Low	73.4	Confident	84 Å²	84	131.3 Å²	131.3	55%	0.545	66%	0.664	S	S	.	*	H	α-helix	trans	-80.9	-35.4	173.5	28.3	-30.8	0	0	0	114	N10	P6-N10 WeakPolarHBondContact O-CB 3.42Å; P6-N10 PolarHBondContact O-N 3.06Å
7	I	64.4	Low	74.5	Confident	125 Å²	125	129.5 Å²	129.5	64%	0.641	65%	0.652	S	S	*	*	H	α-helix	trans	-73	-44.5	-167.7	-54	-73	0	0	0	113.2	T9 N10 K11	I7-T9 VanDerWaalsContact C-N 3.35Å; I7-N10 PolarHBondContact O-N 3.46Å; I7-K11 PolarHBondContact O-N 3.22Å
8	K	73.6	Confident	75.6	Confident	178 Å²	178	125.6 Å²	125.6	77%	0.774	64%	0.643	S	S	*	*	H	α-helix	trans	-64.9	-40.1	178.2	-78.7	-171	179.9	-175.9	0	111.5	K11 R12	K8-K11 PolarHBondContact O-N 2.92Å; K8-R12 PolarHBondContact O-N 3.38Å
9	T	79.6	Confident	76.6	Confident	89 Å²	89	125.2 Å²	125.2	55%	0.546	64%	0.638	S	S	.	*	H	α-helix	trans	-62.8	-42.4	176.9	-48.1	0	0	0	0	111	A5 I7 R12 L13	A5-T9 PolarHBondContact O-OG1 2.94Å; I7-T9 VanDerWaalsContact C-N 3.35Å; T9-R12 PolarHBondContact O-N 2.93Å; T9-L13 WeakPolarHBondContact O-CB 3.44Å; T9-L13 PolarHBondContact O-N 2.89Å
10	N	82.2	Confident	77.5	Confident	84 Å²	84	122.6 Å²	122.6	45%	0.449	63%	0.628	S	S	.	*	H	α-helix	trans	-64	-43	179.4	-147.5	-54.5	0	0	0	112.5	P6 I7 R12 L13 Q14	P6-N10 WeakPolarHBondContact O-CB 3.42Å; P6-N10 PolarHBondContact O-N 3.06Å; I7-N10 PolarHBondContact O-N 3.46Å; N10-R12 PolarHBondContact O-N 3.49Å; N10-L13 PolarHBondContact O-N 3.47Å; N10-Q14 WeakPolarHBondContact O-CG 3.41Å; N10-Q14 PolarHBondContact O-N 3.4Å; N10-Q14 PolarHBondContact OD1-NE2 3.49Å
11	K	86.8	Confident	78.4	Confident	141 Å²	141	120.4 Å²	120.4	61%	0.613	62%	0.618	S	S	*	*	H	α-helix	trans	-61.3	-44.2	175.1	-74.3	-172.1	177.4	-174.7	0	112.7	I7 K8 L13 Q14 Q15	I7-K11 PolarHBondContact O-N 3.22Å; K8-K11 PolarHBondContact O-N 2.92Å; K11-L13 VanDerWaalsContact C-N 3.35Å; K11-Q14 PolarHBondContact O-N 2.95Å; K11-Q15 WeakPolarHBondContact O-CG 3.32Å; K11-Q15 PolarHBondContact O-N 3.48Å
12	R	87.9	Confident	81	Confident	183 Å²	183	115.1 Å²	115.1	69%	0.691	59%	0.59	S	S	*	*	H	α-helix	trans	-61.9	-43.9	175.9	-74.1	-176.2	175	177.1	-2.6	111.2	K8 T9 N10 Q14 Q15 T16	K8-R12 PolarHBondContact O-N 3.38Å; T9-R12 PolarHBondContact O-N 2.93Å; N10-R12 PolarHBondContact O-N 3.49Å; R12-Q14 PolarHBondContact O-N 3.32Å; R12-Q15 PolarHBondContact O-N 3.24Å; R12-T16 PolarHBondContact O-N 2.92Å; R12-T16 PolarHBondContact O-OG1 3.24Å; R12-T16 VanDerWaalsContact O-OG1 3.07Å
13	L	89.7	Confident	83.1	Confident	111 Å²	111	113.2 Å²	113.2	58%	0.581	58%	0.579	S	S	*	*	H	α-helix	trans	-62.2	-42.7	177.4	-176.8	63.5	0	0	0	112.2	T9 N10 K11 T16 Q17	T9-L13 WeakPolarHBondContact O-CB 3.44Å; T9-L13 PolarHBondContact O-N 2.89Å; N10-L13 PolarHBondContact O-N 3.47Å; K11-L13 VanDerWaalsContact C-N 3.35Å; L13-T16 PolarHBondContact O-N 3.24Å; L13-Q17 WeakPolarHBondContact O-CB 3.47Å; L13-Q17 PolarHBondContact O-N 2.96Å
14	Q	90.5	Very high	85	Confident	120 Å²	120	108.7 Å²	108.7	56%	0.561	56%	0.556	S	S	*	*	H	α-helix	trans	-62.5	-41.7	175.7	-72.5	173.4	28.7	0	0	112.1	N10 K11 R12 Q17 A18	N10-Q14 WeakPolarHBondContact O-CG 3.41Å; N10-Q14 PolarHBondContact O-N 3.4Å; N10-Q14 PolarHBondContact OD1-NE2 3.49Å; K11-Q14 PolarHBondContact O-N 2.95Å; R12-Q14 PolarHBondContact O-N 3.32Å; Q14-Q17 PolarHBondContact O-N 3.41Å; Q14-A18 PolarHBondContact O-N 2.94Å
15	Q	91.1	Very high	86.9	Confident	130 Å²	130	103 Å²	103	61%	0.607	54%	0.536	S	S	*	.	H	α-helix	trans	-62	-46.2	173.8	-73.3	175.6	-29.3	0	0	111.3	K11 R12 Q17 A18 Q19	K11-Q15 WeakPolarHBondContact O-CG 3.32Å; K11-Q15 PolarHBondContact O-N 3.48Å; R12-Q15 PolarHBondContact O-N 3.24Å; Q15-Q17 VanDerWaalsContact C-N 3.32Å; Q15-Q17 PolarHBondContact O-N 3.44Å; Q15-A18 PolarHBondContact O-N 3.29Å; Q15-Q19 WeakPolarHBondContact O-CG 3.44Å; Q15-Q19 PolarHBondContact O-N 3.33Å
16	T	92.4	Very high	88.5	Confident	71 Å²	71	104 Å²	104	44%	0.436	53%	0.532	S	S	.	.	H	α-helix	trans	-61.2	-40.7	175.9	-58.4	0	0	0	0	111.6	R12 L13 A18 Q19 V20	R12-T16 PolarHBondContact O-N 2.92Å; R12-T16 PolarHBondContact O-OG1 3.24Å; R12-T16 VanDerWaalsContact O-OG1 3.07Å; L13-T16 PolarHBondContact O-N 3.24Å; T16-A18 PolarHBondContact O-N 2.91Å; T16-Q19 PolarHBondContact O-N 3.48Å; T16-V20 HydrophobicContact CG2-CG2 4.37Å; T16-V20 WeakPolarHBondContact O-CB 3.38Å; T16-V20 VanDerWaalsContact O-CG2 3.28Å; T16-V20 WeakPolarHBondContact O-CG2 3.24Å; T16-V20 PolarHBondContact O-N 3.02Å
17	Q	91.7	Very high	90.2	Very high	101 Å²	101	104.9 Å²	104.9	47%	0.472	53%	0.529	S	S	.	.	H	α-helix	trans	-63.5	-41.1	176.3	-172.3	62.5	59.6	0	0	111.9	L13 Q14 Q15 V20 N21	L13-Q17 WeakPolarHBondContact O-CB 3.47Å; L13-Q17 PolarHBondContact O-N 2.96Å; Q14-Q17 PolarHBondContact O-N 3.41Å; Q15-Q17 VanDerWaalsContact C-N 3.32Å; Q15-Q17 PolarHBondContact O-N 3.44Å; Q17-V20 PolarHBondContact O-N 3.34Å; Q17-N21 PolarHBondContact NE2-OD1 2.83Å; Q17-N21 WeakPolarHBondContact O-CB 3.46Å; Q17-N21 PolarHBondContact O-N 3.39Å; Q17-N21 PolarHBondContact O-ND2 2.94Å; Q17-N21 PolarHBondContact O-OD1 3.49Å
18	A	94.3	Very high	91.8	Very high	58 Å²	58	106.7 Å²	106.7	48%	0.479	53%	0.528	S	S	.	.	H	α-helix	trans	-63.3	-43.9	175.7	0	0	0	0	0	111.7	Q14 Q15 T16 N21 E22	Q14-A18 PolarHBondContact O-N 2.94Å; Q15-A18 PolarHBondContact O-N 3.29Å; T16-A18 PolarHBondContact O-N 2.91Å; A18-N21 PolarHBondContact O-N 2.9Å; A18-E22 PolarHBondContact O-N 3.35Å
19	Q	95	Very high	92.9	Very high	119 Å²	119	101.6 Å²	101.6	56%	0.556	51%	0.512	S	S	*	.	H	α-helix	trans	-63.2	-42.1	175.7	-71.5	178.9	-43.8	0	0	112.2	Q15 T16 E22 V23	Q15-Q19 WeakPolarHBondContact O-CG 3.44Å; Q15-Q19 PolarHBondContact O-N 3.33Å; T16-Q19 PolarHBondContact O-N 3.48Å; Q19-E22 PolarHBondContact O-N 3.22Å; Q19-V23 WeakPolarHBondContact O-CG2 3.35Å; Q19-V23 PolarHBondContact O-N 3.29Å
20	V	95.7	Very high	93.8	Very high	72 Å²	72	100.5 Å²	100.5	44%	0.436	50%	0.503	S	S	.	.	H	α-helix	trans	-64	-43.9	176.3	170	0	0	0	0	110.5	T16 Q17 E22 V23 V24	T16-V20 HydrophobicContact CG2-CG2 4.37Å; T16-V20 WeakPolarHBondContact O-CB 3.38Å; T16-V20 VanDerWaalsContact O-CG2 3.28Å; T16-V20 WeakPolarHBondContact O-CG2 3.24Å; T16-V20 PolarHBondContact O-N 3.02Å; Q17-V20 PolarHBondContact O-N 3.34Å; V20-E22 VanDerWaalsContact C-N 3.35Å; V20-E22 PolarHBondContact O-N 3.04Å; V20-V23 PolarHBondContact O-N 3.49Å; V20-V24 HydrophobicContact CG1-CG2 4.25Å; V20-V24 WeakPolarHBondContact O-CB 3.4Å; V20-V24 VanDerWaalsContact O-CG2 3.24Å; V20-V24 WeakPolarHBondContact O-CG2 3.42Å; V20-V24 PolarHBondContact O-N 3.39Å
21	N	95.9	Very high	94.6	Very high	77 Å²	77	99.9 Å²	99.9	41%	0.412	50%	0.502	S	S	.	.	H	α-helix	trans	-60.7	-44.5	177	-68.8	-9	0	0	0	111.4	Q17 A18 V23 V24 D25	Q17-N21 PolarHBondContact NE2-OD1 2.83Å; Q17-N21 WeakPolarHBondContact O-CB 3.46Å; Q17-N21 PolarHBondContact O-N 3.39Å; Q17-N21 PolarHBondContact O-ND2 2.94Å; Q17-N21 PolarHBondContact O-OD1 3.49Å; A18-N21 PolarHBondContact O-N 2.9Å; N21-V23 PolarHBondContact O-N 3.07Å; N21-V24 PolarHBondContact O-N 3.29Å; N21-D25 VanDerWaalsContact O-CG 3.23Å; N21-D25 PolarHBondContact O-N 3.12Å
22	E	96.7	Very high	95.1	Very high	122 Å²	122	98.3 Å²	98.3	57%	0.57	50%	0.5	S	S	*	.	H	α-helix	trans	-58.9	-47.2	175.6	-179.1	-179.3	-160.7	0	0	111.9	A18 Q19 V20 V24 D25 I26	A18-E22 PolarHBondContact O-N 3.35Å; Q19-E22 PolarHBondContact O-N 3.22Å; V20-E22 VanDerWaalsContact C-N 3.35Å; V20-E22 PolarHBondContact O-N 3.04Å; E22-V24 VanDerWaalsContact C-N 3.34Å; E22-V24 PolarHBondContact O-N 3.05Å; E22-D25 PolarHBondContact O-N 2.84Å; E22-I26 HydrophobicContact CG-CD1 4.21Å; E22-I26 WeakPolarHBondContact O-CG1 3.3Å; E22-I26 PolarHBondContact O-N 3.29Å
23	V	96.5	Very high	95.6	Very high	83 Å²	83	95.3 Å²	95.3	50%	0.503	49%	0.492	S	S	.	.	H	α-helix	trans	-65.5	-38.2	177.4	173.9	0	0	0	0	111.5	Q19 V20 N21 D25 I26 M27	Q19-V23 WeakPolarHBondContact O-CG2 3.35Å; Q19-V23 PolarHBondContact O-N 3.29Å; V20-V23 PolarHBondContact O-N 3.49Å; N21-V23 PolarHBondContact O-N 3.07Å; V23-D25 VanDerWaalsContact C-N 3.31Å; V23-D25 PolarHBondContact O-N 3.3Å; V23-I26 PolarHBondContact O-N 3.39Å; V23-M27 HydrophobicContact CG1-CG 4.3Å; V23-M27 WeakPolarHBondContact O-CB 3.35Å; V23-M27 VanDerWaalsContact O-CG 3.3Å; V23-M27 WeakPolarHBondContact O-CG 3.28Å; V23-M27 PolarHBondContact O-N 3.35Å
24	V	97.3	Very high	96	Very high	62 Å²	62	94.1 Å²	94.1	38%	0.376	49%	0.489	S	S	.	.	H	α-helix	trans	-60.8	-43.2	174.3	165.8	0	0	0	0	110.4	V20 N21 E22 M27 R28	V20-V24 HydrophobicContact CG1-CG2 4.25Å; V20-V24 WeakPolarHBondContact O-CB 3.4Å; V20-V24 VanDerWaalsContact O-CG2 3.24Å; V20-V24 WeakPolarHBondContact O-CG2 3.42Å; V20-V24 PolarHBondContact O-N 3.39Å; N21-V24 PolarHBondContact O-N 3.29Å; E22-V24 VanDerWaalsContact C-N 3.34Å; E22-V24 PolarHBondContact O-N 3.05Å; V24-M27 PolarHBondContact O-N 3.35Å; V24-R28 WeakPolarHBondContact O-CG 3.48Å; V24-R28 PolarHBondContact O-N 3.22Å
25	D	97.1	Very high	96.4	Very high	89 Å²	89	93.4 Å²	93.4	48%	0.476	49%	0.489	S	S	.	.	H	α-helix	trans	-65.4	-41.5	177.9	-67.1	-22.8	0	0	0	111.6	N21 E22 V23 M27 R28 V29	N21-D25 VanDerWaalsContact O-CG 3.23Å; N21-D25 PolarHBondContact O-N 3.12Å; E22-D25 PolarHBondContact O-N 2.84Å; V23-D25 VanDerWaalsContact C-N 3.31Å; V23-D25 PolarHBondContact O-N 3.3Å; D25-M27 VanDerWaalsContact C-N 3.33Å; D25-M27 PolarHBondContact O-N 2.9Å; D25-R28 PolarHBondContact O-N 2.84Å; D25-R28 IonicContact OD1-NE 3.79Å; D25-V29 PolarHBondContact O-N 3.47Å
26	I	97.4	Very high	96.7	Very high	86 Å²	86	93.2 Å²	93.2	44%	0.441	49%	0.488	S	S	.	.	H	α-helix	trans	-60.1	-43.8	172	-67.7	165.9	0	0	0	110.9	E22 V23 V29 N30	E22-I26 HydrophobicContact CG-CD1 4.21Å; E22-I26 WeakPolarHBondContact O-CG1 3.3Å; E22-I26 PolarHBondContact O-N 3.29Å; V23-I26 PolarHBondContact O-N 3.39Å; I26-V29 PolarHBondContact O-N 2.84Å; I26-N30 VanDerWaalsContact O-CG 3.3Å; I26-N30 PolarHBondContact O-N 3.34Å
27	M	97.7	Very high	97	Very high	101 Å²	101	97.8 Å²	97.8	50%	0.498	50%	0.497	S	S	.	.	H	α-helix	trans	-69.4	-31.8	-179	-74	-58.8	-67	0	0	112.7	V23 V24 D25 N30 V31	V23-M27 HydrophobicContact CG1-CG 4.3Å; V23-M27 WeakPolarHBondContact O-CB 3.35Å; V23-M27 VanDerWaalsContact O-CG 3.3Å; V23-M27 WeakPolarHBondContact O-CG 3.28Å; V23-M27 PolarHBondContact O-N 3.35Å; V24-M27 PolarHBondContact O-N 3.35Å; D25-M27 VanDerWaalsContact C-N 3.33Å; D25-M27 PolarHBondContact O-N 2.9Å; M27-N30 PolarHBondContact O-N 3.27Å; M27-N30 HydrophobicContact SD-CB 4.44Å; M27-V31 VanDerWaalsContact O-CG2 3.28Å; M27-V31 WeakPolarHBondContact O-CG2 3.28Å; M27-V31 PolarHBondContact O-N 2.86Å
28	R	98.1	Very high	97.4	Very high	163 Å²	163	98.1 Å²	98.1	62%	0.615	50%	0.502	S	S	*	.	H	α-helix	trans	-58.4	-50.2	170.4	-72.3	177.1	-159.7	-120.6	4.8	110.7	V24 D25 N30 V31 D32	V24-R28 WeakPolarHBondContact O-CG 3.48Å; V24-R28 PolarHBondContact O-N 3.22Å; D25-R28 PolarHBondContact O-N 2.84Å; D25-R28 IonicContact OD1-NE 3.79Å; R28-N30 VanDerWaalsContact C-N 3.28Å; R28-N30 PolarHBondContact O-N 3.46Å; R28-V31 WeakPolarHBondContact O-CB 3.31Å; R28-V31 PolarHBondContact O-N 3.33Å; R28-V31 VanDerWaalsContact O-N 3.12Å; R28-D32 PolarHBondContact O-N 2.95Å
29	V	97.9	Very high	97.5	Very high	71 Å²	71	102.6 Å²	102.6	43%	0.43	51%	0.511	S	S	.	.	H	α-helix	trans	-61.5	-38.7	177.3	176.5	0	0	0	0	111.5	D25 I26 V31 D32 K33	D25-V29 PolarHBondContact O-N 3.47Å; I26-V29 PolarHBondContact O-N 2.84Å; V29-V31 VanDerWaalsContact C-N 3.34Å; V29-D32 PolarHBondContact O-N 3.36Å; V29-K33 HydrophobicContact CG1-CD 4.18Å; V29-K33 VanDerWaalsContact O-CG 3.31Å; V29-K33 WeakPolarHBondContact O-CG 3.29Å; V29-K33 PolarHBondContact O-N 3.33Å
30	N	97.7	Very high	97.7	Very high	67 Å²	67	100.9 Å²	100.9	36%	0.358	51%	0.505	S	S	.	.	H	α-helix	trans	-68.2	-34.2	176.9	-70.2	-16.1	0	0	0	112.5	I26 M27 R28 K33 V34	I26-N30 VanDerWaalsContact O-CG 3.3Å; I26-N30 PolarHBondContact O-N 3.34Å; M27-N30 PolarHBondContact O-N 3.27Å; M27-N30 HydrophobicContact SD-CB 4.44Å; R28-N30 VanDerWaalsContact C-N 3.28Å; R28-N30 PolarHBondContact O-N 3.46Å; N30-K33 PolarHBondContact O-N 3.31Å; N30-V34 WeakPolarHBondContact O-CB 3.48Å; N30-V34 PolarHBondContact O-N 2.98Å
31	V	98.5	Very high	97.9	Very high	71 Å²	71	101.4 Å²	101.4	43%	0.43	51%	0.505	S	S	.	.	H	α-helix	trans	-63.7	-45.2	173.2	167.9	0	0	0	0	110.3	M27 R28 V29 K33 V34 L35	M27-V31 VanDerWaalsContact O-CG2 3.28Å; M27-V31 WeakPolarHBondContact O-CG2 3.28Å; M27-V31 PolarHBondContact O-N 2.86Å; R28-V31 WeakPolarHBondContact O-CB 3.31Å; R28-V31 PolarHBondContact O-N 3.33Å; R28-V31 VanDerWaalsContact O-N 3.12Å; V29-V31 VanDerWaalsContact C-N 3.34Å; V31-K33 VanDerWaalsContact C-N 3.31Å; V31-K33 PolarHBondContact O-N 3.03Å; V31-V34 WeakPolarHBondContact O-CG1 3.49Å; V31-V34 PolarHBondContact O-N 2.94Å; V31-L35 HydrophobicContact CG1-CD1 4.1Å; V31-L35 VanDerWaalsContact O-CG 3.29Å; V31-L35 WeakPolarHBondContact O-CG 3.35Å; V31-L35 PolarHBondContact O-N 3.38Å
32	D	98.2	Very high	98	Very high	107 Å²	107	101.8 Å²	101.8	57%	0.572	51%	0.514	S	S	*	.	H	α-helix	trans	-60.7	-43.3	176.2	-63.8	-28.3	0	0	0	111.3	R28 V29 L35 E36	R28-D32 PolarHBondContact O-N 2.95Å; V29-D32 PolarHBondContact O-N 3.36Å; D32-L35 PolarHBondContact O-N 3.17Å; D32-E36 PolarHBondContact O-N 3.48Å
33	K	98.5	Very high	98.1	Very high	121 Å²	121	100.3 Å²	100.3	53%	0.526	51%	0.507	S	S	.	.	H	α-helix	trans	-64.4	-39.2	176.4	-72.6	172.6	-179.7	173.2	0	113.3	V29 N30 V31 L35 E36 R37	V29-K33 HydrophobicContact CG1-CD 4.18Å; V29-K33 VanDerWaalsContact O-CG 3.31Å; V29-K33 WeakPolarHBondContact O-CG 3.29Å; V29-K33 PolarHBondContact O-N 3.33Å; N30-K33 PolarHBondContact O-N 3.31Å; V31-K33 VanDerWaalsContact C-N 3.31Å; V31-K33 PolarHBondContact O-N 3.03Å; K33-L35 VanDerWaalsContact C-N 3.34Å; K33-E36 PolarHBondContact O-N 3.38Å; K33-R37 WeakPolarHBondContact O-CB 3.34Å; K33-R37 PolarHBondContact O-N 2.83Å
34	V	98.3	Very high	98.2	Very high	85 Å²	85	101.4 Å²	101.4	52%	0.515	51%	0.509	S	S	.	.	H	α-helix	trans	-71.3	-32.9	179.8	80.6	0	0	0	0	111.1	N30 V31 R37 D38	N30-V34 WeakPolarHBondContact O-CB 3.48Å; N30-V34 PolarHBondContact O-N 2.98Å; V31-V34 WeakPolarHBondContact O-CG1 3.49Å; V31-V34 PolarHBondContact O-N 2.94Å; V34-R37 PolarHBondContact O-N 3.03Å; V34-D38 WeakPolarHBondContact O-CB 3.32Å; V34-D38 PolarHBondContact O-N 2.88Å
35	L	98.2	Very high	98.2	Very high	106 Å²	106	103.3 Å²	103.3	56%	0.555	52%	0.518	S	S	*	.	H	α-helix	trans	-68	-41.4	173.4	-68.5	173	0	0	0	112	V31 D32 K33 R37 D38 K39	V31-L35 HydrophobicContact CG1-CD1 4.1Å; V31-L35 VanDerWaalsContact O-CG 3.29Å; V31-L35 WeakPolarHBondContact O-CG 3.35Å; V31-L35 PolarHBondContact O-N 3.38Å; D32-L35 PolarHBondContact O-N 3.17Å; K33-L35 VanDerWaalsContact C-N 3.34Å; L35-R37 VanDerWaalsContact C-N 3.32Å; L35-D38 PolarHBondContact O-N 3.25Å; L35-K39 PolarHBondContact O-N 3.41Å
36	E	98.4	Very high	98.3	Very high	125 Å²	125	101.1 Å²	101.1	58%	0.584	52%	0.516	S	S	*	.	H	α-helix	trans	-63.3	-41.3	172.5	-174.4	178.8	-163.8	0	0	111.4	D32 K33 D38 K39 N40	D32-E36 PolarHBondContact O-N 3.48Å; K33-E36 PolarHBondContact O-N 3.38Å; E36-D38 VanDerWaalsContact C-N 3.34Å; E36-D38 PolarHBondContact O-N 3.4Å; E36-K39 PolarHBondContact O-N 3.01Å; E36-N40 VanDerWaalsContact O-CG 3.32Å; E36-N40 PolarHBondContact O-N 2.92Å; E36-N40 PolarHBondContact O-ND2 3.03Å
37	R	98.5	Very high	98.3	Very high	167 Å²	167	104.6 Å²	104.6	63%	0.63	52%	0.523	S	S	*	.	H	α-helix	trans	-61.2	-41.8	175	-176.3	179.2	178.8	140.7	1	111.9	K33 V34 L35 N40 L41	K33-R37 WeakPolarHBondContact O-CB 3.34Å; K33-R37 PolarHBondContact O-N 2.83Å; V34-R37 PolarHBondContact O-N 3.03Å; L35-R37 VanDerWaalsContact C-N 3.32Å; R37-N40 PolarHBondContact O-N 3.48Å; R37-L41 HydrophobicContact CG-CD1 3.97Å; R37-L41 HydrophobicContact CG-CG 4.2Å; R37-L41 WeakPolarHBondContact O-CB 3.49Å; R37-L41 VanDerWaalsContact O-CG 3.28Å; R37-L41 WeakPolarHBondContact O-CG 3.38Å; R37-L41 PolarHBondContact O-N 3.13Å
38	D	98.5	Very high	98.3	Very high	109 Å²	109	102 Å²	102	58%	0.583	52%	0.518	S	S	*	.	H	α-helix	trans	-59.3	-46.9	177.7	-174.4	70.6	0	0	0	111.4	V34 L35 E36 N40 L41 S42	V34-D38 WeakPolarHBondContact O-CB 3.32Å; V34-D38 PolarHBondContact O-N 2.88Å; L35-D38 PolarHBondContact O-N 3.25Å; E36-D38 VanDerWaalsContact C-N 3.34Å; E36-D38 PolarHBondContact O-N 3.4Å; D38-N40 PolarHBondContact O-N 3.22Å; D38-L41 PolarHBondContact O-N 2.63Å; D38-S42 PolarHBondContact O-N 3.34Å
39	K	98.3	Very high	98.4	Very high	152 Å²	152	98.9 Å²	98.9	66%	0.661	51%	0.513	S	S	*	.	H	α-helix	trans	-58.5	-47.5	174.2	-177.9	179.6	177.1	177.6	0	112.4	L35 E36 L41 S42 E43	L35-K39 PolarHBondContact O-N 3.41Å; E36-K39 PolarHBondContact O-N 3.01Å; K39-L41 VanDerWaalsContact C-N 3.31Å; K39-L41 PolarHBondContact O-N 3.29Å; K39-S42 PolarHBondContact O-N 2.88Å; K39-E43 PolarHBondContact O-N 3.23Å
40	N	98.5	Very high	98.4	Very high	82 Å²	82	98.6 Å²	98.6	44%	0.439	52%	0.519	S	S	.	.	H	α-helix	trans	-65.1	-35.8	179.4	-69.7	-20.6	0	0	0	112	E36 R37 D38 L44	E36-N40 VanDerWaalsContact O-CG 3.32Å; E36-N40 PolarHBondContact O-N 2.92Å; E36-N40 PolarHBondContact O-ND2 3.03Å; R37-N40 PolarHBondContact O-N 3.48Å; D38-N40 PolarHBondContact O-N 3.22Å; N40-L44 VanDerWaalsContact O-CB 3.26Å; N40-L44 WeakPolarHBondContact O-CB 3.29Å; N40-L44 PolarHBondContact O-N 2.98Å
41	L	98.7	Very high	98.4	Very high	84 Å²	84	101.5 Å²	101.5	44%	0.44	53%	0.533	S	S	.	.	H	α-helix	trans	-69.2	-41.4	175.7	-75.3	175.7	0	0	0	111.6	R37 D38 K39 E43 L44 D45	R37-L41 HydrophobicContact CG-CD1 3.97Å; R37-L41 HydrophobicContact CG-CG 4.2Å; R37-L41 WeakPolarHBondContact O-CB 3.49Å; R37-L41 VanDerWaalsContact O-CG 3.28Å; R37-L41 WeakPolarHBondContact O-CG 3.38Å; R37-L41 PolarHBondContact O-N 3.13Å; D38-L41 PolarHBondContact O-N 2.63Å; K39-L41 VanDerWaalsContact C-N 3.31Å; K39-L41 PolarHBondContact O-N 3.29Å; L41-E43 VanDerWaalsContact C-N 3.34Å; L41-E43 PolarHBondContact O-N 3.44Å; L41-L44 PolarHBondContact O-N 2.84Å; L41-D45 VanDerWaalsContact O-CB 3.3Å; L41-D45 WeakPolarHBondContact O-CB 3.43Å; L41-D45 PolarHBondContact O-N 3.47Å
42	S	98.4	Very high	98.4	Very high	84 Å²	84	104.8 Å²	104.8	59%	0.587	54%	0.544	S	S	*	.	H	α-helix	trans	-62.6	-40.7	175.2	179.7	0	0	0	0	112	D38 K39 G46	D38-S42 PolarHBondContact O-N 3.34Å; K39-S42 PolarHBondContact O-N 2.88Å; S42-G46 PolarHBondContact O-N 3.46Å; S42-G46 VanDerWaalsContact O-N 3.13Å
43	E	98.4	Very high	98.4	Very high	91 Å²	91	102.7 Å²	102.7	43%	0.425	54%	0.542	S	S	.	.	H	α-helix	trans	-65.7	-42.3	172.9	-175.9	177.8	-179.4	0	0	111.9	K39 L41 D45 G46 R47	K39-E43 PolarHBondContact O-N 3.23Å; L41-E43 VanDerWaalsContact C-N 3.34Å; L41-E43 PolarHBondContact O-N 3.44Å; E43-D45 VanDerWaalsContact C-N 3.34Å; E43-G46 PolarHBondContact O-N 2.9Å; E43-R47 WeakPolarHBondContact O-CB 3.26Å; E43-R47 VanDerWaalsContact O-CG 3.29Å; E43-R47 WeakPolarHBondContact O-CG 3.29Å; E43-R47 PolarHBondContact O-N 3.47Å; E43-R47 IonicContact OE1-CZ 3.2Å; E43-R47 IonicContact OE1-NE 3.22Å; E43-R47 PolarHBondContact OE1-NE 3.22Å; E43-R47 IonicContact OE1-NH2 2.63Å; E43-R47 PolarHBondContact OE1-NH2 2.91Å
44	L	98.6	Very high	98.4	Very high	106 Å²	106	98.6 Å²	98.6	56%	0.555	53%	0.534	S	S	*	.	H	α-helix	trans	-63.7	-39.9	177.7	-177.6	62.5	0	0	0	112	N40 L41 R47 A48	N40-L44 VanDerWaalsContact O-CB 3.26Å; N40-L44 WeakPolarHBondContact O-CB 3.29Å; N40-L44 PolarHBondContact O-N 2.98Å; L41-L44 PolarHBondContact O-N 2.84Å; L44-R47 CarbonylContact O-C 3.59Å; L44-R47 PolarHBondContact O-N 3.28Å; L44-A48 WeakPolarHBondContact O-CB 3.28Å; L44-A48 PolarHBondContact O-N 2.79Å
45	D	98.4	Very high	98.4	Very high	103 Å²	103	97.1 Å²	97.1	55%	0.551	53%	0.531	S	S	*	.	H	α-helix	trans	-61.5	-49.8	176.9	-168.9	61.1	0	0	0	110.7	L41 E43 R47 A48 D49	L41-D45 VanDerWaalsContact O-CB 3.3Å; L41-D45 WeakPolarHBondContact O-CB 3.43Å; L41-D45 PolarHBondContact O-N 3.47Å; E43-D45 VanDerWaalsContact C-N 3.34Å; D45-R47 VanDerWaalsContact C-N 3.3Å; D45-R47 PolarHBondContact O-N 3.04Å; D45-A48 WeakPolarHBondContact O-CB 3.3Å; D45-A48 PolarHBondContact O-N 2.93Å; D45-D49 PolarHBondContact O-N 3.3Å
46	G	98	Very high	98.5	Very high	42 Å²	42	95.4 Å²	95.4	43%	0.433	53%	0.528	S	S	.	.	H	α-helix	trans	-60.7	-36.7	174.4	0	0	0	0	0	113.4	S42 E43 A50	S42-G46 PolarHBondContact O-N 3.46Å; S42-G46 VanDerWaalsContact O-N 3.13Å; E43-G46 PolarHBondContact O-N 2.9Å; G46-A50 WeakPolarHBondContact O-CB 3.45Å; G46-A50 PolarHBondContact O-N 3.47Å; G46-A50 VanDerWaalsContact O-N 3.15Å
47	R	98.5	Very high	98.5	Very high	159 Å²	159	96.3 Å²	96.3	60%	0.6	53%	0.532	S	S	*	.	H	α-helix	trans	-68.9	-36.9	173.3	-72.4	174.9	179.8	-157.7	2.1	112.2	E43 L44 D45 A50 L51	E43-R47 WeakPolarHBondContact O-CB 3.26Å; E43-R47 VanDerWaalsContact O-CG 3.29Å; E43-R47 WeakPolarHBondContact O-CG 3.29Å; E43-R47 PolarHBondContact O-N 3.47Å; E43-R47 IonicContact OE1-CZ 3.2Å; E43-R47 IonicContact OE1-NE 3.22Å; E43-R47 PolarHBondContact OE1-NE 3.22Å; E43-R47 IonicContact OE1-NH2 2.63Å; E43-R47 PolarHBondContact OE1-NH2 2.91Å; L44-R47 CarbonylContact O-C 3.59Å; L44-R47 PolarHBondContact O-N 3.28Å; D45-R47 VanDerWaalsContact C-N 3.3Å; D45-R47 PolarHBondContact O-N 3.04Å; R47-A50 PolarHBondContact O-N 3.15Å; R47-L51 VanDerWaalsContact O-CB 3.29Å; R47-L51 WeakPolarHBondContact O-CB 3.49Å; R47-L51 PolarHBondContact O-N 2.79Å
48	A	98.7	Very high	98.4	Very high	47 Å²	47	95.7 Å²	95.7	39%	0.388	53%	0.534	S	S	.	.	H	α-helix	trans	-66.6	-42.7	178.3	0	0	0	0	0	111	L44 D45 L51 Q52	L44-A48 WeakPolarHBondContact O-CB 3.28Å; L44-A48 PolarHBondContact O-N 2.79Å; D45-A48 WeakPolarHBondContact O-CB 3.3Å; D45-A48 PolarHBondContact O-N 2.93Å; A48-L51 PolarHBondContact O-N 2.93Å; A48-Q52 WeakPolarHBondContact O-CB 3.33Å; A48-Q52 PolarHBondContact O-N 3.29Å
49	D	98.5	Very high	98.4	Very high	97 Å²	97	97.3 Å²	97.3	52%	0.519	54%	0.538	S	S	.	.	H	α-helix	trans	-60.1	-47.8	173.4	-82	-14.1	0	0	0	111.8	D45 L51 Q52 A53	D45-D49 PolarHBondContact O-N 3.3Å; D49-L51 VanDerWaalsContact C-N 3.31Å; D49-L51 PolarHBondContact O-N 3.34Å; D49-Q52 PolarHBondContact O-N 2.83Å; D49-A53 WeakPolarHBondContact O-CB 3.27Å; D49-A53 PolarHBondContact O-N 3.27Å
50	A	98.4	Very high	98.4	Very high	65 Å²	65	93 Å²	93	54%	0.537	53%	0.531	S	S	.	.	H	α-helix	trans	-61	-41.1	176.7	0	0	0	0	0	111.8	G46 R47 G54	G46-A50 WeakPolarHBondContact O-CB 3.45Å; G46-A50 PolarHBondContact O-N 3.47Å; G46-A50 VanDerWaalsContact O-N 3.15Å; R47-A50 PolarHBondContact O-N 3.15Å; A50-G54 PolarHBondContact O-N 2.8Å
51	L	98.6	Very high	98.4	Very high	128 Å²	128	92.4 Å²	92.4	67%	0.67	53%	0.533	S	S	*	.	H	α-helix	trans	-65.2	-44.1	176.5	179.6	62.7	0	0	0	111.7	R47 A48 D49 G54 A55	R47-L51 VanDerWaalsContact O-CB 3.29Å; R47-L51 WeakPolarHBondContact O-CB 3.49Å; R47-L51 PolarHBondContact O-N 2.79Å; A48-L51 PolarHBondContact O-N 2.93Å; D49-L51 VanDerWaalsContact C-N 3.31Å; D49-L51 PolarHBondContact O-N 3.34Å; L51-G54 PolarHBondContact O-N 3Å; L51-A55 VanDerWaalsContact O-CB 3.27Å; L51-A55 WeakPolarHBondContact O-CB 3.4Å; L51-A55 PolarHBondContact O-N 2.93Å
52	Q	98.6	Very high	98.4	Very high	140 Å²	140	90.3 Å²	90.3	65%	0.654	53%	0.528	S	S	*	.	H	α-helix	trans	-62.2	-45.5	177.9	179	175.4	-28	0	0	111.2	A48 D49 A55 S56	A48-Q52 WeakPolarHBondContact O-CB 3.33Å; A48-Q52 PolarHBondContact O-N 3.29Å; D49-Q52 PolarHBondContact O-N 2.83Å; Q52-A55 PolarHBondContact O-N 3.41Å; Q52-S56 WeakPolarHBondContact O-CB 3.37Å; Q52-S56 PolarHBondContact O-N 3.39Å
53	A	98.3	Very high	98.4	Very high	63 Å²	63	87.2 Å²	87.2	52%	0.521	51%	0.51	S	S	.	.	H	α-helix	trans	-61.4	-45.5	175.8	0	0	0	0	0	111.6	D49 S56 Q57	D49-A53 WeakPolarHBondContact O-CB 3.27Å; D49-A53 PolarHBondContact O-N 3.27Å; A53-S56 PolarHBondContact O-N 2.93Å; A53-Q57 PolarHBondContact O-N 2.9Å
54	G	98.3	Very high	98.4	Very high	36 Å²	36	90 Å²	90	37%	0.371	52%	0.52	S	S	.	.	H	α-helix	trans	-61.3	-42.6	175.6	0	0	0	0	0	112.9	A50 L51 Q57 F58	A50-G54 PolarHBondContact O-N 2.8Å; L51-G54 PolarHBondContact O-N 3Å; G54-Q57 PolarHBondContact O-N 3.01Å; G54-F58 WeakPolarHBondContact O-CB 3.46Å; G54-F58 PolarHBondContact O-N 3.37Å
55	A	98.6	Very high	98.4	Very high	53 Å²	53	89.4 Å²	89.4	44%	0.438	52%	0.517	S	S	.	.	H	α-helix	trans	-64.3	-43.4	177.2	0	0	0	0	0	111.9	L51 Q52 F58 E59	L51-A55 VanDerWaalsContact O-CB 3.27Å; L51-A55 WeakPolarHBondContact O-CB 3.4Å; L51-A55 PolarHBondContact O-N 2.93Å; Q52-A55 PolarHBondContact O-N 3.41Å; A55-F58 PolarHBondContact O-N 3Å; A55-E59 WeakPolarHBondContact O-CB 3.47Å; A55-E59 PolarHBondContact O-N 3.41Å
56	S	98.4	Very high	98.4	Very high	71 Å²	71	92.4 Å²	92.4	50%	0.497	53%	0.525	S	S	.	.	H	α-helix	trans	-63	-43.1	176.2	-175.2	0	0	0	0	111.9	Q52 A53 F58 E59 A60	Q52-S56 WeakPolarHBondContact O-CB 3.37Å; Q52-S56 PolarHBondContact O-N 3.39Å; A53-S56 PolarHBondContact O-N 2.93Å; S56-F58 VanDerWaalsContact C-N 3.34Å; S56-F58 PolarHBondContact O-N 3.35Å; S56-E59 PolarHBondContact O-N 2.8Å; S56-A60 WeakPolarHBondContact O-CB 3.42Å; S56-A60 PolarHBondContact O-N 3.29Å
57	Q	98.4	Very high	98.4	Very high	144 Å²	144	97.3 Å²	97.3	67%	0.673	53%	0.531	S	S	*	.	H	α-helix	trans	-64.2	-40.3	175.6	-173.1	177.4	54.3	0	0	112	A53 G54 S61	A53-Q57 PolarHBondContact O-N 2.9Å; G54-Q57 PolarHBondContact O-N 3.01Å; Q57-S61 VanDerWaalsContact O-CB 3.31Å; Q57-S61 WeakPolarHBondContact O-CB 3.31Å; Q57-S61 PolarHBondContact O-N 2.86Å; Q57-S61 PolarHBondContact O-OG 2.78Å
58	F	98.1	Very high	98.4	Very high	154 Å²	154	95.6 Å²	95.6	68%	0.675	53%	0.528	S	S	*	.	H	α-helix	trans	-62.9	-47.5	175.2	177.1	-98.4	0	0	0	111.4	G54 A55 S56 A60 S61 A62	G54-F58 WeakPolarHBondContact O-CB 3.46Å; G54-F58 PolarHBondContact O-N 3.37Å; A55-F58 PolarHBondContact O-N 3Å; S56-F58 VanDerWaalsContact C-N 3.34Å; S56-F58 PolarHBondContact O-N 3.35Å; F58-A60 PolarHBondContact O-N 3.48Å; F58-S61 PolarHBondContact O-N 2.86Å; F58-A62 HydrophobicContact CE1-CB 4.48Å; F58-A62 VanDerWaalsContact O-CB 3.29Å; F58-A62 WeakPolarHBondContact O-CB 3.48Å; F58-A62 PolarHBondContact O-N 3.37Å
59	E	98.4	Very high	98.4	Very high	143 Å²	143	98.3 Å²	98.3	67%	0.668	53%	0.531	S	S	*	.	H	α-helix	trans	-57.5	-48.7	177.2	-175.1	-171	-170.9	0	0	111.4	A55 S56 S61 A62 G63	A55-E59 WeakPolarHBondContact O-CB 3.47Å; A55-E59 PolarHBondContact O-N 3.41Å; S56-E59 PolarHBondContact O-N 2.8Å; E59-S61 VanDerWaalsContact C-N 3.3Å; E59-S61 PolarHBondContact O-N 3.5Å; E59-A62 PolarHBondContact O-N 3.21Å; E59-G63 PolarHBondContact O-N 2.84Å
60	A	98.4	Very high	98.3	Very high	62 Å²	62	100.7 Å²	100.7	51%	0.512	53%	0.533	S	S	.	.	H	α-helix	trans	-59.8	-42.5	178.2	0	0	0	0	0	111.8	S56 F58 G63 K64	S56-A60 WeakPolarHBondContact O-CB 3.42Å; S56-A60 PolarHBondContact O-N 3.29Å; F58-A60 PolarHBondContact O-N 3.48Å; A60-G63 PolarHBondContact O-N 3.26Å; A60-K64 PolarHBondContact O-N 3.24Å
61	S	98.1	Very high	98.3	Very high	68 Å²	68	104.5 Å²	104.5	48%	0.476	53%	0.533	S	S	.	.	H	α-helix	trans	-68.2	-44.4	179	-61.4	0	0	0	0	112.1	Q57 F58 E59 G63 K64 L65	Q57-S61 VanDerWaalsContact O-CB 3.31Å; Q57-S61 WeakPolarHBondContact O-CB 3.31Å; Q57-S61 PolarHBondContact O-N 2.86Å; Q57-S61 PolarHBondContact O-OG 2.78Å; F58-S61 PolarHBondContact O-N 2.86Å; E59-S61 VanDerWaalsContact C-N 3.3Å; E59-S61 PolarHBondContact O-N 3.5Å; S61-G63 VanDerWaalsContact C-N 3.35Å; S61-G63 PolarHBondContact O-N 3.49Å; S61-K64 PolarHBondContact O-N 2.85Å; S61-L65 WeakPolarHBondContact O-CB 3.29Å; S61-L65 PolarHBondContact O-N 3.35Å
62	A	98.5	Very high	98.3	Very high	40 Å²	40	103.6 Å²	103.6	33%	0.331	52%	0.524	S	S	.	.	H	α-helix	trans	-62.1	-42	175.2	0	0	0	0	0	111.2	F58 E59 K64 L65 K66	F58-A62 HydrophobicContact CE1-CB 4.48Å; F58-A62 VanDerWaalsContact O-CB 3.29Å; F58-A62 WeakPolarHBondContact O-CB 3.48Å; F58-A62 PolarHBondContact O-N 3.37Å; E59-A62 PolarHBondContact O-N 3.21Å; A62-K64 PolarHBondContact O-N 3.05Å; A62-L65 PolarHBondContact O-N 2.99Å; A62-K66 WeakPolarHBondContact O-CB 3.39Å; A62-K66 PolarHBondContact O-N 3.45Å
63	G	98.3	Very high	98.3	Very high	20 Å²	20	102.1 Å²	102.1	21%	0.206	52%	0.52	C	S	.	.	H	α-helix	trans	-60.3	-44.3	173.5	0	0	0	0	0	112.4	E59 A60 S61 K66 R67	E59-G63 PolarHBondContact O-N 2.84Å; A60-G63 PolarHBondContact O-N 3.26Å; S61-G63 VanDerWaalsContact C-N 3.35Å; S61-G63 PolarHBondContact O-N 3.49Å; G63-K66 PolarHBondContact O-N 2.94Å; G63-R67 WeakPolarHBondContact O-CG 3.45Å; G63-R67 PolarHBondContact O-N 3.43Å; G63-R67 PolarHBondContact O-NH1 3.49Å
64	K	98.2	Very high	98.2	Very high	149 Å²	149	101.5 Å²	101.5	65%	0.648	51%	0.511	S	S	*	.	H	α-helix	trans	-63.3	-42.2	174.9	-174.3	177.6	-179.4	177.8	0	111.7	A60 S61 A62 R67 K68	A60-K64 PolarHBondContact O-N 3.24Å; S61-K64 PolarHBondContact O-N 2.85Å; A62-K64 PolarHBondContact O-N 3.05Å; K64-R67 PolarHBondContact O-N 3.49Å; K64-K68 WeakPolarHBondContact O-CB 3.4Å; K64-K68 PolarHBondContact O-N 3.33Å
65	L	98.4	Very high	98.2	Very high	94 Å²	94	107 Å²	107	49%	0.492	53%	0.525	S	S	.	.	H	α-helix	trans	-63	-48.3	177.7	-170	64	0	0	0	111.3	S61 A62 R67 K68 F69	S61-L65 WeakPolarHBondContact O-CB 3.29Å; S61-L65 PolarHBondContact O-N 3.35Å; A62-L65 PolarHBondContact O-N 2.99Å; L65-R67 VanDerWaalsContact C-N 3.34Å; L65-R67 PolarHBondContact O-N 3.35Å; L65-K68 WeakPolarHBondContact O-CB 3.32Å; L65-K68 PolarHBondContact O-N 3.08Å; L65-K68 VanDerWaalsContact O-N 3.14Å; L65-F69 HydrophobicContact CD1-CD2 3.88Å; L65-F69 HydrophobicContact CD1-CE2 3.6Å; L65-F69 HydrophobicContact CG-CD2 4.07Å; L65-F69 HydrophobicContact CG-CE2 4.12Å; L65-F69 WeakPolarHBondContact O-CD2 3.39Å; L65-F69 PolarHBondContact O-N 3.4Å
66	K	98.4	Very high	98.2	Very high	166 Å²	166	111.2 Å²	111.2	72%	0.722	53%	0.531	S	S	*	.	H	α-helix	trans	-54.5	-49.5	175.3	-177.3	178.5	180	178.7	0	111.1	A62 G63 K68 F69 W70	A62-K66 WeakPolarHBondContact O-CB 3.39Å; A62-K66 PolarHBondContact O-N 3.45Å; G63-K66 PolarHBondContact O-N 2.94Å; K66-K68 PolarHBondContact O-N 3.46Å; K66-F69 PolarHBondContact O-N 2.85Å; K66-W70 VanDerWaalsContact O-CB 3.32Å; K66-W70 WeakPolarHBondContact O-CB 3.41Å; K66-W70 PolarHBondContact O-N 3.46Å
67	R	98.3	Very high	98.2	Very high	145 Å²	145	109 Å²	109	55%	0.547	52%	0.519	S	S	.	.	H	α-helix	trans	-61.2	-42.5	177	-71.7	-174.1	-64	-88.3	4.1	112.4	G63 K64 L65 F69 W70 W71	G63-R67 WeakPolarHBondContact O-CG 3.45Å; G63-R67 PolarHBondContact O-N 3.43Å; G63-R67 PolarHBondContact O-NH1 3.49Å; K64-R67 PolarHBondContact O-N 3.49Å; L65-R67 VanDerWaalsContact C-N 3.34Å; L65-R67 PolarHBondContact O-N 3.35Å; R67-F69 PolarHBondContact O-N 2.96Å; R67-W70 PolarHBondContact O-N 3Å; R67-W71 PolarHBondContact O-N 2.91Å
68	K	98.4	Very high	98.2	Very high	123 Å²	123	105.5 Å²	105.5	54%	0.535	51%	0.511	S	S	.	.	H	α-helix	trans	-58.4	-47.3	177.5	-177.2	-178.4	-177.6	179	0	111.4	K64 L65 K66 K72	K64-K68 WeakPolarHBondContact O-CB 3.4Å; K64-K68 PolarHBondContact O-N 3.33Å; L65-K68 WeakPolarHBondContact O-CB 3.32Å; L65-K68 PolarHBondContact O-N 3.08Å; L65-K68 VanDerWaalsContact O-N 3.14Å; K66-K68 PolarHBondContact O-N 3.46Å; K68-K72 WeakPolarHBondContact O-CG 3.44Å; K68-K72 PolarHBondContact O-N 3.14Å; K68-K72 VanDerWaalsContact O-N 3.08Å
69	F	98.1	Very high	98.2	Very high	103 Å²	103	103.6 Å²	103.6	45%	0.452	50%	0.502	S	S	.	.	H	α-helix	trans	-72.4	-36.4	178.9	-84.1	-84.3	0	0	0	112.8	L65 K66 R67 W71 K72 N73	L65-F69 HydrophobicContact CD1-CD2 3.88Å; L65-F69 HydrophobicContact CD1-CE2 3.6Å; L65-F69 HydrophobicContact CG-CD2 4.07Å; L65-F69 HydrophobicContact CG-CE2 4.12Å; L65-F69 WeakPolarHBondContact O-CD2 3.39Å; L65-F69 PolarHBondContact O-N 3.4Å; K66-F69 PolarHBondContact O-N 2.85Å; R67-F69 PolarHBondContact O-N 2.96Å; F69-W71 PolarHBondContact O-N 3.4Å; F69-K72 PolarHBondContact O-N 2.87Å; F69-N73 WeakPolarHBondContact O-CB 3.42Å; F69-N73 PolarHBondContact O-N 2.87Å; F69-N73 PolarHBondContact O-OD1 2.98Å
70	W	98.2	Very high	98.2	Very high	148 Å²	148	100 Å²	100	56%	0.561	49%	0.487	S	S	*	.	H	α-helix	trans	-57.1	-49.4	173.1	-175.4	76.9	0	0	0	111.3	K66 R67 K72 N73 C74	K66-W70 VanDerWaalsContact O-CB 3.32Å; K66-W70 WeakPolarHBondContact O-CB 3.41Å; K66-W70 PolarHBondContact O-N 3.46Å; R67-W70 PolarHBondContact O-N 3Å; W70-K72 PolarHBondContact O-N 3.43Å; W70-N73 PolarHBondContact O-N 3.44Å; W70-C74 PolarHBondContact O-N 3.46Å; W70-C74 PolarHBondContact O-SG 3.36Å
71	W	98.1	Very high	98.2	Very high	144 Å²	144	102.3 Å²	102.3	55%	0.545	49%	0.491	S	S	.	.	H	α-helix	trans	-64.1	-38.2	176.1	-78.1	119	0	0	0	113.7	R67 F69 N73 K75	R67-W71 PolarHBondContact O-N 2.91Å; F69-W71 PolarHBondContact O-N 3.4Å; W71-N73 VanDerWaalsContact C-N 3.35Å; W71-K75 WeakPolarHBondContact O-CB 3.27Å; W71-K75 VanDerWaalsContact O-CG 3.27Å; W71-K75 WeakPolarHBondContact O-CG 3.4Å; W71-K75 PolarHBondContact O-N 3.22Å
72	K	97.9	Very high	98.1	Very high	110 Å²	110	106.6 Å²	106.6	48%	0.478	50%	0.501	S	S	.	.	H	α-helix	trans	-60.3	-46.1	173.6	-78.7	-176.8	172.2	-166.3	0	111.1	K68 F69 W70 K75 Y76	K68-K72 WeakPolarHBondContact O-CG 3.44Å; K68-K72 PolarHBondContact O-N 3.14Å; K68-K72 VanDerWaalsContact O-N 3.08Å; F69-K72 PolarHBondContact O-N 2.87Å; W70-K72 PolarHBondContact O-N 3.43Å; K72-K75 PolarHBondContact O-N 3.23Å; K72-Y76 WeakPolarHBondContact O-CB 3.34Å; K72-Y76 PolarHBondContact O-N 3.31Å
73	N	97.8	Very high	98.1	Very high	109 Å²	109	110.4 Å²	110.4	58%	0.583	51%	0.51	S	S	*	.	H	α-helix	trans	-66.6	-42.1	179.8	-68.1	-6	0	0	0	111.5	F69 W70 W71 Y76 G77	F69-N73 WeakPolarHBondContact O-CB 3.42Å; F69-N73 PolarHBondContact O-N 2.87Å; F69-N73 PolarHBondContact O-OD1 2.98Å; W70-N73 PolarHBondContact O-N 3.44Å; W71-N73 VanDerWaalsContact C-N 3.35Å; N73-Y76 PolarHBondContact O-N 3.38Å; N73-G77 PolarHBondContact O-N 3.32Å
74	C	97.7	Very high	98.1	Very high	49 Å²	49	114.8 Å²	114.8	33%	0.331	53%	0.527	S	S	.	.	H	α-helix	trans	-60	-47.8	174	-69.8	0	0	0	0	111.8	W70 Y76 G77 S78	W70-C74 PolarHBondContact O-N 3.46Å; W70-C74 PolarHBondContact O-SG 3.36Å; C74-Y76 PolarHBondContact O-N 3.01Å; C74-G77 PolarHBondContact O-N 2.99Å; C74-S78 PolarHBondContact O-N 2.84Å; C74-S78 PolarHBondContact O-OG 3.43Å
75	K	98.1	Very high	98.1	Very high	152 Å²	152	115.2 Å²	115.2	66%	0.661	53%	0.53	S	S	*	.	H	α-helix	trans	-61.1	-43.9	177.4	-74.4	176.7	179.6	-176.3	0	111.9	W71 K72 S78 F79	W71-K75 WeakPolarHBondContact O-CB 3.27Å; W71-K75 VanDerWaalsContact O-CG 3.27Å; W71-K75 WeakPolarHBondContact O-CG 3.4Å; W71-K75 PolarHBondContact O-N 3.22Å; K72-K75 PolarHBondContact O-N 3.23Å; K75-S78 PolarHBondContact O-N 2.99Å; K75-F79 PolarHBondContact O-N 3.47Å
76	Y	98.3	Very high	98	Very high	142 Å²	142	116.4 Å²	116.4	56%	0.557	54%	0.536	S	S	*	.	H	α-helix	trans	-63.3	-42.5	176.7	-174.3	-108.3	0	0	0	111.7	K72 N73 C74 S78 F79 L80	K72-Y76 WeakPolarHBondContact O-CB 3.34Å; K72-Y76 PolarHBondContact O-N 3.31Å; N73-Y76 PolarHBondContact O-N 3.38Å; C74-Y76 PolarHBondContact O-N 3.01Å; Y76-S78 PolarHBondContact O-N 3.24Å; Y76-F79 PolarHBondContact O-N 3.47Å; Y76-L80 HydrophobicContact CD1-CD1 3.7Å; Y76-L80 HydrophobicContact CD1-CG 4.14Å; Y76-L80 HydrophobicContact CE1-CD1 3.27Å; Y76-L80 HydrophobicContact CE1-CD2 4.26Å; Y76-L80 HydrophobicContact CE1-CG 3.8Å; Y76-L80 HydrophobicContact CE2-CD2 4.45Å; Y76-L80 HydrophobicContact CE2-CG 4.38Å; Y76-L80 WeakPolarHBondContact O-CG 3.46Å; Y76-L80 PolarHBondContact O-N 2.8Å
77	G	98.3	Very high	98	Very high	24 Å²	24	112.9 Å²	112.9	25%	0.247	53%	0.525	C	S	.	.	H	α-helix	trans	-57.5	-45.2	173.4	0	0	0	0	0	112.5	N73 C74 F79 L80 N81	N73-G77 PolarHBondContact O-N 3.32Å; C74-G77 PolarHBondContact O-N 2.99Å; G77-F79 PolarHBondContact O-N 3.45Å; G77-L80 PolarHBondContact O-N 3.07Å; G77-N81 PolarHBondContact O-N 3.23Å; G77-N81 PolarHBondContact O-ND2 3.27Å
78	S	98.1	Very high	98	Very high	71 Å²	71	113.7 Å²	113.7	50%	0.497	53%	0.532	S	S	.	.	H	α-helix	trans	-64	-39.2	175.5	-56.7	0	0	0	0	112.8	C74 K75 Y76 K82	C74-S78 PolarHBondContact O-N 2.84Å; C74-S78 PolarHBondContact O-OG 3.43Å; K75-S78 PolarHBondContact O-N 2.99Å; Y76-S78 PolarHBondContact O-N 3.24Å; S78-K82 WeakPolarHBondContact O-CG 3.5Å; S78-K82 PolarHBondContact O-N 2.96Å
79	F	97.6	Very high	98	Very high	114 Å²	114	112.1 Å²	112.1	50%	0.5	53%	0.533	S	S	.	.	H	α-helix	trans	-64.2	-46.3	176.4	175.2	-98.7	0	0	0	112.1	K75 Y76 G77 N81 K82 K83	K75-F79 PolarHBondContact O-N 3.47Å; Y76-F79 PolarHBondContact O-N 3.47Å; G77-F79 PolarHBondContact O-N 3.45Å; F79-N81 PolarHBondContact O-N 2.9Å; F79-K82 PolarHBondContact O-N 3.49Å; F79-K83 HydrophobicContact CD1-CG 4.45Å; F79-K83 HydrophobicContact CE1-CG 3.94Å; F79-K83 HydrophobicContact CE2-CG 4.41Å; F79-K83 HydrophobicContact CZ-CD 4.45Å; F79-K83 HydrophobicContact CZ-CG 3.92Å; F79-K83 PolarHBondContact O-N 3.18Å
80	L	98.3	Very high	97.9	Very high	66 Å²	66	111.2 Å²	111.2	35%	0.346	53%	0.532	S	S	.	.	H	α-helix	trans	-59.4	-45.3	176.8	-75.4	179.9	0	0	0	112.1	Y76 G77 K82 K83 I84	Y76-L80 HydrophobicContact CD1-CD1 3.7Å; Y76-L80 HydrophobicContact CD1-CG 4.14Å; Y76-L80 HydrophobicContact CE1-CD1 3.27Å; Y76-L80 HydrophobicContact CE1-CD2 4.26Å; Y76-L80 HydrophobicContact CE1-CG 3.8Å; Y76-L80 HydrophobicContact CE2-CD2 4.45Å; Y76-L80 HydrophobicContact CE2-CG 4.38Å; Y76-L80 WeakPolarHBondContact O-CG 3.46Å; Y76-L80 PolarHBondContact O-N 2.8Å; G77-L80 PolarHBondContact O-N 3.07Å; L80-K82 VanDerWaalsContact C-N 3.31Å; L80-K82 PolarHBondContact O-N 3.38Å; L80-K83 WeakPolarHBondContact O-CB 3.34Å; L80-K83 PolarHBondContact O-N 3.44Å; L80-K83 VanDerWaalsContact O-N 3.17Å; L80-I84 WeakPolarHBondContact O-CG1 3.49Å; L80-I84 PolarHBondContact O-N 2.87Å
81	N	98.3	Very high	97.8	Very high	111 Å²	111	108.1 Å²	108.1	59%	0.594	53%	0.526	S	S	*	.	H	α-helix	trans	-59.5	-41.6	177.2	-82.9	-72.7	0	0	0	112.2	G77 F79 I84 K85	G77-N81 PolarHBondContact O-N 3.23Å; G77-N81 PolarHBondContact O-ND2 3.27Å; F79-N81 PolarHBondContact O-N 2.9Å; N81-I84 PolarHBondContact O-N 3.17Å; N81-K85 PolarHBondContact O-N 3.34Å
82	K	98	Very high	97.7	Very high	158 Å²	158	106.9 Å²	106.9	69%	0.687	53%	0.526	S	S	*	.	H	α-helix	trans	-62.5	-44.8	174.4	-73.6	177.5	179	-177.3	0	111.9	S78 F79 L80 K85 L86	S78-K82 WeakPolarHBondContact O-CG 3.5Å; S78-K82 PolarHBondContact O-N 2.96Å; F79-K82 PolarHBondContact O-N 3.49Å; L80-K82 VanDerWaalsContact C-N 3.31Å; L80-K82 PolarHBondContact O-N 3.38Å; K82-K85 PolarHBondContact O-N 3.18Å; K82-L86 WeakPolarHBondContact O-CB 3.46Å; K82-L86 PolarHBondContact O-N 3.01Å
83	K	97.9	Very high	97.6	Very high	121 Å²	121	107.2 Å²	107.2	53%	0.526	53%	0.533	S	S	.	.	H	α-helix	trans	-60.7	-44.3	176.4	-85.6	-82.3	-175.7	168.7	0	112.1	F79 L80 L86 N87	F79-K83 HydrophobicContact CD1-CG 4.45Å; F79-K83 HydrophobicContact CE1-CG 3.94Å; F79-K83 HydrophobicContact CE2-CG 4.41Å; F79-K83 HydrophobicContact CZ-CD 4.45Å; F79-K83 HydrophobicContact CZ-CG 3.92Å; F79-K83 PolarHBondContact O-N 3.18Å; L80-K83 WeakPolarHBondContact O-CB 3.34Å; L80-K83 PolarHBondContact O-N 3.44Å; L80-K83 VanDerWaalsContact O-N 3.17Å; K83-L86 PolarHBondContact O-N 3.3Å; K83-N87 WeakPolarHBondContact O-CB 3.34Å; K83-N87 PolarHBondContact O-N 3.07Å
84	I	98.2	Very high	97.4	Very high	111 Å²	111	108 Å²	108	57%	0.569	54%	0.535	S	S	*	.	H	α-helix	trans	-61.2	-46	176.6	-69.9	160.1	0	0	0	110.7	L80 N81 L86 N87 K88	L80-I84 WeakPolarHBondContact O-CG1 3.49Å; L80-I84 PolarHBondContact O-N 2.87Å; N81-I84 PolarHBondContact O-N 3.17Å; I84-L86 PolarHBondContact O-N 3.26Å; I84-N87 PolarHBondContact O-N 2.9Å; I84-K88 WeakPolarHBondContact O-CB 3.39Å; I84-K88 PolarHBondContact O-N 2.87Å
85	K	97.5	Very high	97.4	Very high	159 Å²	159	112 Å²	112	69%	0.691	55%	0.552	S	S	*	*	H	α-helix	trans	-61.5	-44.4	178.1	-169.8	173.4	-177	177.2	0	111.8	N81 K82 K88 V89	N81-K85 PolarHBondContact O-N 3.34Å; K82-K85 PolarHBondContact O-N 3.18Å; K85-K88 PolarHBondContact O-N 3.37Å; K85-V89 WeakPolarHBondContact O-CG2 3.46Å; K85-V89 PolarHBondContact O-N 2.92Å
86	L	97.5	Very high	97	Very high	119 Å²	119	112.8 Å²	112.8	62%	0.623	56%	0.563	S	S	*	*	H	α-helix	trans	-63.7	-43.3	176.7	-173	68	0	0	0	111.7	K82 K83 I84 K88 V89 N90	K82-L86 WeakPolarHBondContact O-CB 3.46Å; K82-L86 PolarHBondContact O-N 3.01Å; K83-L86 PolarHBondContact O-N 3.3Å; I84-L86 PolarHBondContact O-N 3.26Å; L86-K88 VanDerWaalsContact C-N 3.32Å; L86-K88 PolarHBondContact O-N 3.45Å; L86-V89 PolarHBondContact O-N 3.48Å; L86-N90 PolarHBondContact O-N 3.36Å
87	N	97.9	Very high	96.9	Very high	92 Å²	92	111.4 Å²	111.4	49%	0.492	56%	0.563	S	S	.	*	H	α-helix	trans	-62.6	-40.3	177.3	-167.3	50.9	0	0	0	111.7	K83 I84 V89 N90 I91	K83-N87 WeakPolarHBondContact O-CB 3.34Å; K83-N87 PolarHBondContact O-N 3.07Å; I84-N87 PolarHBondContact O-N 2.9Å; N87-V89 PolarHBondContact O-N 3.16Å; N87-N90 PolarHBondContact O-N 3.37Å; N87-I91 WeakPolarHBondContact O-CG1 3.38Å; N87-I91 PolarHBondContact O-N 3.28Å
88	K	97.6	Very high	96.9	Very high	162 Å²	162	115.9 Å²	115.9	70%	0.704	58%	0.58	S	S	*	*	H	α-helix	trans	-62.3	-41.8	175.3	-172	174.2	-177.6	176	0	112.1	I84 K85 L86 H92	I84-K88 WeakPolarHBondContact O-CB 3.39Å; I84-K88 PolarHBondContact O-N 2.87Å; K85-K88 PolarHBondContact O-N 3.37Å; L86-K88 VanDerWaalsContact C-N 3.32Å; L86-K88 PolarHBondContact O-N 3.45Å; K88-H92 PolarHBondContact O-N 3.5Å; K88-H92 VanDerWaalsContact O-N 3.09Å
89	V	97.7	Very high	96.8	Very high	89 Å²	89	118.4 Å²	118.4	54%	0.539	58%	0.584	S	S	.	*	H	α-helix	trans	-64.7	-42.3	175	172.9	0	0	0	0	111.1	K85 L86 N87 H92 L93	K85-V89 WeakPolarHBondContact O-CG2 3.46Å; K85-V89 PolarHBondContact O-N 2.92Å; L86-V89 PolarHBondContact O-N 3.48Å; N87-V89 PolarHBondContact O-N 3.16Å; V89-H92 PolarHBondContact O-N 3.42Å; V89-L93 PolarHBondContact O-N 3.08Å
90	N	96.8	Very high	96.8	Very high	84 Å²	84	118.7 Å²	118.7	45%	0.449	59%	0.589	S	S	.	*	H	α-helix	trans	-63.5	-45.7	178.4	-168.8	8	0	0	0	112.1	L86 N87 H92 L93 I94	L86-N90 PolarHBondContact O-N 3.36Å; N87-N90 PolarHBondContact O-N 3.37Å; N90-H92 VanDerWaalsContact C-N 3.28Å; N90-H92 PolarHBondContact O-N 3.28Å; N90-L93 PolarHBondContact O-N 3.09Å; N90-L93 VanDerWaalsContact O-N 3.16Å; N90-I94 WeakPolarHBondContact O-CG1 3.33Å; N90-I94 PolarHBondContact O-N 2.93Å; N90-I94 VanDerWaalsContact O-N 3.08Å
91	I	97	Very high	96.7	Very high	83 Å²	83	122 Å²	122	43%	0.426	61%	0.605	S	S	.	*	H	α-helix	trans	-59.4	-41.8	175.3	-68.9	166.1	0	0	0	110.9	N87 L93 I94 I95	N87-I91 WeakPolarHBondContact O-CG1 3.38Å; N87-I91 PolarHBondContact O-N 3.28Å; I91-L93 VanDerWaalsContact C-N 3.33Å; I91-L93 PolarHBondContact O-N 3.27Å; I91-I94 PolarHBondContact O-N 3.24Å; I91-I95 HydrophobicContact CG2-CD1 3.69Å; I91-I95 WeakPolarHBondContact O-CG1 3.36Å; I91-I95 PolarHBondContact O-N 3.01Å
92	H	95.3	Very high	96.6	Very high	118 Å²	118	122.7 Å²	122.7	55%	0.546	61%	0.605	S	S	.	*	H	α-helix	trans	-62.2	-41.1	177.1	-173.6	55.6	0	0	0	112.1	K88 V89 N90 I94 I95 L96	K88-H92 PolarHBondContact O-N 3.5Å; K88-H92 VanDerWaalsContact O-N 3.09Å; V89-H92 PolarHBondContact O-N 3.42Å; N90-H92 VanDerWaalsContact C-N 3.28Å; N90-H92 PolarHBondContact O-N 3.28Å; H92-I94 VanDerWaalsContact C-N 3.3Å; H92-I94 PolarHBondContact O-N 3.46Å; H92-I95 PolarHBondContact O-N 3.27Å; H92-L96 WeakPolarHBondContact O-CG 3.4Å; H92-L96 PolarHBondContact O-N 3.32Å
93	L	94.9	Very high	96.5	Very high	118 Å²	118	120.2 Å²	120.2	62%	0.618	60%	0.599	S	S	*	*	H	α-helix	trans	-65.6	-30.9	177.5	-176.3	61.4	0	0	0	113.1	V89 N90 I91	V89-L93 PolarHBondContact O-N 3.08Å; N90-L93 PolarHBondContact O-N 3.09Å; N90-L93 VanDerWaalsContact O-N 3.16Å; I91-L93 VanDerWaalsContact C-N 3.33Å; I91-L93 PolarHBondContact O-N 3.27Å
94	I	95.5	Very high	96.3	Very high	124 Å²	124	120.2 Å²	120.2	64%	0.636	61%	0.605	S	S	*	*	H	α-helix	trans	-75.8	-27.2	178.4	-67.8	165.5	0	0	0	112.1	N90 I91 H92	N90-I94 WeakPolarHBondContact O-CG1 3.33Å; N90-I94 PolarHBondContact O-N 2.93Å; N90-I94 VanDerWaalsContact O-N 3.08Å; I91-I94 PolarHBondContact O-N 3.24Å; H92-I94 VanDerWaalsContact C-N 3.3Å; H92-I94 PolarHBondContact O-N 3.46Å
95	I	95.8	Very high	96.2	Very high	133 Å²	133	120.9 Å²	120.9	68%	0.682	61%	0.608	S	S	*	*	H	α-helix	trans	-87.7	-17.4	-177.9	-65.8	168.1	0	0	0	112	I91 H92	I91-I95 HydrophobicContact CG2-CD1 3.69Å; I91-I95 WeakPolarHBondContact O-CG1 3.36Å; I91-I95 PolarHBondContact O-N 3.01Å; H92-I95 PolarHBondContact O-N 3.27Å
96	L	90.9	Very high	96.1	Very high	170 Å²	170	117.5 Å²	117.5	89%	0.89	60%	0.601	S	S	*	*			trans	-82.1	0	172.8	-71.2	173	0	0	0	111.1	H92	H92-L96 WeakPolarHBondContact O-CG 3.4Å; H92-L96 PolarHBondContact O-N 3.32Å

Retrieved 96 of 96 residues in 135.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).