A0A5K4F2I8_SCHMA Loading...

Reverse transcriptase domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F2I8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 40 aa.

						>A0A5K4F2I8_SCHMA|A0A5K4F2I8
MGDTVGPAAYVLFDELYTKENVFRSIITNNKTLNIRLLGR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.7	Very low	68.8	Low	231 Å²	231	104.6 Å²	104.6	100%	1.138	63%	0.634	S	S	*	*				0	117.6	0	-108.4	69.3	171.6	0	0	106.4	D3	M1-D3 PolarHBondContact O-N 2.62Å
2	G	57.3	Low	69.3	Low	67 Å²	67	104.7 Å²	104.7	69%	0.691	63%	0.627	S	S	*	*			trans	-67.4	123.4	176.9	0	0	0	0	0	108.9	T4	G2-T4 PolarHBondContact O-N 2.88Å; G2-T4 PolarHBondContact O-OG1 3.07Å
3	D	61.4	Low	70	Confident	164 Å²	164	106.4 Å²	106.4	88%	0.877	62%	0.622	S	S	*	*			trans	-60.9	89.2	175.2	-66.2	-56.7	0	0	0	108.4	M1 V5	M1-D3 PolarHBondContact O-N 2.62Å; D3-V5 PolarHBondContact O-N 3.01Å
4	T	64	Low	70.8	Confident	132 Å²	132	106.4 Å²	106.4	81%	0.81	62%	0.618	S	S	*	*			trans	-76	101.8	-177.5	-43.3	0	0	0	0	104.7	G2 G6	G2-T4 PolarHBondContact O-N 2.88Å; G2-T4 PolarHBondContact O-OG1 3.07Å; T4-G6 PolarHBondContact O-N 3.07Å
5	V	66.5	Low	71.7	Confident	72 Å²	72	106.3 Å²	106.3	44%	0.436	61%	0.609	S	S	.	*			trans	-55.2	112.7	179.4	-128.2	0	0	0	0	107.5	D3 A9 Y10 F13	D3-V5 PolarHBondContact O-N 3.01Å; V5-A9 HydrophobicContact CB-CB 4.34Å; V5-A9 HydrophobicContact CG1-CB 3.61Å; V5-Y10 HydrophobicContact CB-CD2 4.37Å; V5-Y10 HydrophobicContact CB-CE2 4.23Å; V5-Y10 HydrophobicContact CG2-CE2 4.24Å; V5-F13 HydrophobicContact CG1-CE2 4.11Å
6	G	71.1	Confident	72.3	Confident	35 Å²	35	106.4 Å²	106.4	36%	0.361	61%	0.607	S	S	.	*			trans	-59.8	154.4	-175	0	0	0	0	0	111	T4 A8 A9 Y10	T4-G6 PolarHBondContact O-N 3.07Å; G6-A8 PolarHBondContact O-N 2.86Å; G6-A9 WeakPolarHBondContact O-CA 3.18Å; G6-A9 WeakPolarHBondContact O-CB 3.2Å; G6-A9 PolarHBondContact O-N 3.13Å; G6-Y10 PolarHBondContact O-N 2.65Å
7	P	78.8	Confident	72.9	Confident	114 Å²	114	107.9 Å²	107.9	74%	0.74	60%	0.602	S	S	*	*	H	α-helix	trans	-53.6	-31.7	-176.9	16	-28.6	0	0	0	113.4	A9 Y10 V11	P7-A9 VanDerWaalsContact C-N 3.35Å; P7-A9 PolarHBondContact O-N 3.44Å; P7-Y10 WeakPolarHBondContact O-CB 3.45Å; P7-Y10 PolarHBondContact O-N 2.86Å; P7-V11 WeakPolarHBondContact O-CG2 3.34Å; P7-V11 PolarHBondContact O-N 2.63Å; P7-V11 VanDerWaalsContact O-N 3.11Å
8	A	76.8	Confident	73.7	Confident	70 Å²	70	106.2 Å²	106.2	58%	0.579	59%	0.594	S	S	*	*	H	α-helix	trans	-62.8	-37.4	173.9	0	0	0	0	0	113.4	G6 V11 L12	G6-A8 PolarHBondContact O-N 2.86Å; A8-V11 PolarHBondContact O-N 2.74Å; A8-L12 WeakPolarHBondContact O-CG 3.43Å; A8-L12 PolarHBondContact O-N 3.31Å; A8-L12 VanDerWaalsContact O-N 3.09Å
9	A	77.1	Confident	74.2	Confident	28 Å²	28	108.1 Å²	108.1	23%	0.231	60%	0.595	C	S	.	*	H	α-helix	trans	-67.8	-38.5	175.6	0	0	0	0	0	111.1	V5 G6 P7 V11 L12 F13	V5-A9 HydrophobicContact CB-CB 4.34Å; V5-A9 HydrophobicContact CG1-CB 3.61Å; G6-A9 WeakPolarHBondContact O-CA 3.18Å; G6-A9 WeakPolarHBondContact O-CB 3.2Å; G6-A9 PolarHBondContact O-N 3.13Å; P7-A9 VanDerWaalsContact C-N 3.35Å; P7-A9 PolarHBondContact O-N 3.44Å; A9-V11 PolarHBondContact O-N 3.47Å; A9-L12 PolarHBondContact O-N 3.18Å; A9-F13 HydrophobicContact CB-CD2 4.49Å; A9-F13 HydrophobicContact CB-CE2 4.27Å; A9-F13 WeakPolarHBondContact O-CD2 3.42Å; A9-F13 PolarHBondContact O-N 3.37Å
10	Y	78.3	Confident	74.7	Confident	155 Å²	155	106.5 Å²	106.5	61%	0.608	58%	0.583	S	S	*	*	H	α-helix	trans	-59.7	-44.5	173.7	-98	-81.9	0	0	0	112.5	V5 G6 P7 L12 F13 D14	V5-Y10 HydrophobicContact CB-CD2 4.37Å; V5-Y10 HydrophobicContact CB-CE2 4.23Å; V5-Y10 HydrophobicContact CG2-CE2 4.24Å; G6-Y10 PolarHBondContact O-N 2.65Å; P7-Y10 WeakPolarHBondContact O-CB 3.45Å; P7-Y10 PolarHBondContact O-N 2.86Å; Y10-L12 VanDerWaalsContact C-N 3.33Å; Y10-L12 PolarHBondContact O-N 2.91Å; Y10-F13 PolarHBondContact O-N 3.02Å; Y10-D14 WeakPolarHBondContact O-CB 3.47Å; Y10-D14 PolarHBondContact O-N 3.3Å
11	V	81.8	Confident	75.1	Confident	83 Å²	83	104.8 Å²	104.8	50%	0.503	57%	0.574	S	S	.	*	H	α-helix	trans	-60.6	-43.7	175.6	175.1	0	0	0	0	111	P7 A8 A9 F13 D14 E15	P7-V11 WeakPolarHBondContact O-CG2 3.34Å; P7-V11 PolarHBondContact O-N 2.63Å; P7-V11 VanDerWaalsContact O-N 3.11Å; A8-V11 PolarHBondContact O-N 2.74Å; A9-V11 PolarHBondContact O-N 3.47Å; V11-F13 PolarHBondContact O-N 2.99Å; V11-D14 PolarHBondContact O-N 2.83Å; V11-E15 WeakPolarHBondContact O-CG 3.23Å; V11-E15 PolarHBondContact O-N 2.84Å
12	L	74.5	Confident	76.9	Confident	105 Å²	105	97.8 Å²	97.8	55%	0.55	54%	0.544	S	S	.	.	H	α-helix	trans	-62	-41.7	176.2	-75.3	163.8	0	0	0	112.1	A8 A9 Y10 L16	A8-L12 WeakPolarHBondContact O-CG 3.43Å; A8-L12 PolarHBondContact O-N 3.31Å; A8-L12 VanDerWaalsContact O-N 3.09Å; A9-L12 PolarHBondContact O-N 3.18Å; Y10-L12 VanDerWaalsContact C-N 3.33Å; Y10-L12 PolarHBondContact O-N 2.91Å; L12-L16 WeakPolarHBondContact O-CB 3.28Å; L12-L16 WeakPolarHBondContact O-CD1 3.49Å; L12-L16 WeakPolarHBondContact O-CG 3.46Å; L12-L16 PolarHBondContact O-N 3.33Å
13	F	78.7	Confident	77.7	Confident	127 Å²	127	99.6 Å²	99.6	56%	0.557	53%	0.533	S	S	*	.	H	α-helix	trans	-64.8	-39.9	175.7	-75.7	-61	0	0	0	112.2	V5 A9 Y10 V11 L16 Y17	V5-F13 HydrophobicContact CG1-CE2 4.11Å; A9-F13 HydrophobicContact CB-CD2 4.49Å; A9-F13 HydrophobicContact CB-CE2 4.27Å; A9-F13 WeakPolarHBondContact O-CD2 3.42Å; A9-F13 PolarHBondContact O-N 3.37Å; Y10-F13 PolarHBondContact O-N 3.02Å; V11-F13 PolarHBondContact O-N 2.99Å; F13-L16 PolarHBondContact O-N 2.93Å; F13-Y17 VanDerWaalsContact O-CB 3.28Å; F13-Y17 WeakPolarHBondContact O-CB 2.98Å; F13-Y17 PolarHBondContact O-N 3.22Å
14	D	81.6	Confident	78.5	Confident	106 Å²	106	98.6 Å²	98.6	57%	0.567	52%	0.517	S	S	*	.	H	α-helix	trans	-70	-39.8	-179	-156.6	41.3	0	0	0	111.8	Y10 V11 Y17 T18	Y10-D14 WeakPolarHBondContact O-CB 3.47Å; Y10-D14 PolarHBondContact O-N 3.3Å; V11-D14 PolarHBondContact O-N 2.83Å; D14-Y17 PolarHBondContact O-N 3.44Å; D14-T18 VanDerWaalsContact O-CB 3.29Å; D14-T18 WeakPolarHBondContact O-CB 3.32Å; D14-T18 PolarHBondContact O-N 3.24Å; D14-T18 PolarHBondContact O-OG1 2.91Å
15	E	84.4	Confident	79.2	Confident	105 Å²	105	95 Å²	95	49%	0.491	50%	0.497	S	S	.	.	H	α-helix	trans	-63	-43.5	171.7	-75.3	-174.5	-175.4	0	0	112	V11 T18 K19	V11-E15 WeakPolarHBondContact O-CG 3.23Å; V11-E15 PolarHBondContact O-N 2.84Å; E15-T18 PolarHBondContact O-N 3.03Å; E15-K19 WeakPolarHBondContact O-CB 3.09Å; E15-K19 WeakPolarHBondContact O-CG 3.45Å; E15-K19 PolarHBondContact O-N 3.14Å
16	L	81.2	Confident	79.6	Confident	109 Å²	109	95.1 Å²	95.1	57%	0.571	49%	0.494	S	S	*	.	H	α-helix	trans	-62.6	-46.2	176.6	-76.7	169	0	0	0	111.1	L12 F13 K19 E20	L12-L16 WeakPolarHBondContact O-CB 3.28Å; L12-L16 WeakPolarHBondContact O-CD1 3.49Å; L12-L16 WeakPolarHBondContact O-CG 3.46Å; L12-L16 PolarHBondContact O-N 3.33Å; F13-L16 PolarHBondContact O-N 2.93Å; L16-K19 PolarHBondContact O-N 3.48Å; L16-E20 WeakPolarHBondContact O-CB 3.39Å; L16-E20 PolarHBondContact O-N 2.8Å
17	Y	82.3	Confident	79.6	Confident	132 Å²	132	96.6 Å²	96.6	52%	0.518	49%	0.493	S	S	.	.	H	α-helix	trans	-65.2	-40.3	179.4	-170.8	-104.7	0	0	0	112	F13 D14 K19 E20 N21	F13-Y17 VanDerWaalsContact O-CB 3.28Å; F13-Y17 WeakPolarHBondContact O-CB 2.98Å; F13-Y17 PolarHBondContact O-N 3.22Å; D14-Y17 PolarHBondContact O-N 3.44Å; Y17-K19 PolarHBondContact O-N 2.91Å; Y17-E20 WeakPolarHBondContact O-CB 3.46Å; Y17-E20 PolarHBondContact O-N 3.02Å; Y17-N21 WeakPolarHBondContact CD1-ND2 3.35Å; Y17-N21 WeakPolarHBondContact CE1-ND2 3.33Å; Y17-N21 PolarHBondContact O-N 3.28Å; Y17-N21 PolarHBondContact O-ND2 2.98Å
18	T	86.7	Confident	79.2	Confident	76 Å²	76	96 Å²	96	47%	0.466	49%	0.488	S	S	.	.	H	α-helix	trans	-61	-46.1	174.2	-62.2	0	0	0	0	110.9	D14 E15 E20 N21 V22	D14-T18 VanDerWaalsContact O-CB 3.29Å; D14-T18 WeakPolarHBondContact O-CB 3.32Å; D14-T18 PolarHBondContact O-N 3.24Å; D14-T18 PolarHBondContact O-OG1 2.91Å; E15-T18 PolarHBondContact O-N 3.03Å; T18-E20 VanDerWaalsContact C-N 3.34Å; T18-E20 PolarHBondContact O-N 3.47Å; T18-N21 PolarHBondContact O-N 3.38Å; T18-V22 WeakPolarHBondContact O-CG2 3.47Å; T18-V22 PolarHBondContact O-N 3.23Å
19	K	83.8	Confident	78.9	Confident	142 Å²	142	98.7 Å²	98.7	62%	0.617	49%	0.492	S	S	*	.	H	α-helix	trans	-64.8	-38.4	177	-74.1	-179.5	-176.2	175.9	0	112.3	E15 L16 Y17 V22 F23	E15-K19 WeakPolarHBondContact O-CB 3.09Å; E15-K19 WeakPolarHBondContact O-CG 3.45Å; E15-K19 PolarHBondContact O-N 3.14Å; L16-K19 PolarHBondContact O-N 3.48Å; Y17-K19 PolarHBondContact O-N 2.91Å; K19-V22 PolarHBondContact O-N 3.35Å; K19-F23 WeakPolarHBondContact O-CB 3.44Å; K19-F23 PolarHBondContact O-N 3.48Å
20	E	83.7	Confident	78	Confident	77 Å²	77	101 Å²	101	36%	0.36	50%	0.501	S	S	.	.	H	α-helix	trans	-61.5	-45.1	175.3	-169.2	-165.8	146.1	0	0	111.4	L16 Y17 T18 V22 F23 R24	L16-E20 WeakPolarHBondContact O-CB 3.39Å; L16-E20 PolarHBondContact O-N 2.8Å; Y17-E20 WeakPolarHBondContact O-CB 3.46Å; Y17-E20 PolarHBondContact O-N 3.02Å; T18-E20 VanDerWaalsContact C-N 3.34Å; T18-E20 PolarHBondContact O-N 3.47Å; E20-V22 PolarHBondContact O-N 2.85Å; E20-F23 PolarHBondContact O-N 3.44Å; E20-R24 WeakPolarHBondContact O-CB 3.46Å; E20-R24 WeakPolarHBondContact O-CG 3.47Å; E20-R24 PolarHBondContact O-N 2.86Å; E20-R24 IonicContact OE1-CZ 3.09Å; E20-R24 IonicContact OE1-NE 2.74Å; E20-R24 PolarHBondContact OE1-NE 2.86Å; E20-R24 IonicContact OE1-NH2 2.63Å; E20-R24 PolarHBondContact OE1-NH2 2.97Å
21	N	83.1	Confident	77	Confident	70 Å²	70	103.3 Å²	103.3	37%	0.374	51%	0.514	S	S	.	.	H	α-helix	trans	-64	-40	177.1	-79.6	-29.7	0	0	0	112.3	Y17 T18 S25	Y17-N21 WeakPolarHBondContact CD1-ND2 3.35Å; Y17-N21 WeakPolarHBondContact CE1-ND2 3.33Å; Y17-N21 PolarHBondContact O-N 3.28Å; Y17-N21 PolarHBondContact O-ND2 2.98Å; T18-N21 PolarHBondContact O-N 3.38Å; N21-S25 WeakPolarHBondContact O-CB 3.2Å; N21-S25 PolarHBondContact O-N 3.01Å
22	V	81.3	Confident	75.5	Confident	84 Å²	84	105.1 Å²	105.1	51%	0.509	53%	0.525	S	S	.	.	H	α-helix	trans	-61.3	-46.5	173.1	172.3	0	0	0	0	110.3	T18 K19 E20 S25 I26	T18-V22 WeakPolarHBondContact O-CG2 3.47Å; T18-V22 PolarHBondContact O-N 3.23Å; K19-V22 PolarHBondContact O-N 3.35Å; E20-V22 PolarHBondContact O-N 2.85Å; V22-S25 WeakPolarHBondContact O-CB 3.48Å; V22-S25 PolarHBondContact O-N 2.73Å; V22-I26 HydrophobicContact CG1-CD1 3.97Å; V22-I26 WeakPolarHBondContact O-CG1 3.33Å; V22-I26 PolarHBondContact O-N 3.49Å
23	F	74.7	Confident	74.6	Confident	105 Å²	105	104.1 Å²	104.1	46%	0.461	52%	0.52	S	S	.	.	H	α-helix	trans	-63.2	-45.8	179.2	-173.3	-105.5	0	0	0	112.3	K19 E20 S25 I26 I27 I35	K19-F23 WeakPolarHBondContact O-CB 3.44Å; K19-F23 PolarHBondContact O-N 3.48Å; E20-F23 PolarHBondContact O-N 3.44Å; F23-S25 VanDerWaalsContact C-N 3.31Å; F23-S25 PolarHBondContact O-N 2.81Å; F23-I26 PolarHBondContact O-N 3.3Å; F23-I27 HydrophobicContact CD1-CD1 3.66Å; F23-I27 HydrophobicContact CE1-CD1 3.21Å; F23-I27 HydrophobicContact CE1-CG1 4.3Å; F23-I27 HydrophobicContact CE2-CD1 4.43Å; F23-I27 HydrophobicContact CG-CD1 4.44Å; F23-I27 HydrophobicContact CZ-CD1 3.66Å; F23-I27 HydrophobicContact CZ-CG1 4.43Å; F23-I27 WeakPolarHBondContact O-CG1 3.47Å; F23-I27 PolarHBondContact O-N 3.31Å; F23-I35 HydrophobicContact CE2-CD1 4.21Å; F23-I35 HydrophobicContact CZ-CD1 4.02Å
24	R	77.3	Confident	73.5	Confident	144 Å²	144	105.9 Å²	105.9	54%	0.543	54%	0.535	S	S	.	.	H	α-helix	trans	-59.9	-42.2	173.4	-75.2	-178.7	-168.5	-86	0.8	111.4	E20 I26 I27 T28	E20-R24 WeakPolarHBondContact O-CB 3.46Å; E20-R24 WeakPolarHBondContact O-CG 3.47Å; E20-R24 PolarHBondContact O-N 2.86Å; E20-R24 IonicContact OE1-CZ 3.09Å; E20-R24 IonicContact OE1-NE 2.74Å; E20-R24 PolarHBondContact OE1-NE 2.86Å; E20-R24 IonicContact OE1-NH2 2.63Å; E20-R24 PolarHBondContact OE1-NH2 2.97Å; R24-I26 VanDerWaalsContact C-N 3.34Å; R24-I26 PolarHBondContact O-N 3.36Å; R24-I27 PolarHBondContact O-N 3.5Å; R24-T28 WeakPolarHBondContact O-CB 3.29Å; R24-T28 PolarHBondContact O-N 3.03Å; R24-T28 PolarHBondContact O-OG1 2.82Å
25	S	79.2	Confident	72.5	Confident	56 Å²	56	104.7 Å²	104.7	39%	0.392	53%	0.528	S	S	.	.	H	α-helix	trans	-61.5	-42.3	177	-177.7	0	0	0	0	111.4	N21 V22 F23 T28 N29	N21-S25 WeakPolarHBondContact O-CB 3.2Å; N21-S25 PolarHBondContact O-N 3.01Å; V22-S25 WeakPolarHBondContact O-CB 3.48Å; V22-S25 PolarHBondContact O-N 2.73Å; F23-S25 VanDerWaalsContact C-N 3.31Å; F23-S25 PolarHBondContact O-N 2.81Å; S25-T28 PolarHBondContact O-N 3.26Å; S25-N29 VanDerWaalsContact O-CB 3.23Å; S25-N29 WeakPolarHBondContact O-CB 3.49Å; S25-N29 PolarHBondContact O-N 3.46Å; S25-N29 PolarHBondContact O-ND2 3.02Å; S25-N29 VanDerWaalsContact O-ND2 3.14Å; S25-N29 PolarHBondContact OG-ND2 3.27Å
26	I	75.8	Confident	71.2	Confident	75 Å²	75	109.6 Å²	109.6	39%	0.385	54%	0.542	S	S	.	.	H	α-helix	trans	-61.9	-46.5	175.9	-68.8	165.7	0	0	0	110.9	V22 F23 R24 N30 L33	V22-I26 HydrophobicContact CG1-CD1 3.97Å; V22-I26 WeakPolarHBondContact O-CG1 3.33Å; V22-I26 PolarHBondContact O-N 3.49Å; F23-I26 PolarHBondContact O-N 3.3Å; R24-I26 VanDerWaalsContact C-N 3.34Å; R24-I26 PolarHBondContact O-N 3.36Å; I26-N30 WeakPolarHBondContact O-CB 3.45Å; I26-N30 PolarHBondContact O-N 2.91Å; I26-N30 PolarHBondContact O-ND2 2.98Å; I26-L33 HydrophobicContact CG2-CD1 4.03Å
27	I	70.5	Confident	70.1	Confident	66 Å²	66	112 Å²	112	34%	0.338	56%	0.555	S	S	.	*	H	α-helix	trans	-65.2	-39.6	178.5	-67.5	172.1	0	0	0	111.6	F23 R24 N30	F23-I27 HydrophobicContact CD1-CD1 3.66Å; F23-I27 HydrophobicContact CE1-CD1 3.21Å; F23-I27 HydrophobicContact CE1-CG1 4.3Å; F23-I27 HydrophobicContact CE2-CD1 4.43Å; F23-I27 HydrophobicContact CG-CD1 4.44Å; F23-I27 HydrophobicContact CZ-CD1 3.66Å; F23-I27 HydrophobicContact CZ-CG1 4.43Å; F23-I27 WeakPolarHBondContact O-CG1 3.47Å; F23-I27 PolarHBondContact O-N 3.31Å; R24-I27 PolarHBondContact O-N 3.5Å; I27-N30 CarbonylContact O-C 3.3Å; I27-N30 VanDerWaalsContact O-C 3.3Å
28	T	71.2	Confident	68.7	Low	102 Å²	102	112.7 Å²	112.7	63%	0.626	57%	0.567	S	S	*	*	H	α-helix	trans	-78.5	-41.7	-174.1	-45.4	0	0	0	0	111.3	R24 S25	R24-T28 WeakPolarHBondContact O-CB 3.29Å; R24-T28 PolarHBondContact O-N 3.03Å; R24-T28 PolarHBondContact O-OG1 2.82Å; S25-T28 PolarHBondContact O-N 3.26Å
29	N	69.7	Low	67.1	Low	125 Å²	125	112.7 Å²	112.7	67%	0.668	58%	0.582	S	S	*	*	H	α-helix	trans	-73.2	-38.2	177	-75.5	-52.3	0	0	0	111.7	S25 K31	S25-N29 VanDerWaalsContact O-CB 3.23Å; S25-N29 WeakPolarHBondContact O-CB 3.49Å; S25-N29 PolarHBondContact O-N 3.46Å; S25-N29 PolarHBondContact O-ND2 3.02Å; S25-N29 VanDerWaalsContact O-ND2 3.14Å; S25-N29 PolarHBondContact OG-ND2 3.27Å; N29-K31 PolarHBondContact O-N 3.24Å
30	N	59.3	Low	64.8	Low	77 Å²	77	121.3 Å²	121.3	41%	0.412	61%	0.61	S	S	.	*	S	Bend	trans	-89.6	84.3	167.2	-62.3	-80.4	0	0	0	108.6	I26 I27 T32 L33	I26-N30 WeakPolarHBondContact O-CB 3.45Å; I26-N30 PolarHBondContact O-N 2.91Å; I26-N30 PolarHBondContact O-ND2 2.98Å; I27-N30 CarbonylContact O-C 3.3Å; I27-N30 VanDerWaalsContact O-C 3.3Å; N30-T32 PolarHBondContact O-N 2.89Å; N30-L33 HydrophobicContact CB-CD1 3.87Å; N30-L33 PolarHBondContact O-N 3.46Å
31	K	55.4	Low	63.9	Low	203 Å²	203	123.5 Å²	123.5	88%	0.883	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	-47.8	2.7	171.2	-74.2	-173.7	175.3	-179.5	0	115.7	N29	N29-K31 PolarHBondContact O-N 3.24Å
32	T	51	Low	62.9	Low	122 Å²	122	126.3 Å²	126.3	75%	0.748	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-131.1	3.4	-165.5	15.2	0	0	0	0	114.5	N30 N34	N30-T32 PolarHBondContact O-N 2.89Å; T32-N34 VanDerWaalsContact C-N 3.28Å; T32-N34 PolarHBondContact O-N 3.25Å
33	L	56.2	Low	61.9	Low	84 Å²	84	128.7 Å²	128.7	44%	0.44	64%	0.643	S	S	.	*			trans	-83.2	80.5	170.8	-101.6	136.4	0	0	0	110	I26 N30 I35	I26-L33 HydrophobicContact CG2-CD1 4.03Å; N30-L33 HydrophobicContact CB-CD1 3.87Å; N30-L33 PolarHBondContact O-N 3.46Å; L33-I35 HydrophobicContact CB-CD1 4.37Å; L33-I35 HydrophobicContact CB-CG1 4.09Å; L33-I35 HydrophobicContact CD2-CD1 3.64Å; L33-I35 HydrophobicContact CD2-CG1 3.51Å; L33-I35 HydrophobicContact CG-CG1 4.41Å; L33-I35 PolarHBondContact O-N 3.46Å
34	N	55.3	Low	61.1	Low	163 Å²	163	130.1 Å²	130.1	87%	0.872	65%	0.654	S	S	*	*			trans	-74.1	65.3	172.3	-143.6	-18	0	0	0	109.1	T32 R36	T32-N34 VanDerWaalsContact C-N 3.28Å; T32-N34 PolarHBondContact O-N 3.25Å; N34-R36 PolarHBondContact O-N 3.09Å; N34-R36 VanDerWaalsContact O-N 3.13Å
35	I	60.2	Low	60.1	Low	81 Å²	81	129.2 Å²	129.2	42%	0.415	66%	0.66	S	S	.	*			trans	-77.9	100.5	-179.6	-49.4	174.6	0	0	0	107.6	F23 L33 L37	F23-I35 HydrophobicContact CE2-CD1 4.21Å; F23-I35 HydrophobicContact CZ-CD1 4.02Å; L33-I35 HydrophobicContact CB-CD1 4.37Å; L33-I35 HydrophobicContact CB-CG1 4.09Å; L33-I35 HydrophobicContact CD2-CD1 3.64Å; L33-I35 HydrophobicContact CD2-CG1 3.51Å; L33-I35 HydrophobicContact CG-CG1 4.41Å; L33-I35 PolarHBondContact O-N 3.46Å; I35-L37 PolarHBondContact O-N 3.49Å
36	R	56.5	Low	58.8	Low	209 Å²	209	134.1 Å²	134.1	79%	0.789	68%	0.678	S	S	*	*			trans	-72.9	98.6	169	-159.3	169	-160.6	-177.4	4.2	107.8	N34 L38	N34-R36 PolarHBondContact O-N 3.09Å; N34-R36 VanDerWaalsContact O-N 3.13Å; R36-L38 VanDerWaalsContact C-N 3.26Å; R36-L38 HydrophobicContact CG-CD2 4.14Å; R36-L38 HydrophobicContact CG-CG 4.35Å; R36-L38 PolarHBondContact O-N 2.95Å
37	L	58.3	Low	57.6	Low	160 Å²	160	138.3 Å²	138.3	84%	0.838	70%	0.699	S	S	*	*			trans	-64	91.9	167	-85.4	158.2	0	0	0	107.9	I35 G39	I35-L37 PolarHBondContact O-N 3.49Å; L37-G39 VanDerWaalsContact C-N 3.28Å; L37-G39 PolarHBondContact O-N 3.43Å
38	L	54.1	Low	56.6	Low	146 Å²	146	143.8 Å²	143.8	76%	0.764	73%	0.727	S	S	*	*			trans	-77.6	85.2	170	-68.4	171.5	0	0	0	107.4	R36 R40	R36-L38 VanDerWaalsContact C-N 3.26Å; R36-L38 HydrophobicContact CG-CD2 4.14Å; R36-L38 HydrophobicContact CG-CG 4.35Å; R36-L38 PolarHBondContact O-N 2.95Å; L38-R40 PolarHBondContact O-N 3.11Å
39	G	51.8	Low	55.4	Low	76 Å²	76	147.3 Å²	147.3	78%	0.784	74%	0.736	S	S	*	*			trans	-68.7	120.9	165.1	0	0	0	0	0	109.2	L37	L37-G39 VanDerWaalsContact C-N 3.28Å; L37-G39 PolarHBondContact O-N 3.43Å
40	R	37.4	Very low	54.1	Low	322 Å²	322	149.4 Å²	149.4	100%	1.215	74%	0.742	S	S	*	*			trans	-90.9	0	154.3	-79.9	-172	175.7	175.6	-0.4	108.5	L38	L38-R40 PolarHBondContact O-N 3.11Å

Retrieved 40 of 40 residues in 42.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).