A0A5K4EVB9_SCHMA Loading...

Protein FAM183A

AlphaFold DB , UniProt , Accession A0A5K4EVB9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 37 aa.

>A0A5K4EVB9_SCHMA|A0A5K4EVB9
MEIDRTDPRFYHPKVACEMTQFMDAYWKLNEQRKLNS
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

 

Download Structure   PDB   PAE   Table  
Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M60.8Low80.4Confident234 Ų234132.2 Ų132.2100%1.15363%0.626SS**  0104.90-162.1179.9-118.700105.7I3M1-I3 PolarHBondContact O-N 2.9Å
2E76.6Confident81.1Confident197 Ų197131.1 Ų131.192%0.92162%0.62SS**  trans-67.1118172.2-91.8-178.1159.500107.5D4E2-D4 PolarHBondContact O-N 3.31Å
3I74.8Confident81.6Confident113 Ų113127.8 Ų127.858%0.57962%0.617SS**  trans-77.8113.7176.4-58.4175.3000106M1 R5 F10M1-I3 PolarHBondContact O-N 2.9Å; I3-R5 PolarHBondContact O-N 3.3Å; I3-F10 HydrophobicContact CG2-CD2 3.54Å; I3-F10 HydrophobicContact CG2-CE2 3.48Å; I3-F10 VanDerWaalsContact CG2-CE2 3.48Å; I3-F10 HydrophobicContact CG2-CZ 4.47Å
4D80.5Confident82.4Confident93 Ų93129.7 Ų129.750%0.49762%0.62SS.*  trans-65.8102.5175.1-175.50.8000109.6E2 T6 D7E2-D4 PolarHBondContact O-N 3.31Å; D4-T6 PolarHBondContact O-N 2.71Å; D4-T6 WeakPolarHBondContact OD1-CA 3.47Å; D4-T6 WeakPolarHBondContact OD1-CB 3.05Å; D4-T6 PolarHBondContact OD1-N 3.41Å; D4-T6 PolarHBondContact OD1-OG1 2.91Å; D4-T6 PolarHBondContact OD2-OG1 3.25Å; D4-D7 WeakPolarHBondContact O-CB 3.43Å; D4-D7 PolarHBondContact O-N 3.09Å
5R81.6Confident83.1Confident179 Ų179126.6 Ų126.668%0.67561%0.613SS**THydrogen-bonded Turntrans-78.3-8.8177.5-66.8-177179164.60.1112.7I3 Y11I3-R5 PolarHBondContact O-N 3.3Å; R5-Y11 VanDerWaalsContact O-CE2 3.3Å; R5-Y11 WeakPolarHBondContact O-CE2 3.27Å; R5-Y11 PolarHBondContact O-OH 3.4Å
6T87.7Confident83.6Confident117 Ų117119.8 Ų119.872%0.71858%0.583SS**THydrogen-bonded Turntrans-79.1-15.8173.872.20000111.8D4 P8D4-T6 PolarHBondContact O-N 2.71Å; D4-T6 WeakPolarHBondContact OD1-CA 3.47Å; D4-T6 WeakPolarHBondContact OD1-CB 3.05Å; D4-T6 PolarHBondContact OD1-N 3.41Å; D4-T6 PolarHBondContact OD1-OG1 2.91Å; D4-T6 PolarHBondContact OD2-OG1 3.25Å; T6-P8 VanDerWaalsContact O-CD 3.29Å; T6-P8 WeakPolarHBondContact O-CD 3.36Å
7D84.8Confident84.1Confident32 Ų32116.6 Ų116.617%0.17158%0.575CS.*  trans-69.8117.6177.1-166.6-30.6000111.4D4 R9 F10D4-D7 WeakPolarHBondContact O-CB 3.43Å; D4-D7 PolarHBondContact O-N 3.09Å; D7-R9 VanDerWaalsContact CG-NE 3.31Å; D7-R9 PolarHBondContact O-N 3.35Å; D7-R9 WeakPolarHBondContact OD1-CB 3.38Å; D7-R9 WeakPolarHBondContact OD1-CG 3.42Å; D7-R9 IonicContact OD1-CZ 3.03Å; D7-R9 PolarHBondContact OD1-N 3.37Å; D7-R9 IonicContact OD1-NE 2.68Å; D7-R9 PolarHBondContact OD1-NE 3.08Å; D7-R9 IonicContact OD2-CZ 2.81Å; D7-R9 IonicContact OD2-NE 3.99Å; D7-R9 PolarHBondContact OD2-NE 3.35Å; D7-R9 IonicContact OD2-NH2 3.61Å; D7-R9 PolarHBondContact OD2-NH2 3.49Å; D7-F10 VanDerWaalsContact O-CB 3.23Å; D7-F10 WeakPolarHBondContact O-CB 3.43Å; D7-F10 PolarHBondContact O-N 3.09Å
8P81.9Confident84.8Confident90 Ų90115.6 Ų115.658%0.58457%0.569SS**Hα-helixtrans-57.2-24.6177.2-24.434.8000113.6T6 F10 Y11 H12T6-P8 VanDerWaalsContact O-CD 3.29Å; T6-P8 WeakPolarHBondContact O-CD 3.36Å; P8-F10 PolarHBondContact O-N 3.02Å; P8-Y11 PolarHBondContact O-N 3.5Å; P8-Y11 VanDerWaalsContact O-N 3.16Å; P8-H12 PolarHBondContact O-N 3.2Å
9R82.9Confident85.3Confident155 Ų155115.4 Ų115.459%0.58557%0.568SS**Hα-helixtrans-62.8-25.6176.3-62.1178.6-69.1-176.10.2112.2D7 Y11 H12 A16D7-R9 VanDerWaalsContact CG-NE 3.31Å; D7-R9 PolarHBondContact O-N 3.35Å; D7-R9 WeakPolarHBondContact OD1-CB 3.38Å; D7-R9 WeakPolarHBondContact OD1-CG 3.42Å; D7-R9 IonicContact OD1-CZ 3.03Å; D7-R9 PolarHBondContact OD1-N 3.37Å; D7-R9 IonicContact OD1-NE 2.68Å; D7-R9 PolarHBondContact OD1-NE 3.08Å; D7-R9 IonicContact OD2-CZ 2.81Å; D7-R9 IonicContact OD2-NE 3.99Å; D7-R9 PolarHBondContact OD2-NE 3.35Å; D7-R9 IonicContact OD2-NH2 3.61Å; D7-R9 PolarHBondContact OD2-NH2 3.49Å; R9-Y11 VanDerWaalsContact C-N 3.31Å; R9-Y11 PolarHBondContact O-N 3Å; R9-H12 CarbonylContact O-C 3.44Å; R9-H12 PolarHBondContact O-N 3.41Å; R9-A16 HydrophobicContact CB-CB 3.63Å; R9-A16 HydrophobicContact CG-CB 3.72Å
10F83.3Confident85.8Confident98 Ų98114.1 Ų114.143%0.4357%0.567SS.*Hα-helixtrans-64-37.9176-170.5-98.5000111.9I3 D7 P8I3-F10 HydrophobicContact CG2-CD2 3.54Å; I3-F10 HydrophobicContact CG2-CE2 3.48Å; I3-F10 VanDerWaalsContact CG2-CE2 3.48Å; I3-F10 HydrophobicContact CG2-CZ 4.47Å; D7-F10 VanDerWaalsContact O-CB 3.23Å; D7-F10 WeakPolarHBondContact O-CB 3.43Å; D7-F10 PolarHBondContact O-N 3.09Å; P8-F10 PolarHBondContact O-N 3.02Å
11Y89Confident86.3Confident146 Ų146114.7 Ų114.757%0.57357%0.568SS**Hα-helixtrans-85.6-21.3-178.9-61-75.6000113.3R5 P8 R9 P13R5-Y11 VanDerWaalsContact O-CE2 3.3Å; R5-Y11 WeakPolarHBondContact O-CE2 3.27Å; R5-Y11 PolarHBondContact O-OH 3.4Å; P8-Y11 PolarHBondContact O-N 3.5Å; P8-Y11 VanDerWaalsContact O-N 3.16Å; R9-Y11 VanDerWaalsContact C-N 3.31Å; R9-Y11 PolarHBondContact O-N 3Å; Y11-P13 WeakPolarHBondContact O-CD 3.35Å
12H89.2Confident88Confident119 Ų119109.4 Ų109.455%0.55154%0.539SS*.  trans-12661.2-178.7-55.5-64.8000111.9P8 R9 K14 V15 A16P8-H12 PolarHBondContact O-N 3.2Å; R9-H12 CarbonylContact O-C 3.44Å; R9-H12 PolarHBondContact O-N 3.41Å; H12-K14 VanDerWaalsContact C-N 3.28Å; H12-K14 PolarHBondContact O-N 3.15Å; H12-V15 HydrophobicContact CB-CB 4.2Å; H12-V15 HydrophobicContact CB-CG2 4.38Å; H12-V15 PolarHBondContact O-N 2.93Å; H12-A16 WeakPolarHBondContact O-CB 3.42Å; H12-A16 PolarHBondContact O-N 2.91Å
13P88Confident89Confident89 Ų89105.1 Ų105.158%0.57852%0.52SS*.Hα-helixtrans-62.3-33.8-171.524-34.5000113Y11 C17Y11-P13 WeakPolarHBondContact O-CD 3.35Å; P13-C17 WeakPolarHBondContact O-CB 3.39Å; P13-C17 PolarHBondContact O-N 2.9Å
14K92.5Very high90.1Very high154 Ų154103.1 Ų103.167%0.6751%0.511SS*.Hα-helixtrans-65.5-49177.3-170.6179178.3-173.60111.7H12 A16 C17 E18H12-K14 VanDerWaalsContact C-N 3.28Å; H12-K14 PolarHBondContact O-N 3.15Å; K14-A16 VanDerWaalsContact C-N 3.32Å; K14-A16 PolarHBondContact O-N 3.32Å; K14-C17 WeakPolarHBondContact O-CB 3.33Å; K14-C17 PolarHBondContact O-N 3.33Å; K14-E18 WeakPolarHBondContact CE-OE1 3.12Å; K14-E18 WeakPolarHBondContact O-CG 3.17Å; K14-E18 PolarHBondContact O-N 3.01Å
15V92.4Very high90.9Very high83 Ų83101.5 Ų101.550%0.50351%0.51SS..Hα-helixtrans-63.8-41178.3179.80000110.5H12 C17 E18 M19H12-V15 HydrophobicContact CB-CB 4.2Å; H12-V15 HydrophobicContact CB-CG2 4.38Å; H12-V15 PolarHBondContact O-N 2.93Å; V15-C17 VanDerWaalsContact C-N 3.33Å; V15-C17 PolarHBondContact O-N 3.03Å; V15-E18 PolarHBondContact O-N 3.32Å; V15-M19 WeakPolarHBondContact O-CB 3.43Å; V15-M19 PolarHBondContact O-N 2.97Å
16A92.2Very high91.7Very high17 Ų1798.3 Ų98.314%0.1450%0.499CS..Hα-helixtrans-61.5-41.2175.900000112.2R9 H12 K14 T20R9-A16 HydrophobicContact CB-CB 3.63Å; R9-A16 HydrophobicContact CG-CB 3.72Å; H12-A16 WeakPolarHBondContact O-CB 3.42Å; H12-A16 PolarHBondContact O-N 2.91Å; K14-A16 VanDerWaalsContact C-N 3.32Å; K14-A16 PolarHBondContact O-N 3.32Å; A16-T20 WeakPolarHBondContact O-CB 3.35Å; A16-T20 PolarHBondContact O-N 3.44Å; A16-T20 PolarHBondContact O-OG1 3.44Å
17C92.3Very high92.2Very high66 Ų6699.9 Ų99.945%0.44649%0.492SS..Hα-helixtrans-64.3-49.2175.5-173.50000111.5P13 K14 V15 M19 T20 Q21P13-C17 WeakPolarHBondContact O-CB 3.39Å; P13-C17 PolarHBondContact O-N 2.9Å; K14-C17 WeakPolarHBondContact O-CB 3.33Å; K14-C17 PolarHBondContact O-N 3.33Å; V15-C17 VanDerWaalsContact C-N 3.33Å; V15-C17 PolarHBondContact O-N 3.03Å; C17-M19 VanDerWaalsContact C-N 3.33Å; C17-M19 PolarHBondContact O-N 3.45Å; C17-T20 WeakPolarHBondContact O-CB 3.47Å; C17-T20 PolarHBondContact O-N 2.96Å; C17-T20 VanDerWaalsContact O-N 3.11Å; C17-Q21 WeakPolarHBondContact O-CG 3.29Å; C17-Q21 PolarHBondContact O-N 3.29Å
18E96Very high92.7Very high99 Ų99103.8 Ų103.846%0.46351%0.507SS..Hα-helixtrans-58.8-43.4177.8-72.4170.4178.200111.6K14 V15 T20 Q21 F22K14-E18 WeakPolarHBondContact CE-OE1 3.12Å; K14-E18 WeakPolarHBondContact O-CG 3.17Å; K14-E18 PolarHBondContact O-N 3.01Å; V15-E18 PolarHBondContact O-N 3.32Å; E18-T20 VanDerWaalsContact C-N 3.34Å; E18-T20 PolarHBondContact O-N 3.03Å; E18-Q21 PolarHBondContact O-N 3.03Å; E18-F22 PolarHBondContact O-N 3.45Å
19M94.2Very high93.5Very high112 Ų112103.4 Ų103.455%0.55250%0.5SS*.Hα-helixtrans-63-40.7175.9-16963.170.600111.8V15 C17 F22 M23V15-M19 WeakPolarHBondContact O-CB 3.43Å; V15-M19 PolarHBondContact O-N 2.97Å; C17-M19 VanDerWaalsContact C-N 3.33Å; C17-M19 PolarHBondContact O-N 3.45Å; M19-F22 PolarHBondContact O-N 3.37Å; M19-F22 HydrophobicContact SD-CD1 4.48Å; M19-M23 VanDerWaalsContact O-CG 3.27Å; M19-M23 WeakPolarHBondContact O-CG 3.44Å; M19-M23 PolarHBondContact O-N 3.41Å
20T95.2Very high94.2Very high89 Ų8998.3 Ų98.355%0.54648%0.484SS..Hα-helixtrans-63.6-43.5177.7-57.50000111.2A16 C17 E18 M23 D24A16-T20 WeakPolarHBondContact O-CB 3.35Å; A16-T20 PolarHBondContact O-N 3.44Å; A16-T20 PolarHBondContact O-OG1 3.44Å; C17-T20 WeakPolarHBondContact O-CB 3.47Å; C17-T20 PolarHBondContact O-N 2.96Å; C17-T20 VanDerWaalsContact O-N 3.11Å; E18-T20 VanDerWaalsContact C-N 3.34Å; E18-T20 PolarHBondContact O-N 3.03Å; T20-M23 PolarHBondContact O-N 2.94Å; T20-D24 PolarHBondContact O-N 3.35Å
21Q96.6Very high94.8Very high126 Ų12696.5 Ų96.559%0.58948%0.477SS*.Hα-helixtrans-63.6-42.1176-70178.3-8.900112.1C17 E18 D24 A25C17-Q21 WeakPolarHBondContact O-CG 3.29Å; C17-Q21 PolarHBondContact O-N 3.29Å; E18-Q21 PolarHBondContact O-N 3.03Å; Q21-D24 PolarHBondContact O-N 3.46Å; Q21-A25 PolarHBondContact O-N 3.34Å
22F96.7Very high95.2Very high123 Ų12394.3 Ų94.354%0.53947%0.472SS..Hα-helixtrans-60-46.9175.4173.6-96.7000111.7E18 M19 D24 A25 Y26E18-F22 PolarHBondContact O-N 3.45Å; M19-F22 PolarHBondContact O-N 3.37Å; M19-F22 HydrophobicContact SD-CD1 4.48Å; F22-D24 VanDerWaalsContact C-N 3.34Å; F22-D24 PolarHBondContact O-N 2.61Å; F22-A25 PolarHBondContact O-N 2.62Å; F22-Y26 WeakPolarHBondContact O-CB 3.4Å; F22-Y26 PolarHBondContact O-N 2.87Å
23M97.2Very high95.5Very high108 Ų10895.9 Ų95.953%0.53247%0.473SS..Hα-helixtrans-63.8-38.6179.9-70.4-63-70.100112.3M19 T20 Y26 W27M19-M23 VanDerWaalsContact O-CG 3.27Å; M19-M23 WeakPolarHBondContact O-CG 3.44Å; M19-M23 PolarHBondContact O-N 3.41Å; T20-M23 PolarHBondContact O-N 2.94Å; M23-Y26 PolarHBondContact O-N 3.05Å; M23-W27 WeakPolarHBondContact O-CB 3.21Å; M23-W27 PolarHBondContact O-N 3.24Å
24D98Very high95.9Very high71 Ų7197.7 Ų97.738%0.3847%0.472SS..Hα-helixtrans-63.7-45.8174.3179.152.7000111.9T20 Q21 F22 Y26 W27 K28T20-D24 PolarHBondContact O-N 3.35Å; Q21-D24 PolarHBondContact O-N 3.46Å; F22-D24 VanDerWaalsContact C-N 3.34Å; F22-D24 PolarHBondContact O-N 2.61Å; D24-Y26 VanDerWaalsContact C-N 3.34Å; D24-Y26 PolarHBondContact O-N 2.81Å; D24-W27 PolarHBondContact O-N 3.16Å; D24-K28 WeakPolarHBondContact O-CG 3.45Å; D24-K28 PolarHBondContact O-N 2.95Å; D24-K28 WeakPolarHBondContact OD1-CE 3.41Å; D24-K28 IonicContact OD1-NZ 3.1Å; D24-K28 WeakPolarHBondContact OD2-CE 3.3Å; D24-K28 IonicContact OD2-NZ 2.62Å; D24-K28 PolarHBondContact OD2-NZ 3.22Å
25A97.8Very high96Very high58 Ų5896.7 Ų96.748%0.47947%0.473SS..Hα-helixtrans-62-41.8176.400000112.1Q21 F22 K28 L29Q21-A25 PolarHBondContact O-N 3.34Å; F22-A25 PolarHBondContact O-N 2.62Å; A25-K28 PolarHBondContact O-N 3.45Å; A25-L29 PolarHBondContact O-N 2.74Å
26Y97.8Very high95.8Very high113 Ų11398.6 Ų98.644%0.44348%0.48SS..Hα-helixtrans-64.4-43.1176.8-177.8-100.8000112F22 M23 D24 L29 N30F22-Y26 WeakPolarHBondContact O-CB 3.4Å; F22-Y26 PolarHBondContact O-N 2.87Å; M23-Y26 PolarHBondContact O-N 3.05Å; D24-Y26 VanDerWaalsContact C-N 3.34Å; D24-Y26 PolarHBondContact O-N 2.81Å; Y26-L29 PolarHBondContact O-N 3.03Å; Y26-N30 WeakPolarHBondContact CE1-ND2 3.23Å; Y26-N30 VanDerWaalsContact CZ-ND2 3.28Å; Y26-N30 PolarHBondContact O-N 2.95Å; Y26-N30 PolarHBondContact OH-ND2 2.68Å
27W97.4Very high95Very high150 Ų150104.8 Ų104.857%0.56852%0.522SS*.Hα-helixtrans-59.9-48.8175.8176.374.4000111.3M23 D24 L29 N30 E31M23-W27 WeakPolarHBondContact O-CB 3.21Å; M23-W27 PolarHBondContact O-N 3.24Å; D24-W27 PolarHBondContact O-N 3.16Å; W27-L29 VanDerWaalsContact C-N 3.31Å; W27-L29 PolarHBondContact O-N 2.99Å; W27-N30 PolarHBondContact O-N 3.33Å; W27-N30 VanDerWaalsContact O-N 3.09Å; W27-E31 HydrophobicContact CD2-CG 4.08Å; W27-E31 HydrophobicContact CH2-CG 4.27Å; W27-E31 HydrophobicContact CZ2-CG 3.65Å; W27-E31 PolarHBondContact O-N 2.88Å
28K97.2Very high95.1Very high113 Ų113106.7 Ų106.749%0.49153%0.526SS..Hα-helixtrans-56.8-42.9176.3-73.7170.8178.7162.20112.5D24 A25 N30 E31 Q32D24-K28 WeakPolarHBondContact O-CG 3.45Å; D24-K28 PolarHBondContact O-N 2.95Å; D24-K28 WeakPolarHBondContact OD1-CE 3.41Å; D24-K28 IonicContact OD1-NZ 3.1Å; D24-K28 WeakPolarHBondContact OD2-CE 3.3Å; D24-K28 IonicContact OD2-NZ 2.62Å; D24-K28 PolarHBondContact OD2-NZ 3.22Å; A25-K28 PolarHBondContact O-N 3.45Å; K28-N30 VanDerWaalsContact C-N 3.35Å; K28-N30 PolarHBondContact O-N 3.11Å; K28-E31 PolarHBondContact O-N 3.37Å; K28-Q32 WeakPolarHBondContact O-CB 3.47Å; K28-Q32 PolarHBondContact O-N 2.86Å
29L97.1Very high95.1Very high83 Ų83107.1 Ų107.144%0.43553%0.53SS..Hα-helixtrans-61.7-42.9176.6-17867.5000111.8A25 Y26 W27 Q32 R33A25-L29 PolarHBondContact O-N 2.74Å; Y26-L29 PolarHBondContact O-N 3.03Å; W27-L29 VanDerWaalsContact C-N 3.31Å; W27-L29 PolarHBondContact O-N 2.99Å; L29-Q32 PolarHBondContact O-N 3.46Å; L29-R33 WeakPolarHBondContact O-CG 3.43Å; L29-R33 PolarHBondContact O-N 2.95Å
30N97.2Very high95.1Very high47 Ų47106.8 Ų106.825%0.25153%0.528SS..Hα-helixtrans-67.3-40.6178.3-84.3-13.2000112.4Y26 W27 K28 Q32 R33 K34Y26-N30 WeakPolarHBondContact CE1-ND2 3.23Å; Y26-N30 VanDerWaalsContact CZ-ND2 3.28Å; Y26-N30 PolarHBondContact O-N 2.95Å; Y26-N30 PolarHBondContact OH-ND2 2.68Å; W27-N30 PolarHBondContact O-N 3.33Å; W27-N30 VanDerWaalsContact O-N 3.09Å; K28-N30 VanDerWaalsContact C-N 3.35Å; K28-N30 PolarHBondContact O-N 3.11Å; N30-Q32 VanDerWaalsContact C-N 3.34Å; N30-R33 PolarHBondContact O-N 3.46Å; N30-K34 WeakPolarHBondContact O-CG 3.34Å; N30-K34 PolarHBondContact O-N 3.39Å; N30-K34 VanDerWaalsContact O-N 3.09Å
31E97.1Very high95.1Very high61 Ų61107.9 Ų107.929%0.28553%0.527SS..Hα-helixtrans-63.1-41.8173.8-67.5-5412300111.4W27 K28 R33 K34 L35W27-E31 HydrophobicContact CD2-CG 4.08Å; W27-E31 HydrophobicContact CH2-CG 4.27Å; W27-E31 HydrophobicContact CZ2-CG 3.65Å; W27-E31 PolarHBondContact O-N 2.88Å; K28-E31 PolarHBondContact O-N 3.37Å; E31-R33 VanDerWaalsContact C-N 3.29Å; E31-R33 PolarHBondContact O-N 2.94Å; E31-K34 PolarHBondContact O-N 2.94Å; E31-K34 IonicContact OE1-NZ 2.71Å; E31-K34 PolarHBondContact OE1-NZ 3.26Å; E31-K34 IonicContact OE2-NZ 3.98Å; E31-L35 WeakPolarHBondContact O-CG 3.45Å; E31-L35 PolarHBondContact O-N 3.23Å; E31-L35 VanDerWaalsContact O-N 3.08Å
32Q96.7Very high95Very high100 Ų100106.8 Ų106.847%0.46752%0.523SS..Hα-helixtrans-61.1-38.1174.8-171.863.462.600112.3K28 L29 N30 L35 N36K28-Q32 WeakPolarHBondContact O-CB 3.47Å; K28-Q32 PolarHBondContact O-N 2.86Å; L29-Q32 PolarHBondContact O-N 3.46Å; N30-Q32 VanDerWaalsContact C-N 3.34Å; Q32-L35 PolarHBondContact O-N 3.21Å; Q32-N36 PolarHBondContact NE2-OD1 3.48Å; Q32-N36 PolarHBondContact O-N 3.49Å; Q32-N36 VanDerWaalsContact O-N 3.15Å; Q32-N36 PolarHBondContact O-OD1 2.98Å
33R96.9Very high94.9Very high151 Ų151105.7 Ų105.757%0.5752%0.522SS*.Hα-helixtrans-64.7-40.3176.2-75.7173176179.7-3.2112.4L29 N30 E31 L35 N36 S37L29-R33 WeakPolarHBondContact O-CG 3.43Å; L29-R33 PolarHBondContact O-N 2.95Å; N30-R33 PolarHBondContact O-N 3.46Å; E31-R33 VanDerWaalsContact C-N 3.29Å; E31-R33 PolarHBondContact O-N 2.94Å; R33-L35 VanDerWaalsContact C-N 3.3Å; R33-L35 PolarHBondContact O-N 3.47Å; R33-N36 PolarHBondContact O-N 3.46Å; R33-S37 PolarHBondContact O-N 3.32Å
34K96.1Very high94.8Very high127 Ų127105.5 Ų105.555%0.55252%0.522SS*.Hα-helixtrans-65.4-33.3175.9-67.4173.1-173.4170.30112.5N30 E31 N36 S37N30-K34 WeakPolarHBondContact O-CG 3.34Å; N30-K34 PolarHBondContact O-N 3.39Å; N30-K34 VanDerWaalsContact O-N 3.09Å; E31-K34 PolarHBondContact O-N 2.94Å; E31-K34 IonicContact OE1-NZ 2.71Å; E31-K34 PolarHBondContact OE1-NZ 3.26Å; E31-K34 IonicContact OE2-NZ 3.98Å; K34-N36 VanDerWaalsContact C-N 3.33Å; K34-S37 PolarHBondContact O-OG 3.26Å
35L93.1Very high94.5Very high133 Ų133108.2 Ų108.270%0.69653%0.533SS*.Hα-helixtrans-75.2-24.7177.1-70.7172.2000112.9E31 Q32 R33E31-L35 WeakPolarHBondContact O-CG 3.45Å; E31-L35 PolarHBondContact O-N 3.23Å; E31-L35 VanDerWaalsContact O-N 3.08Å; Q32-L35 PolarHBondContact O-N 3.21Å; R33-L35 VanDerWaalsContact C-N 3.3Å; R33-L35 PolarHBondContact O-N 3.47Å
36N89.4Confident94.2Very high123 Ų123112.3 Ų112.366%0.65854%0.537SS*.  trans-89.9-7-179.9-68-4.7000113.4Q32 R33 K34Q32-N36 PolarHBondContact NE2-OD1 3.48Å; Q32-N36 PolarHBondContact O-N 3.49Å; Q32-N36 VanDerWaalsContact O-N 3.15Å; Q32-N36 PolarHBondContact O-OD1 2.98Å; R33-N36 PolarHBondContact O-N 3.46Å; K34-N36 VanDerWaalsContact C-N 3.33Å
37S74.8Confident93.9Very high147 Ų147112.3 Ų112.3100%1.02855%0.546SS*.  trans-92.90174.562.90000111.4R33 K34R33-S37 PolarHBondContact O-N 3.32Å; K34-S37 PolarHBondContact O-OG 3.26Å

Retrieved 37 of 37 residues in 83.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).