A0A5K4ETS1_SCHMA Loading...

Rhomboid domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4ETS1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 104 aa.

						>A0A5K4ETS1_SCHMA|A0A5K4ETS1
MAFLGGYTVSLIASVLEYAKAHELGLSLNSTGLQCIRYVVTGTAAAICHSSVSFISAKATGRSDSWVNHALGGAASGLICTWNRKMKSLKTTLQFLSPYKNIGV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.4	Low	82.6	Confident	206 Å²	206	77.3 Å²	77.3	100%	1.015	43%	0.426	S	S	*	.				0	-24.1	0	-62.7	-47.8	-172.7	0	0	115.1	F3 L4 G5	M1-F3 PolarHBondContact O-N 2.99Å; M1-L4 PolarHBondContact O-N 3.2Å; M1-G5 PolarHBondContact O-N 3.36Å
2	A	73.8	Confident	83.4	Confident	30 Å²	30	78.7 Å²	78.7	25%	0.248	43%	0.431	C	S	.	.	H	α-helix	trans	-62.9	-38.3	-173.5	0	0	0	0	0	114.1	L4 G5 G6 A46 S50	A2-L4 PolarHBondContact O-N 3.48Å; A2-G5 PolarHBondContact O-N 3.19Å; A2-G6 PolarHBondContact O-N 3.02Å; A2-A46 VanDerWaalsContact O-CB 3.29Å; A2-A46 WeakPolarHBondContact O-CB 3.29Å; A2-S50 WeakPolarHBondContact CB-OG 3.29Å
3	F	78.1	Confident	83.9	Confident	111 Å²	111	75.6 Å²	75.6	49%	0.487	42%	0.422	S	S	.	.	H	α-helix	trans	-53.9	-55	177.4	175.8	-94.5	0	0	0	112.6	M1 G5 G6 Y7 T43 I47	M1-F3 PolarHBondContact O-N 2.99Å; F3-G5 VanDerWaalsContact C-N 3.28Å; F3-G5 PolarHBondContact O-N 3.3Å; F3-G6 PolarHBondContact O-N 2.89Å; F3-Y7 WeakPolarHBondContact O-CB 3.46Å; F3-Y7 PolarHBondContact O-N 2.92Å; F3-T43 HydrophobicContact CD2-CG2 3.99Å; F3-T43 HydrophobicContact CE2-CG2 3.36Å; F3-T43 HydrophobicContact CZ-CG2 4.13Å; F3-I47 HydrophobicContact CD2-CD1 4.22Å; F3-I47 HydrophobicContact CD2-CG1 3.88Å; F3-I47 HydrophobicContact CE2-CD1 4.23Å; F3-I47 HydrophobicContact CE2-CG1 4.39Å
4	L	82.7	Confident	84.3	Confident	107 Å²	107	70.7 Å²	70.7	56%	0.56	40%	0.396	S	S	*	.	H	α-helix	trans	-61.7	-40.1	179.8	-174.4	63.4	0	0	0	110.9	M1 A2 Y7 T8	M1-L4 PolarHBondContact O-N 3.2Å; A2-L4 PolarHBondContact O-N 3.48Å; L4-Y7 PolarHBondContact O-N 3.32Å; L4-T8 WeakPolarHBondContact O-CB 3.38Å; L4-T8 PolarHBondContact O-N 3.13Å; L4-T8 PolarHBondContact O-OG1 3.45Å
5	G	85.5	Confident	84.8	Confident	37 Å²	37	72 Å²	72	38%	0.381	41%	0.406	S	S	.	.	H	α-helix	trans	-60.2	-48.9	175.3	0	0	0	0	0	112.9	M1 A2 F3 T8 V9	M1-G5 PolarHBondContact O-N 3.36Å; A2-G5 PolarHBondContact O-N 3.19Å; F3-G5 VanDerWaalsContact C-N 3.28Å; F3-G5 PolarHBondContact O-N 3.3Å; G5-T8 PolarHBondContact O-N 3.47Å; G5-V9 VanDerWaalsContact O-CG2 3.27Å; G5-V9 WeakPolarHBondContact O-CG2 3.2Å; G5-V9 PolarHBondContact O-N 3.36Å
6	G	82	Confident	85.3	Confident	16 Å²	16	73.8 Å²	73.8	17%	0.165	41%	0.413	C	S	.	.	H	α-helix	trans	-64.3	-41.6	178	0	0	0	0	0	113.3	A2 F3 S10	A2-G6 PolarHBondContact O-N 3.02Å; F3-G6 PolarHBondContact O-N 2.89Å; G6-S10 WeakPolarHBondContact O-CB 3.36Å; G6-S10 PolarHBondContact O-N 3.02Å; G6-S10 PolarHBondContact O-OG 3.01Å
7	Y	84	Confident	85.6	Confident	96 Å²	96	73.1 Å²	73.1	38%	0.376	41%	0.406	S	S	.	.	H	α-helix	trans	-60.2	-51.8	175.2	178	-97.1	0	0	0	111.3	F3 L4 V9 S10 L11 V39	F3-Y7 WeakPolarHBondContact O-CB 3.46Å; F3-Y7 PolarHBondContact O-N 2.92Å; L4-Y7 PolarHBondContact O-N 3.32Å; Y7-V9 PolarHBondContact O-N 3.26Å; Y7-S10 PolarHBondContact O-N 3.39Å; Y7-L11 HydrophobicContact CE1-CD2 4.08Å; Y7-L11 WeakPolarHBondContact O-CB 3.47Å; Y7-L11 PolarHBondContact O-N 3.45Å; Y7-V39 HydrophobicContact CD2-CG1 4.07Å; Y7-V39 HydrophobicContact CE2-CG1 3.89Å
8	T	88.8	Confident	85.8	Confident	63 Å²	63	74.7 Å²	74.7	39%	0.387	41%	0.405	S	S	.	.	H	α-helix	trans	-61.4	-46.5	-178.5	-60.4	0	0	0	0	111.9	L4 G5 S10 L11 I12	L4-T8 WeakPolarHBondContact O-CB 3.38Å; L4-T8 PolarHBondContact O-N 3.13Å; L4-T8 PolarHBondContact O-OG1 3.45Å; G5-T8 PolarHBondContact O-N 3.47Å; T8-S10 VanDerWaalsContact C-N 3.29Å; T8-S10 PolarHBondContact O-N 2.98Å; T8-L11 PolarHBondContact O-N 3.41Å; T8-I12 HydrophobicContact CG2-CD1 3.94Å; T8-I12 VanDerWaalsContact O-CG1 3.3Å; T8-I12 WeakPolarHBondContact O-CG1 3.19Å; T8-I12 PolarHBondContact O-N 3.13Å
9	V	89.5	Confident	86.1	Confident	99 Å²	99	73.1 Å²	73.1	60%	0.6	40%	0.404	S	S	*	.	H	α-helix	trans	-61.1	-40.5	178.1	172	0	0	0	0	111.2	G5 Y7 I12 A13	G5-V9 VanDerWaalsContact O-CG2 3.27Å; G5-V9 WeakPolarHBondContact O-CG2 3.2Å; G5-V9 PolarHBondContact O-N 3.36Å; Y7-V9 PolarHBondContact O-N 3.26Å; V9-I12 PolarHBondContact O-N 2.96Å; V9-A13 WeakPolarHBondContact O-CB 3.35Å; V9-A13 PolarHBondContact O-N 3.19Å
10	S	87.7	Confident	86.4	Confident	12 Å²	12	74.7 Å²	74.7	8%	0.084	41%	0.406	C	S	.	.	H	α-helix	trans	-72.3	-34.2	-179.9	-53	0	0	0	0	112.8	G6 Y7 T8 S14 Y38 G42	G6-S10 WeakPolarHBondContact O-CB 3.36Å; G6-S10 PolarHBondContact O-N 3.02Å; G6-S10 PolarHBondContact O-OG 3.01Å; Y7-S10 PolarHBondContact O-N 3.39Å; T8-S10 VanDerWaalsContact C-N 3.29Å; T8-S10 PolarHBondContact O-N 2.98Å; S10-S14 WeakPolarHBondContact O-CB 3.4Å; S10-S14 PolarHBondContact O-N 3.4Å; S10-S14 PolarHBondContact O-OG 3.16Å; S10-Y38 WeakPolarHBondContact CB-O 3.46Å; S10-Y38 PolarHBondContact OG-O 3.05Å; S10-G42 VanDerWaalsContact OG-CA 3.26Å; S10-G42 WeakPolarHBondContact OG-CA 3.33Å
11	L	91.2	Very high	86.6	Confident	73 Å²	73	71.2 Å²	71.2	38%	0.382	39%	0.388	S	S	.	.	H	α-helix	trans	-65.9	-46.3	174.3	-174.6	66.3	0	0	0	110.5	Y7 T8 A13 S14 V15	Y7-L11 HydrophobicContact CE1-CD2 4.08Å; Y7-L11 WeakPolarHBondContact O-CB 3.47Å; Y7-L11 PolarHBondContact O-N 3.45Å; T8-L11 PolarHBondContact O-N 3.41Å; L11-A13 VanDerWaalsContact C-N 3.34Å; L11-A13 PolarHBondContact O-N 2.77Å; L11-S14 WeakPolarHBondContact O-CB 3.37Å; L11-S14 PolarHBondContact O-N 3.47Å; L11-S14 VanDerWaalsContact O-N 3.13Å; L11-V15 WeakPolarHBondContact O-CG2 3.42Å; L11-V15 PolarHBondContact O-N 3.4Å
12	I	92	Very high	87.7	Confident	94 Å²	94	67.9 Å²	67.9	48%	0.482	37%	0.369	S	S	.	.	H	α-helix	trans	-58.6	-47.1	175.4	-67.1	165.7	0	0	0	110.5	T8 V9 S14 V15 L16	T8-I12 HydrophobicContact CG2-CD1 3.94Å; T8-I12 VanDerWaalsContact O-CG1 3.3Å; T8-I12 WeakPolarHBondContact O-CG1 3.19Å; T8-I12 PolarHBondContact O-N 3.13Å; V9-I12 PolarHBondContact O-N 2.96Å; I12-S14 VanDerWaalsContact C-N 3.27Å; I12-S14 PolarHBondContact O-N 3.42Å; I12-V15 PolarHBondContact O-N 2.84Å; I12-L16 HydrophobicContact CG2-CD1 4.08Å; I12-L16 HydrophobicContact CG2-CG 4.45Å; I12-L16 WeakPolarHBondContact O-CG 3.42Å; I12-L16 PolarHBondContact O-N 3.39Å
13	A	89.7	Confident	88.6	Confident	39 Å²	39	74.1 Å²	74.1	32%	0.322	39%	0.393	S	S	.	.	H	α-helix	trans	-58.9	-40.5	176.5	0	0	0	0	0	112.1	V9 L11 L16 E17	V9-A13 WeakPolarHBondContact O-CB 3.35Å; V9-A13 PolarHBondContact O-N 3.19Å; L11-A13 VanDerWaalsContact C-N 3.34Å; L11-A13 PolarHBondContact O-N 2.77Å; A13-L16 PolarHBondContact O-N 3.19Å; A13-E17 WeakPolarHBondContact O-CB 3.43Å; A13-E17 WeakPolarHBondContact O-CG 3.2Å; A13-E17 PolarHBondContact O-N 3.39Å
14	S	89.3	Confident	89.4	Confident	7 Å²	7	74.8 Å²	74.8	5%	0.049	40%	0.401	C	S	.	.	H	α-helix	trans	-64.5	-44.3	176.5	-59.4	0	0	0	0	112.3	S10 L11 I12 E17 Y18 C35	S10-S14 WeakPolarHBondContact O-CB 3.4Å; S10-S14 PolarHBondContact O-N 3.4Å; S10-S14 PolarHBondContact O-OG 3.16Å; L11-S14 WeakPolarHBondContact O-CB 3.37Å; L11-S14 PolarHBondContact O-N 3.47Å; L11-S14 VanDerWaalsContact O-N 3.13Å; I12-S14 VanDerWaalsContact C-N 3.27Å; I12-S14 PolarHBondContact O-N 3.42Å; S14-E17 PolarHBondContact O-N 3Å; S14-Y18 WeakPolarHBondContact O-CB 3.4Å; S14-Y18 PolarHBondContact O-N 3.1Å; S14-C35 PolarHBondContact O-SG 2.95Å; S14-C35 PolarHBondContact OG-O 3.39Å; S14-C35 VanDerWaalsContact OG-O 3.14Å
15	V	92.4	Very high	89.7	Confident	90 Å²	90	73 Å²	73	55%	0.545	41%	0.409	S	S	.	.	H	α-helix	trans	-61.6	-45.9	177.7	170.7	0	0	0	0	110.7	L11 I12 E17 Y18 A19	L11-V15 WeakPolarHBondContact O-CG2 3.42Å; L11-V15 PolarHBondContact O-N 3.4Å; I12-V15 PolarHBondContact O-N 2.84Å; V15-E17 VanDerWaalsContact C-N 3.32Å; V15-E17 PolarHBondContact O-N 2.91Å; V15-Y18 PolarHBondContact O-N 3.27Å; V15-A19 WeakPolarHBondContact O-CB 3.34Å; V15-A19 PolarHBondContact O-N 3.3Å
16	L	93	Very high	89.8	Confident	100 Å²	100	75.9 Å²	75.9	52%	0.524	42%	0.415	S	S	.	.	H	α-helix	trans	-61.8	-40.5	177.9	-68.8	174	0	0	0	112.1	I12 A13 K20	I12-L16 HydrophobicContact CG2-CD1 4.08Å; I12-L16 HydrophobicContact CG2-CG 4.45Å; I12-L16 WeakPolarHBondContact O-CG 3.42Å; I12-L16 PolarHBondContact O-N 3.39Å; A13-L16 PolarHBondContact O-N 3.19Å; L16-K20 WeakPolarHBondContact O-CB 3.48Å; L16-K20 VanDerWaalsContact O-CG 3.26Å; L16-K20 WeakPolarHBondContact O-CG 3.38Å; L16-K20 PolarHBondContact O-N 3.32Å
17	E	89.6	Confident	90.1	Very high	63 Å²	63	78.5 Å²	78.5	29%	0.294	43%	0.431	S	S	.	.	H	α-helix	trans	-73	-36.4	-179.6	-71.5	-81.1	124.8	0	0	112	A13 S14 V15 K20 A21 Y38	A13-E17 WeakPolarHBondContact O-CB 3.43Å; A13-E17 WeakPolarHBondContact O-CG 3.2Å; A13-E17 PolarHBondContact O-N 3.39Å; S14-E17 PolarHBondContact O-N 3Å; V15-E17 VanDerWaalsContact C-N 3.32Å; V15-E17 PolarHBondContact O-N 2.91Å; E17-K20 IonicContact OE1-NZ 3.48Å; E17-K20 PolarHBondContact OE1-NZ 3.02Å; E17-A21 WeakPolarHBondContact O-CB 3.39Å; E17-A21 PolarHBondContact O-N 3.44Å; E17-Y38 HydrophobicContact CB-CE2 3.99Å; E17-Y38 HydrophobicContact CG-CD2 4.44Å; E17-Y38 HydrophobicContact CG-CE2 3.62Å; E17-Y38 PolarHBondContact OE2-OH 3.4Å
18	Y	89.5	Confident	90.3	Very high	101 Å²	101	77 Å²	77	40%	0.396	43%	0.429	S	S	.	.	H	α-helix	trans	-66.6	-43.1	172.9	-161	-90.3	0	0	0	112.1	S14 V15 A21 H22 L28 T31	S14-Y18 WeakPolarHBondContact O-CB 3.4Å; S14-Y18 PolarHBondContact O-N 3.1Å; V15-Y18 PolarHBondContact O-N 3.27Å; Y18-A21 PolarHBondContact O-N 3.4Å; Y18-H22 PolarHBondContact O-N 2.98Å; Y18-L28 HydrophobicContact CE1-CD2 4.34Å; Y18-L28 HydrophobicContact CE2-CB 4.43Å; Y18-L28 HydrophobicContact CE2-CD2 4.38Å; Y18-T31 HydrophobicContact CD2-CG2 4.22Å
19	A	92	Very high	90.3	Very high	45 Å²	45	81 Å²	81	37%	0.372	45%	0.448	S	S	.	.	H	α-helix	trans	-60.2	-46.8	176	0	0	0	0	0	111.6	V15 A21 H22 E23	V15-A19 WeakPolarHBondContact O-CB 3.34Å; V15-A19 PolarHBondContact O-N 3.3Å; A19-A21 VanDerWaalsContact C-N 3.33Å; A19-A21 PolarHBondContact O-N 3.29Å; A19-H22 WeakPolarHBondContact O-CB 3.25Å; A19-H22 PolarHBondContact O-N 3.44Å; A19-H22 VanDerWaalsContact O-N 3.17Å; A19-E23 PolarHBondContact O-N 3.49Å
20	K	91.4	Very high	90	Very high	105 Å²	105	79.3 Å²	79.3	46%	0.457	44%	0.441	S	S	.	.	H	α-helix	trans	-59.5	-41.6	174.6	-74.3	174.2	-175	176	0	112.7	L16 E17 H22 E23 L24	L16-K20 WeakPolarHBondContact O-CB 3.48Å; L16-K20 VanDerWaalsContact O-CG 3.26Å; L16-K20 WeakPolarHBondContact O-CG 3.38Å; L16-K20 PolarHBondContact O-N 3.32Å; E17-K20 IonicContact OE1-NZ 3.48Å; E17-K20 PolarHBondContact OE1-NZ 3.02Å; K20-H22 VanDerWaalsContact C-N 3.28Å; K20-H22 PolarHBondContact O-N 2.98Å; K20-E23 PolarHBondContact O-N 2.72Å; K20-L24 WeakPolarHBondContact O-CB 3.38Å; K20-L24 VanDerWaalsContact O-CG 3.29Å; K20-L24 WeakPolarHBondContact O-CG 3.36Å; K20-L24 PolarHBondContact O-N 3.14Å
21	A	90.2	Very high	90	Very high	2 Å²	2	79.3 Å²	79.3	2%	0.017	44%	0.44	C	S	.	.	H	α-helix	trans	-64.9	-35	178.2	0	0	0	0	0	112.4	E17 Y18 A19 G25 L26 L28 T31	E17-A21 WeakPolarHBondContact O-CB 3.39Å; E17-A21 PolarHBondContact O-N 3.44Å; Y18-A21 PolarHBondContact O-N 3.4Å; A19-A21 VanDerWaalsContact C-N 3.33Å; A19-A21 PolarHBondContact O-N 3.29Å; A21-G25 PolarHBondContact O-N 3.28Å; A21-L26 HydrophobicContact CB-CB 4.02Å; A21-L26 PolarHBondContact O-N 3.19Å; A21-L28 HydrophobicContact CB-CD2 4.44Å; A21-T31 HydrophobicContact CB-CG2 3.52Å; A21-T31 WeakPolarHBondContact CB-OG1 3.16Å
22	H	89.8	Confident	89.8	Confident	135 Å²	135	76.8 Å²	76.8	63%	0.625	43%	0.432	S	S	*	.	H	α-helix	trans	-65.5	-46.3	174	-172.4	-87.7	0	0	0	111.6	Y18 A19 K20 L24 G25 L28	Y18-H22 PolarHBondContact O-N 2.98Å; A19-H22 WeakPolarHBondContact O-CB 3.25Å; A19-H22 PolarHBondContact O-N 3.44Å; A19-H22 VanDerWaalsContact O-N 3.17Å; K20-H22 VanDerWaalsContact C-N 3.28Å; K20-H22 PolarHBondContact O-N 2.98Å; H22-L24 PolarHBondContact O-N 3.27Å; H22-G25 PolarHBondContact O-N 3.17Å; H22-L28 HydrophobicContact CB-CD2 4.48Å
23	E	93.2	Very high	89.7	Confident	161 Å²	161	76.6 Å²	76.6	75%	0.752	43%	0.432	S	S	*	.	H	α-helix	trans	-64.3	-37.2	177.8	-70.5	177.1	171.6	0	0	113.1	A19 K20	A19-E23 PolarHBondContact O-N 3.49Å; K20-E23 PolarHBondContact O-N 2.72Å
24	L	93.2	Very high	89.6	Confident	125 Å²	125	77.1 Å²	77.1	65%	0.654	43%	0.427	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.9	2	-177.2	-65.1	173.4	0	0	0	113.9	K20 H22 L26	K20-L24 WeakPolarHBondContact O-CB 3.38Å; K20-L24 VanDerWaalsContact O-CG 3.29Å; K20-L24 WeakPolarHBondContact O-CG 3.36Å; K20-L24 PolarHBondContact O-N 3.14Å; H22-L24 PolarHBondContact O-N 3.27Å; L24-L26 HydrophobicContact CB-CD1 4.14Å; L24-L26 HydrophobicContact CB-CG 3.86Å; L24-L26 HydrophobicContact CD1-CD1 4.21Å; L24-L26 PolarHBondContact O-N 3.31Å
25	G	89.7	Confident	89.6	Confident	70 Å²	70	77.4 Å²	77.4	72%	0.722	43%	0.429	S	S	*	.	T	Hydrogen-bonded Turn	trans	62	27.1	-177.2	0	0	0	0	0	113.8	A21 H22	A21-G25 PolarHBondContact O-N 3.28Å; H22-G25 PolarHBondContact O-N 3.17Å
26	L	88.2	Confident	89.5	Confident	98 Å²	98	78.1 Å²	78.1	51%	0.513	43%	0.429	S	S	.	.			trans	-77.1	162.1	178.7	-62.9	176.8	0	0	0	111	A21 L24 L28	A21-L26 HydrophobicContact CB-CB 4.02Å; A21-L26 PolarHBondContact O-N 3.19Å; L24-L26 HydrophobicContact CB-CD1 4.14Å; L24-L26 HydrophobicContact CB-CG 3.86Å; L24-L26 HydrophobicContact CD1-CD1 4.21Å; L24-L26 PolarHBondContact O-N 3.31Å; L26-L28 PolarHBondContact O-N 3.25Å
27	S	88.6	Confident	89.3	Confident	71 Å²	71	78.6 Å²	78.6	50%	0.497	42%	0.424	S	S	.	.			trans	-61	112	176.4	179.6	0	0	0	0	111.4	N29 S30 T31	S27-N29 VanDerWaalsContact C-N 3.26Å; S27-N29 PolarHBondContact O-N 3.4Å; S27-S30 PolarHBondContact O-N 2.9Å; S27-S30 PolarHBondContact OG-N 3.45Å; S27-T31 PolarHBondContact O-N 2.89Å; S27-T31 PolarHBondContact O-OG1 2.89Å
28	L	87.8	Confident	89.1	Confident	65 Å²	65	79.3 Å²	79.3	34%	0.34	42%	0.424	S	S	.	.	H	α-helix	trans	-63	-32.5	177.1	-61.4	-179.4	0	0	0	112.1	Y18 A21 H22 L26 T31 G32	Y18-L28 HydrophobicContact CE1-CD2 4.34Å; Y18-L28 HydrophobicContact CE2-CB 4.43Å; Y18-L28 HydrophobicContact CE2-CD2 4.38Å; A21-L28 HydrophobicContact CB-CD2 4.44Å; H22-L28 HydrophobicContact CB-CD2 4.48Å; L26-L28 PolarHBondContact O-N 3.25Å; L28-T31 PolarHBondContact O-N 3.03Å; L28-G32 PolarHBondContact O-N 3.02Å
29	N	87.5	Confident	89.2	Confident	145 Å²	145	76.1 Å²	76.1	78%	0.775	42%	0.415	S	S	*	.	H	α-helix	trans	-64.8	-47.6	176.4	-71	-22.9	0	0	0	111.9	S27 T31 G32 L33	S27-N29 VanDerWaalsContact C-N 3.26Å; S27-N29 PolarHBondContact O-N 3.4Å; N29-T31 VanDerWaalsContact C-N 3.3Å; N29-T31 PolarHBondContact O-N 3.17Å; N29-G32 PolarHBondContact O-N 2.87Å; N29-L33 PolarHBondContact O-N 3.33Å; N29-L33 VanDerWaalsContact O-N 3.13Å
30	S	84.9	Confident	89.1	Confident	65 Å²	65	78.2 Å²	78.2	46%	0.455	42%	0.423	S	S	.	.	H	α-helix	trans	-63.3	-40.9	176.5	-174.9	0	0	0	0	110.9	S27 L33 Q34	S27-S30 PolarHBondContact O-N 2.9Å; S27-S30 PolarHBondContact OG-N 3.45Å; S30-L33 PolarHBondContact O-N 3.06Å; S30-Q34 WeakPolarHBondContact O-CG 3.41Å; S30-Q34 PolarHBondContact O-N 3.12Å; S30-Q34 VanDerWaalsContact O-N 3.1Å
31	T	87.2	Confident	88.9	Confident	11 Å²	11	74.2 Å²	74.2	7%	0.067	41%	0.407	C	S	.	.	H	α-helix	trans	-67.5	-42.4	178.9	-52.8	0	0	0	0	112	Y18 A21 S27 L28 N29 L33 Q34 C35	Y18-T31 HydrophobicContact CD2-CG2 4.22Å; A21-T31 HydrophobicContact CB-CG2 3.52Å; A21-T31 WeakPolarHBondContact CB-OG1 3.16Å; S27-T31 PolarHBondContact O-N 2.89Å; S27-T31 PolarHBondContact O-OG1 2.89Å; L28-T31 PolarHBondContact O-N 3.03Å; N29-T31 VanDerWaalsContact C-N 3.3Å; N29-T31 PolarHBondContact O-N 3.17Å; T31-L33 VanDerWaalsContact C-N 3.31Å; T31-L33 PolarHBondContact O-N 2.91Å; T31-Q34 CarbonylContact O-C 3.55Å; T31-Q34 WeakPolarHBondContact O-CA 3.5Å; T31-Q34 WeakPolarHBondContact O-CB 3.49Å; T31-Q34 PolarHBondContact O-N 3.03Å; T31-C35 PolarHBondContact O-N 2.68Å; T31-C35 PolarHBondContact O-SG 3.34Å
32	G	87.6	Confident	88.8	Confident	21 Å²	21	74.7 Å²	74.7	22%	0.216	41%	0.413	C	S	.	.	H	α-helix	trans	-58.8	-42	175.3	0	0	0	0	0	112	L28 N29 Q34 C35 I36	L28-G32 PolarHBondContact O-N 3.02Å; N29-G32 PolarHBondContact O-N 2.87Å; G32-Q34 VanDerWaalsContact C-N 3.3Å; G32-Q34 PolarHBondContact O-N 3.38Å; G32-C35 WeakPolarHBondContact O-CB 3.38Å; G32-C35 PolarHBondContact O-N 3.46Å; G32-I36 WeakPolarHBondContact O-CG1 3.29Å; G32-I36 PolarHBondContact O-N 3Å
33	L	89.2	Confident	88.8	Confident	90 Å²	90	69.4 Å²	69.4	47%	0.471	39%	0.39	S	S	.	.	H	α-helix	trans	-63.2	-35.9	173.4	-175.1	61.6	0	0	0	112.3	N29 S30 T31 R37	N29-L33 PolarHBondContact O-N 3.33Å; N29-L33 VanDerWaalsContact O-N 3.13Å; S30-L33 PolarHBondContact O-N 3.06Å; T31-L33 VanDerWaalsContact C-N 3.31Å; T31-L33 PolarHBondContact O-N 2.91Å; L33-R37 WeakPolarHBondContact O-CG 3.36Å; L33-R37 PolarHBondContact O-N 3.29Å; L33-R37 VanDerWaalsContact O-N 3.16Å
34	Q	87	Confident	88.7	Confident	49 Å²	49	63.5 Å²	63.5	23%	0.229	37%	0.369	C	S	.	.	H	α-helix	trans	-67.9	-39.7	173.4	-68.1	-166.6	66.3	0	0	112.4	S30 T31 G32 R37 Y38	S30-Q34 WeakPolarHBondContact O-CG 3.41Å; S30-Q34 PolarHBondContact O-N 3.12Å; S30-Q34 VanDerWaalsContact O-N 3.1Å; T31-Q34 CarbonylContact O-C 3.55Å; T31-Q34 WeakPolarHBondContact O-CA 3.5Å; T31-Q34 WeakPolarHBondContact O-CB 3.49Å; T31-Q34 PolarHBondContact O-N 3.03Å; G32-Q34 VanDerWaalsContact C-N 3.3Å; G32-Q34 PolarHBondContact O-N 3.38Å; Q34-R37 WeakPolarHBondContact O-CA 3.33Å; Q34-R37 WeakPolarHBondContact O-CB 3.5Å; Q34-R37 PolarHBondContact O-N 3.41Å; Q34-R37 VanDerWaalsContact O-N 3.12Å; Q34-Y38 PolarHBondContact O-N 3Å
35	C	89.9	Confident	88.5	Confident	14 Å²	14	58 Å²	58	10%	0.095	34%	0.341	C	S	.	.	H	α-helix	trans	-59.4	-47.6	174.9	-66.6	0	0	0	0	111.4	S14 T31 G32 R37 Y38 V39	S14-C35 PolarHBondContact O-SG 2.95Å; S14-C35 PolarHBondContact OG-O 3.39Å; S14-C35 VanDerWaalsContact OG-O 3.14Å; T31-C35 PolarHBondContact O-N 2.68Å; T31-C35 PolarHBondContact O-SG 3.34Å; G32-C35 WeakPolarHBondContact O-CB 3.38Å; G32-C35 PolarHBondContact O-N 3.46Å; C35-R37 PolarHBondContact O-N 3.19Å; C35-Y38 WeakPolarHBondContact O-CB 3.41Å; C35-Y38 PolarHBondContact O-N 3.36Å; C35-V39 PolarHBondContact O-N 3.4Å
36	I	90	Very high	88.5	Confident	104 Å²	104	55 Å²	55	53%	0.533	31%	0.309	S	S	.	.	H	α-helix	trans	-56.2	-43.3	174.7	-66.7	166.6	0	0	0	110.2	G32 Y38 V39 V40	G32-I36 WeakPolarHBondContact O-CG1 3.29Å; G32-I36 PolarHBondContact O-N 3Å; I36-Y38 PolarHBondContact O-N 3.03Å; I36-V39 PolarHBondContact O-N 3.05Å; I36-V40 HydrophobicContact CG2-CG2 4.19Å; I36-V40 WeakPolarHBondContact O-CB 3.35Å; I36-V40 VanDerWaalsContact O-CG2 3.25Å; I36-V40 WeakPolarHBondContact O-CG2 3.21Å; I36-V40 PolarHBondContact O-N 2.95Å
37	R	88.2	Confident	88.7	Confident	111 Å²	111	54.3 Å²	54.3	42%	0.419	31%	0.305	S	S	.	.	H	α-helix	trans	-63.6	-38.7	177.1	-71.3	174.5	-174.6	-178	7.3	112.7	L33 Q34 C35 T41	L33-R37 WeakPolarHBondContact O-CG 3.36Å; L33-R37 PolarHBondContact O-N 3.29Å; L33-R37 VanDerWaalsContact O-N 3.16Å; Q34-R37 WeakPolarHBondContact O-CA 3.33Å; Q34-R37 WeakPolarHBondContact O-CB 3.5Å; Q34-R37 PolarHBondContact O-N 3.41Å; Q34-R37 VanDerWaalsContact O-N 3.12Å; C35-R37 PolarHBondContact O-N 3.19Å; R37-T41 WeakPolarHBondContact O-CB 3.34Å; R37-T41 PolarHBondContact O-N 3.28Å; R37-T41 PolarHBondContact O-OG1 3.33Å
38	Y	86.6	Confident	88.8	Confident	78 Å²	78	52.1 Å²	52.1	31%	0.306	29%	0.29	S	S	.	.	H	α-helix	trans	-62.3	-50.8	175.4	-67.1	-36.3	0	0	0	111	S10 E17 Q34 C35 I36 V40 T41 G42	S10-Y38 WeakPolarHBondContact CB-O 3.46Å; S10-Y38 PolarHBondContact OG-O 3.05Å; E17-Y38 HydrophobicContact CB-CE2 3.99Å; E17-Y38 HydrophobicContact CG-CD2 4.44Å; E17-Y38 HydrophobicContact CG-CE2 3.62Å; E17-Y38 PolarHBondContact OE2-OH 3.4Å; Q34-Y38 PolarHBondContact O-N 3Å; C35-Y38 WeakPolarHBondContact O-CB 3.41Å; C35-Y38 PolarHBondContact O-N 3.36Å; I36-Y38 PolarHBondContact O-N 3.03Å; Y38-V40 PolarHBondContact O-N 2.86Å; Y38-T41 PolarHBondContact O-N 2.95Å; Y38-G42 PolarHBondContact O-N 3.22Å
39	V	90.2	Very high	89	Confident	34 Å²	34	51.7 Å²	51.7	21%	0.206	29%	0.286	C	S	.	.	H	α-helix	trans	-58.1	-49.1	178.2	177.8	0	0	0	0	111.3	Y7 C35 I36 T43	Y7-V39 HydrophobicContact CD2-CG1 4.07Å; Y7-V39 HydrophobicContact CE2-CG1 3.89Å; C35-V39 PolarHBondContact O-N 3.4Å; I36-V39 PolarHBondContact O-N 3.05Å; V39-T43 WeakPolarHBondContact O-CB 3.42Å; V39-T43 PolarHBondContact O-N 2.66Å; V39-T43 PolarHBondContact O-OG1 3.35Å
40	V	90.1	Very high	89.2	Confident	89 Å²	89	47.3 Å²	47.3	54%	0.539	27%	0.267	S	S	.	.	H	α-helix	trans	-63.2	-46.4	179.7	171.6	0	0	0	0	111.1	I36 Y38 T43 A44	I36-V40 HydrophobicContact CG2-CG2 4.19Å; I36-V40 WeakPolarHBondContact O-CB 3.35Å; I36-V40 VanDerWaalsContact O-CG2 3.25Å; I36-V40 WeakPolarHBondContact O-CG2 3.21Å; I36-V40 PolarHBondContact O-N 2.95Å; Y38-V40 PolarHBondContact O-N 2.86Å; V40-T43 PolarHBondContact O-N 3.47Å; V40-A44 VanDerWaalsContact O-CB 3.29Å; V40-A44 WeakPolarHBondContact O-CB 3.35Å; V40-A44 PolarHBondContact O-N 3.13Å
41	T	88.6	Confident	89.5	Confident	20 Å²	20	46.8 Å²	46.8	12%	0.123	26%	0.263	C	S	.	.	H	α-helix	trans	-63.7	-47.9	-177.6	-59.2	0	0	0	0	111.3	R37 Y38 A44 A45 N83	R37-T41 WeakPolarHBondContact O-CB 3.34Å; R37-T41 PolarHBondContact O-N 3.28Å; R37-T41 PolarHBondContact O-OG1 3.33Å; Y38-T41 PolarHBondContact O-N 2.95Å; T41-A44 PolarHBondContact O-N 3.44Å; T41-A45 VanDerWaalsContact O-CB 3.31Å; T41-A45 WeakPolarHBondContact O-CB 3.38Å; T41-A45 PolarHBondContact O-N 3.49Å; T41-N83 HydrophobicContact CG2-CB 4.14Å
42	G	88	Confident	89.7	Confident	13 Å²	13	48.3 Å²	48.3	13%	0.134	27%	0.272	C	S	.	.	H	α-helix	trans	-75.3	-27.8	-178.1	0	0	0	0	0	113.3	S10 Y38 A46	S10-G42 VanDerWaalsContact OG-CA 3.26Å; S10-G42 WeakPolarHBondContact OG-CA 3.33Å; Y38-G42 PolarHBondContact O-N 3.22Å; G42-A46 WeakPolarHBondContact O-CB 3.26Å; G42-A46 PolarHBondContact O-N 3.43Å
43	T	89.7	Confident	89.8	Confident	24 Å²	24	47.9 Å²	47.9	15%	0.147	27%	0.266	C	S	.	.	H	α-helix	trans	-64	-48.1	168.1	-56.7	0	0	0	0	110.7	F3 V39 V40 A45 A46 I47	F3-T43 HydrophobicContact CD2-CG2 3.99Å; F3-T43 HydrophobicContact CE2-CG2 3.36Å; F3-T43 HydrophobicContact CZ-CG2 4.13Å; V39-T43 WeakPolarHBondContact O-CB 3.42Å; V39-T43 PolarHBondContact O-N 2.66Å; V39-T43 PolarHBondContact O-OG1 3.35Å; V40-T43 PolarHBondContact O-N 3.47Å; T43-A45 PolarHBondContact O-N 2.95Å; T43-A46 PolarHBondContact O-N 3.22Å; T43-I47 HydrophobicContact CG2-CD1 4.07Å; T43-I47 WeakPolarHBondContact O-CG1 3.2Å; T43-I47 PolarHBondContact O-N 2.88Å
44	A	90	Very high	89.9	Confident	36 Å²	36	50 Å²	50	30%	0.298	27%	0.272	S	S	.	.	H	α-helix	trans	-61.6	-42.4	176.9	0	0	0	0	0	112.1	V40 T41 I47 C48 I79	V40-A44 VanDerWaalsContact O-CB 3.29Å; V40-A44 WeakPolarHBondContact O-CB 3.35Å; V40-A44 PolarHBondContact O-N 3.13Å; T41-A44 PolarHBondContact O-N 3.44Å; A44-I47 PolarHBondContact O-N 3.01Å; A44-C48 WeakPolarHBondContact O-CB 3.34Å; A44-C48 PolarHBondContact O-N 2.98Å; A44-I79 HydrophobicContact CB-CG2 4.08Å
45	A	90.4	Very high	90.2	Very high	9 Å²	9	53 Å²	53	7%	0.074	29%	0.288	C	S	.	.	H	α-helix	trans	-59.8	-46	174.8	0	0	0	0	0	111.1	T41 T43 I47 C48 H49 S76	T41-A45 VanDerWaalsContact O-CB 3.31Å; T41-A45 WeakPolarHBondContact O-CB 3.38Å; T41-A45 PolarHBondContact O-N 3.49Å; T43-A45 PolarHBondContact O-N 2.95Å; A45-I47 PolarHBondContact O-N 3.46Å; A45-C48 WeakPolarHBondContact O-CB 3.33Å; A45-C48 PolarHBondContact O-N 2.93Å; A45-H49 PolarHBondContact O-N 3.24Å; A45-S76 PolarHBondContact O-OG 3.5Å
46	A	89.5	Confident	90.2	Very high	7 Å²	7	53 Å²	53	6%	0.058	29%	0.288	C	S	.	.	H	α-helix	trans	-65.9	-38.9	178.4	0	0	0	0	0	113.9	A2 G42 T43 C48 H49 S50	A2-A46 VanDerWaalsContact O-CB 3.29Å; A2-A46 WeakPolarHBondContact O-CB 3.29Å; G42-A46 WeakPolarHBondContact O-CB 3.26Å; G42-A46 PolarHBondContact O-N 3.43Å; T43-A46 PolarHBondContact O-N 3.22Å; A46-C48 VanDerWaalsContact C-N 3.32Å; A46-H49 WeakPolarHBondContact O-CB 3.31Å; A46-H49 PolarHBondContact O-N 3.47Å; A46-S50 PolarHBondContact O-N 3.38Å
47	I	91.2	Very high	90.3	Very high	84 Å²	84	49 Å²	49	43%	0.431	27%	0.271	S	S	.	.	H	α-helix	trans	-61.9	-44.9	173.4	-68.3	168.6	0	0	0	109.8	F3 T43 A44 A45 S50 S51	F3-I47 HydrophobicContact CD2-CD1 4.22Å; F3-I47 HydrophobicContact CD2-CG1 3.88Å; F3-I47 HydrophobicContact CE2-CD1 4.23Å; F3-I47 HydrophobicContact CE2-CG1 4.39Å; T43-I47 HydrophobicContact CG2-CD1 4.07Å; T43-I47 WeakPolarHBondContact O-CG1 3.2Å; T43-I47 PolarHBondContact O-N 2.88Å; A44-I47 PolarHBondContact O-N 3.01Å; A45-I47 PolarHBondContact O-N 3.46Å; I47-S50 PolarHBondContact O-N 2.84Å; I47-S51 VanDerWaalsContact O-CB 3.3Å; I47-S51 WeakPolarHBondContact O-CB 3.37Å; I47-S51 PolarHBondContact O-N 3.4Å; I47-S51 PolarHBondContact O-OG 3.27Å
48	C	91.7	Very high	90.5	Very high	26 Å²	26	51 Å²	51	18%	0.176	28%	0.283	C	S	.	.	H	α-helix	trans	-63.1	-44.5	177.4	-174.4	0	0	0	0	112	A44 A45 A46 S50 S51 V52 A75 I79	A44-C48 WeakPolarHBondContact O-CB 3.34Å; A44-C48 PolarHBondContact O-N 2.98Å; A45-C48 WeakPolarHBondContact O-CB 3.33Å; A45-C48 PolarHBondContact O-N 2.93Å; A46-C48 VanDerWaalsContact C-N 3.32Å; C48-S50 PolarHBondContact O-N 3.37Å; C48-S51 PolarHBondContact O-N 2.89Å; C48-V52 WeakPolarHBondContact O-CB 3.26Å; C48-V52 WeakPolarHBondContact O-CG2 3.48Å; C48-V52 PolarHBondContact O-N 2.96Å; C48-A75 WeakPolarHBondContact SG-CB 3.3Å; C48-I79 HydrophobicContact CB-CD1 3.2Å; C48-I79 HydrophobicContact CB-CG1 4.49Å; C48-I79 VanDerWaalsContact SG-CD1 3.56Å
49	H	92.2	Very high	90.7	Very high	56 Å²	56	51.4 Å²	51.4	26%	0.259	30%	0.302	S	S	.	.	H	α-helix	trans	-52.2	-57	173.6	-166.7	176.8	0	0	0	110.4	A45 A46 S51 V52 S53 H69 G72 S76	A45-H49 PolarHBondContact O-N 3.24Å; A46-H49 WeakPolarHBondContact O-CB 3.31Å; A46-H49 PolarHBondContact O-N 3.47Å; H49-S51 VanDerWaalsContact C-N 3.34Å; H49-S51 PolarHBondContact O-N 3.43Å; H49-V52 PolarHBondContact O-N 3.41Å; H49-S53 PolarHBondContact CD2-OG 3.04Å; H49-S53 VanDerWaalsContact CD2-OG 3.29Å; H49-S53 VanDerWaalsContact O-CB 3.3Å; H49-S53 WeakPolarHBondContact O-CB 3.39Å; H49-S53 PolarHBondContact O-N 3.06Å; H49-S53 PolarHBondContact O-OG 3.48Å; H49-H69 AromaticContact NE2-ND1 3.89Å; H49-H69 PolarHBondContact NE2-O 3.48Å; H49-G72 VanDerWaalsContact CD2-C 3.47Å; H49-S76 WeakPolarHBondContact CA-OG 3.5Å; H49-S76 WeakPolarHBondContact CB-OG 3.44Å; H49-S76 PolarHBondContact N-OG 2.93Å
50	S	90.1	Very high	90.7	Very high	52 Å²	52	53.2 Å²	53.2	36%	0.364	31%	0.313	S	S	.	.	H	α-helix	trans	-60.8	-42.6	-179.2	-76.3	0	0	0	0	112.8	A2 A46 I47 C48 F54	A2-S50 WeakPolarHBondContact CB-OG 3.29Å; A46-S50 PolarHBondContact O-N 3.38Å; I47-S50 PolarHBondContact O-N 2.84Å; C48-S50 PolarHBondContact O-N 3.37Å; S50-F54 VanDerWaalsContact O-CB 3.25Å; S50-F54 WeakPolarHBondContact O-CB 3.48Å; S50-F54 PolarHBondContact O-N 3.48Å
51	S	92.3	Very high	90.7	Very high	55 Å²	55	52.2 Å²	52.2	39%	0.385	32%	0.321	S	S	.	.	H	α-helix	trans	-66	-48	-177.5	-56.5	0	0	0	0	111.3	I47 C48 H49 F54 I55	I47-S51 VanDerWaalsContact O-CB 3.3Å; I47-S51 WeakPolarHBondContact O-CB 3.37Å; I47-S51 PolarHBondContact O-N 3.4Å; I47-S51 PolarHBondContact O-OG 3.27Å; C48-S51 PolarHBondContact O-N 2.89Å; H49-S51 VanDerWaalsContact C-N 3.34Å; H49-S51 PolarHBondContact O-N 3.43Å; S51-F54 PolarHBondContact O-N 2.83Å; S51-I55 WeakPolarHBondContact O-CB 3.3Å; S51-I55 WeakPolarHBondContact O-CD1 3.38Å; S51-I55 WeakPolarHBondContact O-CG1 3.3Å; S51-I55 PolarHBondContact O-N 3.49Å
52	V	91.9	Very high	90.7	Very high	42 Å²	42	59.9 Å²	59.9	26%	0.255	35%	0.348	S	S	.	.	H	α-helix	trans	-69.7	-41	-179.1	172.4	0	0	0	0	111	C48 H49 F54 I55 S56 L71 A75	C48-V52 WeakPolarHBondContact O-CB 3.26Å; C48-V52 WeakPolarHBondContact O-CG2 3.48Å; C48-V52 PolarHBondContact O-N 2.96Å; H49-V52 PolarHBondContact O-N 3.41Å; V52-F54 VanDerWaalsContact C-N 3.29Å; V52-F54 PolarHBondContact O-N 3.22Å; V52-I55 PolarHBondContact O-N 3.44Å; V52-S56 WeakPolarHBondContact O-CB 3.45Å; V52-S56 PolarHBondContact O-N 2.94Å; V52-L71 HydrophobicContact CG1-CB 4.07Å; V52-A75 HydrophobicContact CB-CB 4.28Å; V52-A75 HydrophobicContact CG1-CB 4.27Å; V52-A75 HydrophobicContact CG2-CB 3.77Å
53	S	89.8	Confident	90.6	Very high	13 Å²	13	63 Å²	63	9%	0.091	37%	0.368	C	S	.	.	H	α-helix	trans	-59.1	-42.9	173.6	-62.9	0	0	0	0	111.5	H49 A57 N68	H49-S53 PolarHBondContact CD2-OG 3.04Å; H49-S53 VanDerWaalsContact CD2-OG 3.29Å; H49-S53 VanDerWaalsContact O-CB 3.3Å; H49-S53 WeakPolarHBondContact O-CB 3.39Å; H49-S53 PolarHBondContact O-N 3.06Å; H49-S53 PolarHBondContact O-OG 3.48Å; S53-A57 VanDerWaalsContact O-CB 3.3Å; S53-A57 WeakPolarHBondContact O-CB 3.42Å; S53-A57 PolarHBondContact O-N 3.34Å; S53-N68 WeakPolarHBondContact CA-O 3.27Å; S53-N68 PolarHBondContact OG-O 3.48Å
54	F	90.6	Very high	90.3	Very high	135 Å²	135	69.1 Å²	69.1	59%	0.592	40%	0.4	S	S	*	.	H	α-helix	trans	-66.6	-47.8	178.5	-179.2	-99.7	0	0	0	112.3	S50 S51 V52 S56 A57 K58	S50-F54 VanDerWaalsContact O-CB 3.25Å; S50-F54 WeakPolarHBondContact O-CB 3.48Å; S50-F54 PolarHBondContact O-N 3.48Å; S51-F54 PolarHBondContact O-N 2.83Å; V52-F54 VanDerWaalsContact C-N 3.29Å; V52-F54 PolarHBondContact O-N 3.22Å; F54-S56 VanDerWaalsContact C-N 3.31Å; F54-S56 PolarHBondContact O-N 2.96Å; F54-A57 PolarHBondContact O-N 2.92Å; F54-K58 HydrophobicContact CD1-CG 4.31Å; F54-K58 HydrophobicContact CE1-CG 3.96Å; F54-K58 HydrophobicContact CE2-CG 4.36Å; F54-K58 HydrophobicContact CZ-CD 4.17Å; F54-K58 HydrophobicContact CZ-CG 3.99Å; F54-K58 VanDerWaalsContact O-CG 3.31Å; F54-K58 WeakPolarHBondContact O-CG 3.47Å; F54-K58 PolarHBondContact O-N 2.86Å
55	I	92.7	Very high	90.1	Very high	111 Å²	111	68.6 Å²	68.6	57%	0.569	39%	0.393	S	S	*	.	H	α-helix	trans	-61.5	-43.4	178.2	-68.9	164.7	0	0	0	110.1	S51 V52 K58 A59	S51-I55 WeakPolarHBondContact O-CB 3.3Å; S51-I55 WeakPolarHBondContact O-CD1 3.38Å; S51-I55 WeakPolarHBondContact O-CG1 3.3Å; S51-I55 PolarHBondContact O-N 3.49Å; V52-I55 PolarHBondContact O-N 3.44Å; I55-K58 PolarHBondContact O-N 3.03Å; I55-A59 WeakPolarHBondContact O-CB 3.48Å; I55-A59 PolarHBondContact O-N 3.47Å
56	S	91.2	Very high	90.1	Very high	14 Å²	14	77.5 Å²	77.5	10%	0.098	43%	0.425	C	S	.	.	H	α-helix	trans	-63.8	-42.5	177.5	-172.5	0	0	0	0	112	V52 F54 K58 A59 T60 N68 L71	V52-S56 WeakPolarHBondContact O-CB 3.45Å; V52-S56 PolarHBondContact O-N 2.94Å; F54-S56 VanDerWaalsContact C-N 3.31Å; F54-S56 PolarHBondContact O-N 2.96Å; S56-K58 VanDerWaalsContact C-N 3.31Å; S56-K58 PolarHBondContact O-N 3.46Å; S56-A59 PolarHBondContact O-N 3.38Å; S56-T60 WeakPolarHBondContact O-CB 3.37Å; S56-T60 VanDerWaalsContact O-CG2 3.31Å; S56-T60 WeakPolarHBondContact O-CG2 3.49Å; S56-T60 PolarHBondContact O-N 3.37Å; S56-T60 PolarHBondContact O-OG1 2.95Å; S56-N68 VanDerWaalsContact C-OD1 3.28Å; S56-N68 VanDerWaalsContact CB-OD1 3.3Å; S56-N68 WeakPolarHBondContact CB-OD1 3.25Å; S56-N68 PolarHBondContact O-OD1 2.94Å; S56-N68 PolarHBondContact OG-OD1 2.89Å; S56-L71 WeakPolarHBondContact OG-CD1 3.48Å
57	A	91.2	Very high	90.2	Very high	20 Å²	20	80 Å²	80	17%	0.165	44%	0.439	C	S	.	.	H	α-helix	trans	-60.2	-41.6	174.1	0	0	0	0	0	112	S53 F54 G61 R62 N68	S53-A57 VanDerWaalsContact O-CB 3.3Å; S53-A57 WeakPolarHBondContact O-CB 3.42Å; S53-A57 PolarHBondContact O-N 3.34Å; F54-A57 PolarHBondContact O-N 2.92Å; A57-G61 WeakPolarHBondContact O-CA 3.39Å; A57-G61 PolarHBondContact O-N 3.06Å; A57-R62 PolarHBondContact O-N 3.26Å; A57-N68 WeakPolarHBondContact CA-ND2 3.49Å; A57-N68 PolarHBondContact N-OD1 2.66Å
58	K	92.4	Very high	90	Very high	154 Å²	154	76 Å²	76	67%	0.67	42%	0.419	S	S	*	.	H	α-helix	trans	-68.6	-39.6	177.1	-67.9	-74.3	-84.8	-179.4	0	112.1	F54 I55 S56	F54-K58 HydrophobicContact CD1-CG 4.31Å; F54-K58 HydrophobicContact CE1-CG 3.96Å; F54-K58 HydrophobicContact CE2-CG 4.36Å; F54-K58 HydrophobicContact CZ-CD 4.17Å; F54-K58 HydrophobicContact CZ-CG 3.99Å; F54-K58 VanDerWaalsContact O-CG 3.31Å; F54-K58 WeakPolarHBondContact O-CG 3.47Å; F54-K58 PolarHBondContact O-N 2.86Å; I55-K58 PolarHBondContact O-N 3.03Å; S56-K58 VanDerWaalsContact C-N 3.31Å; S56-K58 PolarHBondContact O-N 3.46Å
59	A	92	Very high	89.8	Confident	86 Å²	86	80 Å²	80	71%	0.711	44%	0.435	S	S	*	.	H	α-helix	trans	-72.1	-36.6	-179.7	0	0	0	0	0	112.9	I55 S56	I55-A59 WeakPolarHBondContact O-CB 3.48Å; I55-A59 PolarHBondContact O-N 3.47Å; S56-A59 PolarHBondContact O-N 3.38Å
60	T	90.1	Very high	89.8	Confident	71 Å²	71	79.6 Å²	79.6	44%	0.436	44%	0.441	S	S	.	.	H	α-helix	trans	-87.8	-15	-179.2	59	0	0	0	0	113.4	S56 R62	S56-T60 WeakPolarHBondContact O-CB 3.37Å; S56-T60 VanDerWaalsContact O-CG2 3.31Å; S56-T60 WeakPolarHBondContact O-CG2 3.49Å; S56-T60 PolarHBondContact O-N 3.37Å; S56-T60 PolarHBondContact O-OG1 2.95Å; T60-R62 PolarHBondContact O-N 2.71Å; T60-R62 PolarHBondContact OG1-N 3.23Å
61	G	89.9	Confident	89.8	Confident	69 Å²	69	81.1 Å²	81.1	71%	0.711	45%	0.445	S	S	*	.	S	Bend	trans	65.3	11.3	-170.4	0	0	0	0	0	113.7	A57	A57-G61 WeakPolarHBondContact O-CA 3.39Å; A57-G61 PolarHBondContact O-N 3.06Å
62	R	87.1	Confident	89.7	Confident	180 Å²	180	78.5 Å²	78.5	68%	0.679	43%	0.427	S	S	*	.			trans	-116.6	83.7	-175.4	-67.2	-179.2	175.9	-179	-1.8	110.2	A57 T60 D64 S65 N68	A57-R62 PolarHBondContact O-N 3.26Å; T60-R62 PolarHBondContact O-N 2.71Å; T60-R62 PolarHBondContact OG1-N 3.23Å; R62-D64 VanDerWaalsContact C-N 3.28Å; R62-D64 PolarHBondContact O-N 2.87Å; R62-S65 PolarHBondContact O-N 3.41Å; R62-N68 PolarHBondContact O-ND2 3.02Å
63	S	85.9	Confident	89.6	Confident	79 Å²	79	78 Å²	78	55%	0.552	43%	0.43	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.6	-40.9	-178.8	40.8	0	0	0	0	113.9	S65	S63-S65 VanDerWaalsContact C-N 3.34Å; S63-S65 PolarHBondContact O-N 2.81Å
64	D	84	Confident	89.7	Confident	153 Å²	153	80.3 Å²	80.3	82%	0.818	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95	12.3	-170.4	-54	-68.4	0	0	0	113.4	R62 W66	R62-D64 VanDerWaalsContact C-N 3.28Å; R62-D64 PolarHBondContact O-N 2.87Å; D64-W66 PolarHBondContact O-N 3.27Å
65	S	85.8	Confident	89.8	Confident	24 Å²	24	75 Å²	75	17%	0.168	43%	0.431	C	S	.	.			trans	-74.7	123.4	178	-170.7	0	0	0	0	111.2	R62 S63 V67 N68	R62-S65 PolarHBondContact O-N 3.41Å; S63-S65 VanDerWaalsContact C-N 3.34Å; S63-S65 PolarHBondContact O-N 2.81Å; S65-V67 PolarHBondContact O-N 3.45Å; S65-V67 WeakPolarHBondContact OG-CB 3.15Å; S65-V67 PolarHBondContact OG-N 3.25Å; S65-N68 WeakPolarHBondContact O-CB 3.44Å; S65-N68 PolarHBondContact O-N 3.39Å
66	W	90.8	Very high	89.6	Confident	196 Å²	196	70.3 Å²	70.3	74%	0.742	41%	0.408	S	S	*	.	H	α-helix	trans	-54.7	-25.5	170.3	69.5	-97.8	0	0	0	112.6	D64 N68 H69 A70	D64-W66 PolarHBondContact O-N 3.27Å; W66-N68 VanDerWaalsContact C-N 3.29Å; W66-N68 PolarHBondContact O-N 3.49Å; W66-H69 WeakPolarHBondContact O-CB 3.47Å; W66-H69 PolarHBondContact O-N 3.5Å; W66-A70 HydrophobicContact CE3-CB 4.06Å; W66-A70 HydrophobicContact CZ3-CB 3.99Å; W66-A70 PolarHBondContact O-N 3.19Å
67	V	90.3	Very high	89.4	Confident	59 Å²	59	71.2 Å²	71.2	36%	0.358	42%	0.42	S	S	.	.	H	α-helix	trans	-62.1	-36.7	178.6	179.5	0	0	0	0	111.5	S65 H69 A70 L71	S65-V67 PolarHBondContact O-N 3.45Å; S65-V67 WeakPolarHBondContact OG-CB 3.15Å; S65-V67 PolarHBondContact OG-N 3.25Å; V67-H69 VanDerWaalsContact C-N 3.31Å; V67-H69 PolarHBondContact O-N 2.91Å; V67-A70 PolarHBondContact O-N 2.87Å; V67-L71 HydrophobicContact CG1-CD1 4.17Å; V67-L71 WeakPolarHBondContact O-CG 3.22Å; V67-L71 PolarHBondContact O-N 2.67Å
68	N	87.2	Confident	89.4	Confident	2 Å²	2	76.3 Å²	76.3	1%	0.011	44%	0.444	C	S	.	.	H	α-helix	trans	-63.7	-41.5	177.5	-60.2	-33.5	0	0	0	111.1	S53 S56 A57 R62 S65 W66 L71 G72	S53-N68 WeakPolarHBondContact CA-O 3.27Å; S53-N68 PolarHBondContact OG-O 3.48Å; S56-N68 VanDerWaalsContact C-OD1 3.28Å; S56-N68 VanDerWaalsContact CB-OD1 3.3Å; S56-N68 WeakPolarHBondContact CB-OD1 3.25Å; S56-N68 PolarHBondContact O-OD1 2.94Å; S56-N68 PolarHBondContact OG-OD1 2.89Å; A57-N68 WeakPolarHBondContact CA-ND2 3.49Å; A57-N68 PolarHBondContact N-OD1 2.66Å; R62-N68 PolarHBondContact O-ND2 3.02Å; S65-N68 WeakPolarHBondContact O-CB 3.44Å; S65-N68 PolarHBondContact O-N 3.39Å; W66-N68 VanDerWaalsContact C-N 3.29Å; W66-N68 PolarHBondContact O-N 3.49Å; N68-L71 PolarHBondContact O-N 3.41Å; N68-G72 PolarHBondContact O-N 3.43Å
69	H	89	Confident	89.1	Confident	108 Å²	108	71.2 Å²	71.2	50%	0.5	42%	0.423	S	S	.	.	H	α-helix	trans	-66.8	-39.9	174.7	-72.1	-81.5	0	0	0	112.1	H49 W66 V67 L71 G72 G73	H49-H69 AromaticContact NE2-ND1 3.89Å; H49-H69 PolarHBondContact NE2-O 3.48Å; W66-H69 WeakPolarHBondContact O-CB 3.47Å; W66-H69 PolarHBondContact O-N 3.5Å; V67-H69 VanDerWaalsContact C-N 3.31Å; V67-H69 PolarHBondContact O-N 2.91Å; H69-L71 VanDerWaalsContact C-N 3.35Å; H69-L71 PolarHBondContact O-N 3.18Å; H69-G72 PolarHBondContact O-N 3.3Å; H69-G73 PolarHBondContact O-N 3.09Å
70	A	91.2	Very high	88.8	Confident	48 Å²	48	69.4 Å²	69.4	40%	0.397	41%	0.405	S	S	.	.	H	α-helix	trans	-61.6	-43.1	175.3	0	0	0	0	0	111.8	W66 V67 G73 A74	W66-A70 HydrophobicContact CE3-CB 4.06Å; W66-A70 HydrophobicContact CZ3-CB 3.99Å; W66-A70 PolarHBondContact O-N 3.19Å; V67-A70 PolarHBondContact O-N 2.87Å; A70-G73 PolarHBondContact O-N 2.84Å; A70-A74 PolarHBondContact O-N 3.23Å
71	L	91.2	Very high	88.4	Confident	84 Å²	84	69.5 Å²	69.5	44%	0.44	41%	0.406	S	S	.	.	H	α-helix	trans	-61.5	-46	174.8	-78.7	164.7	0	0	0	111.9	V52 S56 V67 N68 H69 G73 A74 A75	V52-L71 HydrophobicContact CG1-CB 4.07Å; S56-L71 WeakPolarHBondContact OG-CD1 3.48Å; V67-L71 HydrophobicContact CG1-CD1 4.17Å; V67-L71 WeakPolarHBondContact O-CG 3.22Å; V67-L71 PolarHBondContact O-N 2.67Å; N68-L71 PolarHBondContact O-N 3.41Å; H69-L71 VanDerWaalsContact C-N 3.35Å; H69-L71 PolarHBondContact O-N 3.18Å; L71-G73 VanDerWaalsContact C-N 3.32Å; L71-G73 PolarHBondContact O-N 3.42Å; L71-A74 PolarHBondContact O-N 3.3Å; L71-A75 PolarHBondContact O-N 2.97Å
72	G	90.1	Very high	87.9	Confident	0 Å²	0	75 Å²	75	0%	0	41%	0.405	C	S	.	.	H	α-helix	trans	-64.6	-36.5	175.7	0	0	0	0	0	113	H49 N68 H69 A75 S76	H49-G72 VanDerWaalsContact CD2-C 3.47Å; N68-G72 PolarHBondContact O-N 3.43Å; H69-G72 PolarHBondContact O-N 3.3Å; G72-A75 PolarHBondContact O-N 3.26Å; G72-S76 WeakPolarHBondContact O-CB 3.19Å; G72-S76 PolarHBondContact O-N 3.41Å; G72-S76 PolarHBondContact O-OG 3.4Å
73	G	89.4	Confident	87	Confident	32 Å²	32	69.5 Å²	69.5	33%	0.33	39%	0.389	S	S	.	.	H	α-helix	trans	-62	-44.7	171.7	0	0	0	0	0	112.7	H69 A70 L71 S76 G77	H69-G73 PolarHBondContact O-N 3.09Å; A70-G73 PolarHBondContact O-N 2.84Å; L71-G73 VanDerWaalsContact C-N 3.32Å; L71-G73 PolarHBondContact O-N 3.42Å; G73-S76 WeakPolarHBondContact O-CB 3.34Å; G73-S76 PolarHBondContact O-N 3.33Å; G73-G77 PolarHBondContact O-N 2.94Å
74	A	91.7	Very high	85.9	Confident	62 Å²	62	75.4 Å²	75.4	51%	0.512	40%	0.399	S	S	.	.	H	α-helix	trans	-62	-45.2	176.7	0	0	0	0	0	111.9	A70 L71 S76 G77 L78	A70-A74 PolarHBondContact O-N 3.23Å; L71-A74 PolarHBondContact O-N 3.3Å; A74-S76 VanDerWaalsContact C-N 3.32Å; A74-S76 PolarHBondContact O-N 3.4Å; A74-G77 PolarHBondContact O-N 3.38Å; A74-L78 PolarHBondContact O-N 2.84Å; A74-L78 VanDerWaalsContact O-N 3.09Å
75	A	91.5	Very high	84.5	Confident	22 Å²	22	75 Å²	75	18%	0.182	39%	0.39	C	S	.	.	H	α-helix	trans	-62.5	-39.8	176.8	0	0	0	0	0	112.1	C48 V52 L71 G72 G77 L78 I79	C48-A75 WeakPolarHBondContact SG-CB 3.3Å; V52-A75 HydrophobicContact CB-CB 4.28Å; V52-A75 HydrophobicContact CG1-CB 4.27Å; V52-A75 HydrophobicContact CG2-CB 3.77Å; L71-A75 PolarHBondContact O-N 2.97Å; G72-A75 PolarHBondContact O-N 3.26Å; A75-G77 PolarHBondContact O-N 3.29Å; A75-L78 WeakPolarHBondContact O-CB 3.34Å; A75-L78 PolarHBondContact O-N 3.21Å; A75-I79 PolarHBondContact O-N 2.88Å
76	S	89.8	Confident	82.7	Confident	14 Å²	14	78.8 Å²	78.8	10%	0.098	41%	0.406	C	S	.	.	H	α-helix	trans	-62.7	-41.6	173.8	-55.7	0	0	0	0	112.3	A45 H49 G72 G73 A74 L78 I79 C80	A45-S76 PolarHBondContact O-OG 3.5Å; H49-S76 WeakPolarHBondContact CA-OG 3.5Å; H49-S76 WeakPolarHBondContact CB-OG 3.44Å; H49-S76 PolarHBondContact N-OG 2.93Å; G72-S76 WeakPolarHBondContact O-CB 3.19Å; G72-S76 PolarHBondContact O-N 3.41Å; G72-S76 PolarHBondContact O-OG 3.4Å; G73-S76 WeakPolarHBondContact O-CB 3.34Å; G73-S76 PolarHBondContact O-N 3.33Å; A74-S76 VanDerWaalsContact C-N 3.32Å; A74-S76 PolarHBondContact O-N 3.4Å; S76-L78 VanDerWaalsContact C-N 3.3Å; S76-L78 PolarHBondContact O-N 2.97Å; S76-I79 WeakPolarHBondContact O-CB 3.17Å; S76-I79 PolarHBondContact O-N 2.93Å; S76-C80 PolarHBondContact O-N 3.47Å; S76-C80 PolarHBondContact O-SG 3.5Å
77	G	87.5	Confident	80.8	Confident	33 Å²	33	74.2 Å²	74.2	34%	0.34	39%	0.392	S	S	.	.	H	α-helix	trans	-61.3	-36.5	176.2	0	0	0	0	0	113.1	G73 A74 A75 C80 T81	G73-G77 PolarHBondContact O-N 2.94Å; A74-G77 PolarHBondContact O-N 3.38Å; A75-G77 PolarHBondContact O-N 3.29Å; G77-C80 PolarHBondContact O-N 2.81Å; G77-T81 WeakPolarHBondContact O-CB 3.31Å; G77-T81 PolarHBondContact O-N 3.48Å; G77-T81 PolarHBondContact O-OG1 2.87Å
78	L	89.8	Confident	78.8	Confident	127 Å²	127	75.2 Å²	75.2	67%	0.665	40%	0.402	S	S	*	.	H	α-helix	trans	-63.4	-43.1	173.3	-73.1	168.4	0	0	0	111.7	A74 A75 S76 C80 T81 W82	A74-L78 PolarHBondContact O-N 2.84Å; A74-L78 VanDerWaalsContact O-N 3.09Å; A75-L78 WeakPolarHBondContact O-CB 3.34Å; A75-L78 PolarHBondContact O-N 3.21Å; S76-L78 VanDerWaalsContact C-N 3.3Å; S76-L78 PolarHBondContact O-N 2.97Å; L78-C80 PolarHBondContact O-N 3.28Å; L78-T81 PolarHBondContact O-N 2.84Å; L78-W82 WeakPolarHBondContact O-CB 3.3Å; L78-W82 PolarHBondContact O-N 3.01Å
79	I	87	Confident	77	Confident	46 Å²	46	80.7 Å²	80.7	24%	0.236	43%	0.43	C	S	.	.	H	α-helix	trans	-61	-44.8	175.9	-67.6	179	0	0	0	111.3	A44 C48 A75 S76 T81 W82 N83	A44-I79 HydrophobicContact CB-CG2 4.08Å; C48-I79 HydrophobicContact CB-CD1 3.2Å; C48-I79 HydrophobicContact CB-CG1 4.49Å; C48-I79 VanDerWaalsContact SG-CD1 3.56Å; A75-I79 PolarHBondContact O-N 2.88Å; S76-I79 WeakPolarHBondContact O-CB 3.17Å; S76-I79 PolarHBondContact O-N 2.93Å; I79-T81 VanDerWaalsContact C-N 3.31Å; I79-T81 PolarHBondContact O-N 3.33Å; I79-W82 PolarHBondContact O-N 2.99Å; I79-N83 PolarHBondContact O-N 3.28Å; I79-N83 PolarHBondContact O-ND2 3.42Å
80	C	85.2	Confident	75.2	Confident	49 Å²	49	82.2 Å²	82.2	33%	0.331	44%	0.435	S	S	.	.	H	α-helix	trans	-62.1	-39.5	177	-68.6	0	0	0	0	111.9	S76 G77 L78 R84	S76-C80 PolarHBondContact O-N 3.47Å; S76-C80 PolarHBondContact O-SG 3.5Å; G77-C80 PolarHBondContact O-N 2.81Å; L78-C80 PolarHBondContact O-N 3.28Å; C80-R84 PolarHBondContact O-N 2.95Å
81	T	83	Confident	73.5	Confident	73 Å²	73	83.3 Å²	83.3	45%	0.448	44%	0.437	S	S	.	.	H	α-helix	trans	-74	-39.1	-179.4	-56.5	0	0	0	0	112.2	G77 L78 I79 N83 R84 K85	G77-T81 WeakPolarHBondContact O-CB 3.31Å; G77-T81 PolarHBondContact O-N 3.48Å; G77-T81 PolarHBondContact O-OG1 2.87Å; L78-T81 PolarHBondContact O-N 2.84Å; I79-T81 VanDerWaalsContact C-N 3.31Å; I79-T81 PolarHBondContact O-N 3.33Å; T81-N83 VanDerWaalsContact C-N 3.31Å; T81-N83 PolarHBondContact O-N 3.24Å; T81-R84 WeakPolarHBondContact O-CB 3.45Å; T81-R84 PolarHBondContact O-N 3.41Å; T81-K85 PolarHBondContact O-N 3.29Å
82	W	77.4	Confident	71.5	Confident	183 Å²	183	83 Å²	83	69%	0.693	44%	0.439	S	S	*	.	H	α-helix	trans	-58.4	-44.3	177.6	-172.4	-92.6	0	0	0	111.3	L78 I79 R84 K85	L78-W82 WeakPolarHBondContact O-CB 3.3Å; L78-W82 PolarHBondContact O-N 3.01Å; I79-W82 PolarHBondContact O-N 2.99Å; W82-R84 VanDerWaalsContact C-N 3.29Å; W82-R84 PolarHBondContact O-N 3.03Å; W82-K85 PolarHBondContact O-N 2.91Å
83	N	68.2	Low	69.7	Low	66 Å²	66	87.9 Å²	87.9	35%	0.353	47%	0.465	S	S	.	.	H	α-helix	trans	-65.9	-28.5	175.9	-79	-60.4	0	0	0	113.3	T41 I79 T81	T41-N83 HydrophobicContact CG2-CB 4.14Å; I79-N83 PolarHBondContact O-N 3.28Å; I79-N83 PolarHBondContact O-ND2 3.42Å; T81-N83 VanDerWaalsContact C-N 3.31Å; T81-N83 PolarHBondContact O-N 3.24Å
84	R	63	Low	68.1	Low	202 Å²	202	93.1 Å²	93.1	76%	0.762	48%	0.48	S	S	*	.	H	α-helix	trans	-74.6	-39.4	174.3	-74.1	-176	178.3	-176	0.1	112.8	C80 T81 W82 M86 K87	C80-R84 PolarHBondContact O-N 2.95Å; T81-R84 WeakPolarHBondContact O-CB 3.45Å; T81-R84 PolarHBondContact O-N 3.41Å; W82-R84 VanDerWaalsContact C-N 3.29Å; W82-R84 PolarHBondContact O-N 3.03Å; R84-M86 PolarHBondContact O-N 3.45Å; R84-K87 PolarHBondContact O-N 3.15Å
85	K	56.1	Low	66.3	Low	146 Å²	146	97.9 Å²	97.9	64%	0.635	49%	0.49	S	S	*	.	H	α-helix	trans	-61.3	-26.4	-179.7	-77.5	-166.1	174.8	-171.7	0	113.1	T81 W82 K87 S88 L89	T81-K85 PolarHBondContact O-N 3.29Å; W82-K85 PolarHBondContact O-N 2.91Å; K85-K87 PolarHBondContact O-N 2.9Å; K85-S88 PolarHBondContact O-N 2.65Å; K85-L89 PolarHBondContact O-N 3.44Å
86	M	46.7	Very low	64.5	Low	102 Å²	102	102.1 Å²	102.1	50%	0.502	51%	0.509	S	S	.	.	H	α-helix	trans	-64.2	-25.2	173.6	-63	-169.4	-160.1	0	0	113.7	R84 K90	R84-M86 PolarHBondContact O-N 3.45Å; M86-K90 PolarHBondContact O-N 3.44Å
87	K	51.3	Low	62.7	Low	101 Å²	101	104.9 Å²	104.9	44%	0.439	53%	0.528	S	S	.	.	H	α-helix	trans	-73	-42.4	174.1	-77	-171.4	174.7	-174.5	0	111.5	R84 K85 L89 K90 T91	R84-K87 PolarHBondContact O-N 3.15Å; K85-K87 PolarHBondContact O-N 2.9Å; K87-L89 PolarHBondContact O-N 2.9Å; K87-K90 PolarHBondContact O-N 3.44Å; K87-T91 PolarHBondContact O-N 3.07Å; K87-T91 PolarHBondContact O-OG1 3.3Å
88	S	48.7	Very low	61.1	Low	80 Å²	80	106.9 Å²	106.9	56%	0.559	54%	0.535	S	S	*	.	H	α-helix	trans	-62.1	-43.2	-179.9	174.3	0	0	0	0	111.8	K85 K90 T91 T92	K85-S88 PolarHBondContact O-N 2.65Å; S88-K90 PolarHBondContact O-N 3.19Å; S88-T91 PolarHBondContact O-N 3.23Å; S88-T92 PolarHBondContact O-N 3.42Å; S88-T92 PolarHBondContact O-OG1 2.75Å
89	L	49.9	Very low	59.3	Low	116 Å²	116	110.3 Å²	110.3	61%	0.607	54%	0.541	S	S	*	.	H	α-helix	trans	-66.8	-38	179.1	-117.7	139.1	0	0	0	112.6	K85 K87 L93	K85-L89 PolarHBondContact O-N 3.44Å; K87-L89 PolarHBondContact O-N 2.9Å; L89-L93 HydrophobicContact CD2-CD1 4.05Å; L89-L93 WeakPolarHBondContact O-CB 3.36Å; L89-L93 WeakPolarHBondContact O-CD1 3.38Å; L89-L93 WeakPolarHBondContact O-CG 3.47Å; L89-L93 PolarHBondContact O-N 3.49Å
90	K	51	Low	57.6	Low	140 Å²	140	117.1 Å²	117.1	61%	0.609	57%	0.568	S	S	*	*	H	α-helix	trans	-68.9	-40.4	175	-83.6	-170.4	173.7	-172.3	0	112.9	M86 K87 S88 L93 Q94	M86-K90 PolarHBondContact O-N 3.44Å; K87-K90 PolarHBondContact O-N 3.44Å; S88-K90 PolarHBondContact O-N 3.19Å; K90-L93 PolarHBondContact O-N 3.38Å; K90-Q94 WeakPolarHBondContact O-CB 3.3Å; K90-Q94 WeakPolarHBondContact O-CG 3.48Å; K90-Q94 PolarHBondContact O-N 2.66Å
91	T	55	Low	56	Low	71 Å²	71	122.1 Å²	122.1	44%	0.436	59%	0.592	S	S	.	*	H	α-helix	trans	-65.1	-44.1	176.5	-60.4	0	0	0	0	111.2	K87 S88 L93 Q94 F95	K87-T91 PolarHBondContact O-N 3.07Å; K87-T91 PolarHBondContact O-OG1 3.3Å; S88-T91 PolarHBondContact O-N 3.23Å; T91-L93 VanDerWaalsContact C-N 3.35Å; T91-L93 PolarHBondContact O-N 3.32Å; T91-Q94 PolarHBondContact O-N 3.28Å; T91-F95 HydrophobicContact CG2-CD2 4.12Å; T91-F95 HydrophobicContact CG2-CE2 4.14Å; T91-F95 WeakPolarHBondContact O-CD2 3.21Å; T91-F95 PolarHBondContact O-N 2.93Å; T91-F95 VanDerWaalsContact O-N 3.13Å
92	T	50.2	Low	54.6	Low	79 Å²	79	125.8 Å²	125.8	49%	0.485	61%	0.607	S	S	.	*	H	α-helix	trans	-63.6	-39.3	176.2	-55.9	0	0	0	0	112	S88 F95 L96	S88-T92 PolarHBondContact O-N 3.42Å; S88-T92 PolarHBondContact O-OG1 2.75Å; T92-F95 PolarHBondContact O-N 3.21Å; T92-L96 HydrophobicContact CG2-CD1 4.13Å; T92-L96 WeakPolarHBondContact O-CG 3.31Å; T92-L96 PolarHBondContact O-N 3.46Å
93	L	52.2	Low	53.1	Low	102 Å²	102	120.5 Å²	120.5	53%	0.534	61%	0.609	S	S	.	*	H	α-helix	trans	-70.1	-31.6	176.2	-71.3	170	0	0	0	113.1	L89 K90 T91 L96 S97	L89-L93 HydrophobicContact CD2-CD1 4.05Å; L89-L93 WeakPolarHBondContact O-CB 3.36Å; L89-L93 WeakPolarHBondContact O-CD1 3.38Å; L89-L93 WeakPolarHBondContact O-CG 3.47Å; L89-L93 PolarHBondContact O-N 3.49Å; K90-L93 PolarHBondContact O-N 3.38Å; T91-L93 VanDerWaalsContact C-N 3.35Å; T91-L93 PolarHBondContact O-N 3.32Å; L93-L96 PolarHBondContact O-N 3.35Å; L93-S97 PolarHBondContact O-N 3.36Å
94	Q	54.7	Low	52.1	Low	142 Å²	142	127.9 Å²	127.9	66%	0.664	66%	0.656	S	S	*	*	H	α-helix	trans	-70.1	-32.9	174.4	-78.2	179.7	-41.5	0	0	112.7	K90 T91 L96 P98	K90-Q94 WeakPolarHBondContact O-CB 3.3Å; K90-Q94 WeakPolarHBondContact O-CG 3.48Å; K90-Q94 PolarHBondContact O-N 2.66Å; T91-Q94 PolarHBondContact O-N 3.28Å; Q94-L96 VanDerWaalsContact C-N 3.33Å; Q94-P98 WeakPolarHBondContact O-CD 3.48Å
95	F	55	Low	51.5	Low	161 Å²	161	124.2 Å²	124.2	71%	0.706	65%	0.651	S	S	*	*	H	α-helix	trans	-73	-22.7	171.3	-88	-81.4	0	0	0	113.6	T91 T92 P98	T91-F95 HydrophobicContact CG2-CD2 4.12Å; T91-F95 HydrophobicContact CG2-CE2 4.14Å; T91-F95 WeakPolarHBondContact O-CD2 3.21Å; T91-F95 PolarHBondContact O-N 2.93Å; T91-F95 VanDerWaalsContact O-N 3.13Å; T92-F95 PolarHBondContact O-N 3.21Å; F95-P98 WeakPolarHBondContact O-CD 3.47Å
96	L	52.7	Low	51.3	Low	112 Å²	112	123 Å²	123	59%	0.586	65%	0.652	S	S	*	*	H	α-helix	trans	-88.4	-17.6	174.7	-73.3	162.3	0	0	0	113.3	T92 L93 Q94	T92-L96 HydrophobicContact CG2-CD1 4.13Å; T92-L96 WeakPolarHBondContact O-CG 3.31Å; T92-L96 PolarHBondContact O-N 3.46Å; L93-L96 PolarHBondContact O-N 3.35Å; Q94-L96 VanDerWaalsContact C-N 3.33Å
97	S	52.8	Low	51.5	Low	71 Å²	71	124.2 Å²	124.2	50%	0.497	66%	0.66	S	S	.	*	G	3₁₀ helix	trans	-69.7	-29.9	179.9	-164.7	0	0	0	0	116.7	L93 Y99 K100	L93-S97 PolarHBondContact O-N 3.36Å; S97-Y99 PolarHBondContact O-N 3.07Å; S97-K100 PolarHBondContact O-N 3.38Å
98	P	53.4	Low	51.5	Low	76 Å²	76	125.5 Å²	125.5	49%	0.494	67%	0.673	S	S	.	*	G	3₁₀ helix	trans	-68	-12.1	178.6	23.9	-32.4	0	0	0	113.9	Q94 F95	Q94-P98 WeakPolarHBondContact O-CD 3.48Å; F95-P98 WeakPolarHBondContact O-CD 3.47Å
99	Y	51.1	Low	51.7	Low	199 Å²	199	128.4 Å²	128.4	78%	0.78	68%	0.68	S	S	*	*	G	3₁₀ helix	trans	-92.6	-1.7	178.8	-71.8	-79.1	0	0	0	114.8	S97	S97-Y99 PolarHBondContact O-N 3.07Å
100	K	51	Low	51.8	Low	188 Å²	188	129.2 Å²	129.2	82%	0.817	69%	0.685	S	S	*	*	S	Bend	trans	-96.4	0.2	-179.5	-157.6	171.7	177.6	-178.2	0	114.3	S97	S97-K100 PolarHBondContact O-N 3.38Å
101	N	53.4	Low	51.9	Low	155 Å²	155	128.4 Å²	128.4	83%	0.829	69%	0.691	S	S	*	*	S	Bend	trans	-122.4	21.8	-175.6	-102.7	-37.2	0	0	0	114.7
102	I	52.9	Low	51.6	Low	150 Å²	150	132.8 Å²	132.8	77%	0.769	71%	0.71	S	S	*	*	S	Bend	trans	-133.7	36.9	-179.3	-35.6	176.9	0	0	0	111.5
103	G	46.7	Very low	51.8	Low	71 Å²	71	137.3 Å²	137.3	73%	0.732	73%	0.729	S	S	*	*			trans	-135.7	11.2	-164.7	0	0	0	0	0	118.2
104	V	45.3	Very low	51.7	Low	221 Å²	221	140.5 Å²	140.5	100%	1.339	75%	0.747	S	S	*	*			trans	-149.7	0	164.5	-173.4	0	0	0	0	108.2

Retrieved 104 of 104 residues in 77.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).