A0A5K4F2R1_SCHMA Loading...

Biogenesis of lysosome-related organelles complex 1 subunit 7

AlphaFold DB , UniProt , Accession A0A5K4F2R1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 139 aa.

						>A0A5K4F2R1_SCHMA|A0A5K4F2R1
MDSNVCMIDDFSDLKDLVEKSRNVEADVFDEIKDLLARRSEIEHKLKKINSLIPDFHKLQVNAENSSKLVGCASKLALQLSGKVEQLDFVKNHVLKCVDKLSHIITVRNSAIGVKRCLVDSKLDEPLVTCLHIWKWRKT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.5	Very low	61.5	Low	221 Å²	221	121.5 Å²	121.5	100%	1.089	65%	0.651	S	S	*	*				0	53.6	0	-141.8	-179.9	176.2	0	0	106
2	D	54.5	Low	63.5	Low	136 Å²	136	116.3 Å²	116.3	73%	0.727	63%	0.632	S	S	*	*			trans	-112.5	2.8	-146.4	-49.9	-45.8	0	0	0	113.9	N4	D2-N4 VanDerWaalsContact C-N 3.26Å; D2-N4 PolarHBondContact O-N 3.41Å
3	S	58.7	Low	65.4	Low	94 Å²	94	115.5 Å²	115.5	66%	0.657	63%	0.627	S	S	*	*	H	α-helix	trans	-72	-16.8	179.9	-172.1	0	0	0	0	113.8
4	N	55.5	Low	67.1	Low	126 Å²	126	114.4 Å²	114.4	67%	0.674	62%	0.619	S	S	*	*	H	α-helix	trans	-86.1	-18.9	-178	-117.7	7.8	0	0	0	113.3	D2 I8	D2-N4 VanDerWaalsContact C-N 3.26Å; D2-N4 PolarHBondContact O-N 3.41Å; N4-I8 WeakPolarHBondContact O-CD1 3.23Å; N4-I8 VanDerWaalsContact O-CG1 3.23Å; N4-I8 WeakPolarHBondContact O-CG1 3.44Å
5	V	54.2	Low	68.7	Low	94 Å²	94	115.7 Å²	115.7	57%	0.57	62%	0.617	S	S	*	*	H	α-helix	trans	-82.8	-40.6	-179.4	179.2	0	0	0	0	111	M7 I8 D9	V5-M7 PolarHBondContact O-N 3.31Å; V5-I8 PolarHBondContact O-N 3.23Å; V5-I8 VanDerWaalsContact O-N 3.16Å; V5-D9 PolarHBondContact O-N 3.45Å
6	C	56.8	Low	70.1	Confident	79 Å²	79	114.1 Å²	114.1	53%	0.534	61%	0.608	S	S	.	*	H	α-helix	trans	-61.8	-39.4	176.8	-169	0	0	0	0	113	I8 D9 D10	C6-I8 VanDerWaalsContact C-N 3.3Å; C6-I8 PolarHBondContact O-N 3.34Å; C6-D9 PolarHBondContact O-N 3.16Å; C6-D10 PolarHBondContact O-N 3.44Å
7	M	57.5	Low	71.4	Confident	126 Å²	126	114.6 Å²	114.6	62%	0.621	61%	0.61	S	S	*	*	H	α-helix	trans	-69.5	-25.9	177.5	-74.5	-80.8	-178.9	0	0	113.1	V5 F11	V5-M7 PolarHBondContact O-N 3.31Å; M7-F11 WeakPolarHBondContact O-CB 3.28Å; M7-F11 PolarHBondContact O-N 3Å
8	I	59.6	Low	72.6	Confident	110 Å²	110	111.8 Å²	111.8	56%	0.564	60%	0.598	S	S	*	*	H	α-helix	trans	-78.5	-37	177.6	-69	168.5	0	0	0	110.5	N4 V5 C6 F11 S12	N4-I8 WeakPolarHBondContact O-CD1 3.23Å; N4-I8 VanDerWaalsContact O-CG1 3.23Å; N4-I8 WeakPolarHBondContact O-CG1 3.44Å; V5-I8 PolarHBondContact O-N 3.23Å; V5-I8 VanDerWaalsContact O-N 3.16Å; C6-I8 VanDerWaalsContact C-N 3.3Å; C6-I8 PolarHBondContact O-N 3.34Å; I8-F11 PolarHBondContact O-N 2.95Å; I8-S12 WeakPolarHBondContact O-CB 3.41Å; I8-S12 PolarHBondContact O-N 2.92Å
9	D	71.4	Confident	73.8	Confident	99 Å²	99	110.9 Å²	110.9	53%	0.529	59%	0.59	S	S	.	*	H	α-helix	trans	-62.8	-48.1	174.1	-83.1	-15.4	0	0	0	111.3	V5 C6 F11 S12 D13	V5-D9 PolarHBondContact O-N 3.45Å; C6-D9 PolarHBondContact O-N 3.16Å; D9-F11 VanDerWaalsContact C-N 3.26Å; D9-F11 PolarHBondContact O-N 3.27Å; D9-S12 PolarHBondContact O-N 3.33Å; D9-S12 VanDerWaalsContact O-N 3.12Å; D9-D13 PolarHBondContact O-N 2.94Å
10	D	78.4	Confident	74.8	Confident	97 Å²	97	112.4 Å²	112.4	52%	0.519	59%	0.591	S	S	.	*	H	α-helix	trans	-59.4	-37	176.5	-71.4	-25.8	0	0	0	112.3	C6 L14	C6-D10 PolarHBondContact O-N 3.44Å; D10-L14 VanDerWaalsContact O-CB 3.28Å; D10-L14 WeakPolarHBondContact O-CB 3.22Å; D10-L14 PolarHBondContact O-N 3.33Å
11	F	82	Confident	75.8	Confident	154 Å²	154	110.5 Å²	110.5	68%	0.675	59%	0.587	S	S	*	*	H	α-helix	trans	-74.1	-32.8	178.8	-153.1	-90.9	0	0	0	112.3	M7 I8 D9 K15	M7-F11 WeakPolarHBondContact O-CB 3.28Å; M7-F11 PolarHBondContact O-N 3Å; I8-F11 PolarHBondContact O-N 2.95Å; D9-F11 VanDerWaalsContact C-N 3.26Å; D9-F11 PolarHBondContact O-N 3.27Å; F11-K15 WeakPolarHBondContact O-CB 3.27Å; F11-K15 PolarHBondContact O-N 3.43Å
12	S	86.1	Confident	78.1	Confident	60 Å²	60	107.2 Å²	107.2	42%	0.42	56%	0.562	S	S	.	*	H	α-helix	trans	-69.3	-45.8	174.1	-164.6	0	0	0	0	111.2	I8 D9 L14 K15 D16	I8-S12 WeakPolarHBondContact O-CB 3.41Å; I8-S12 PolarHBondContact O-N 2.92Å; D9-S12 PolarHBondContact O-N 3.33Å; D9-S12 VanDerWaalsContact O-N 3.12Å; S12-L14 VanDerWaalsContact C-N 3.34Å; S12-L14 PolarHBondContact O-N 3.43Å; S12-K15 WeakPolarHBondContact O-CB 3.42Å; S12-K15 PolarHBondContact O-N 3.15Å; S12-K15 VanDerWaalsContact O-N 3.15Å; S12-D16 PolarHBondContact O-N 2.91Å
13	D	87.9	Confident	80.1	Confident	106 Å²	106	105.1 Å²	105.1	57%	0.567	55%	0.551	S	S	*	*	H	α-helix	trans	-61.8	-42.7	176.2	-77.9	-13.6	0	0	0	111.5	D9 K15 D16 L17	D9-D13 PolarHBondContact O-N 2.94Å; D13-K15 VanDerWaalsContact C-N 3.31Å; D13-K15 PolarHBondContact O-N 3.06Å; D13-D16 PolarHBondContact O-N 3.12Å; D13-L17 WeakPolarHBondContact O-CB 3.4Å; D13-L17 PolarHBondContact O-N 2.94Å
14	L	89.2	Confident	81.9	Confident	100 Å²	100	104.8 Å²	104.8	52%	0.524	55%	0.545	S	S	.	.	H	α-helix	trans	-60.9	-41.1	174.6	-178	63.4	0	0	0	111.5	D10 S12 L17 V18	D10-L14 VanDerWaalsContact O-CB 3.28Å; D10-L14 WeakPolarHBondContact O-CB 3.22Å; D10-L14 PolarHBondContact O-N 3.33Å; S12-L14 VanDerWaalsContact C-N 3.34Å; S12-L14 PolarHBondContact O-N 3.43Å; L14-L17 PolarHBondContact O-N 2.9Å; L14-V18 VanDerWaalsContact O-CG2 3.27Å; L14-V18 WeakPolarHBondContact O-CG2 3.36Å; L14-V18 PolarHBondContact O-N 3.27Å
15	K	91.6	Very high	83.8	Confident	134 Å²	134	105.2 Å²	105.2	58%	0.583	54%	0.543	S	S	*	.	H	α-helix	trans	-63.7	-45.3	177.3	-173	-176.4	175.1	-170.3	0	111.4	F11 S12 D13 L17 V18 E19	F11-K15 WeakPolarHBondContact O-CB 3.27Å; F11-K15 PolarHBondContact O-N 3.43Å; S12-K15 WeakPolarHBondContact O-CB 3.42Å; S12-K15 PolarHBondContact O-N 3.15Å; S12-K15 VanDerWaalsContact O-N 3.15Å; D13-K15 VanDerWaalsContact C-N 3.31Å; D13-K15 PolarHBondContact O-N 3.06Å; K15-L17 VanDerWaalsContact C-N 3.29Å; K15-L17 PolarHBondContact O-N 3.34Å; K15-V18 PolarHBondContact O-N 3.36Å; K15-E19 PolarHBondContact O-N 3.46Å
16	D	90.6	Very high	85.8	Confident	90 Å²	90	103.1 Å²	103.1	48%	0.481	54%	0.535	S	S	.	.	H	α-helix	trans	-62.1	-38.4	175.9	-83.6	2.8	0	0	0	111.8	S12 D13 E19 K20	S12-D16 PolarHBondContact O-N 2.91Å; D13-D16 PolarHBondContact O-N 3.12Å; D16-E19 PolarHBondContact O-N 3.43Å; D16-K20 WeakPolarHBondContact O-CB 3.37Å; D16-K20 WeakPolarHBondContact O-CG 3.5Å; D16-K20 PolarHBondContact O-N 3.22Å
17	L	92	Very high	87.7	Confident	122 Å²	122	104.6 Å²	104.6	64%	0.639	54%	0.538	S	S	*	.	H	α-helix	trans	-67.9	-39.2	177.3	-149.9	121.5	0	0	0	111.8	D13 L14 K15 K20 S21	D13-L17 WeakPolarHBondContact O-CB 3.4Å; D13-L17 PolarHBondContact O-N 2.94Å; L14-L17 PolarHBondContact O-N 2.9Å; K15-L17 VanDerWaalsContact C-N 3.29Å; K15-L17 PolarHBondContact O-N 3.34Å; L17-K20 PolarHBondContact O-N 3.44Å; L17-S21 WeakPolarHBondContact O-CB 3.43Å; L17-S21 PolarHBondContact O-N 3.45Å
18	V	93.9	Very high	89.6	Confident	65 Å²	65	101.9 Å²	101.9	39%	0.394	53%	0.528	S	S	.	.	H	α-helix	trans	-64.7	-43	173.1	169.1	0	0	0	0	111.1	L14 K15 S21 R22	L14-V18 VanDerWaalsContact O-CG2 3.27Å; L14-V18 WeakPolarHBondContact O-CG2 3.36Å; L14-V18 PolarHBondContact O-N 3.27Å; K15-V18 PolarHBondContact O-N 3.36Å; V18-S21 PolarHBondContact O-N 3.18Å; V18-R22 WeakPolarHBondContact O-CG 3.37Å; V18-R22 PolarHBondContact O-N 2.91Å
19	E	94.7	Very high	91.5	Very high	94 Å²	94	102.3 Å²	102.3	44%	0.439	53%	0.526	S	S	.	.	H	α-helix	trans	-62.5	-46.4	176.6	-156.1	83.1	-156.8	0	0	110.9	K15 D16 S21 R22 N23	K15-E19 PolarHBondContact O-N 3.46Å; D16-E19 PolarHBondContact O-N 3.43Å; E19-S21 PolarHBondContact O-N 2.98Å; E19-R22 PolarHBondContact O-N 3.49Å; E19-N23 PolarHBondContact O-N 3.41Å; E19-N23 PolarHBondContact O-ND2 3.37Å
20	K	94.9	Very high	92.7	Very high	141 Å²	141	102 Å²	102	61%	0.613	53%	0.525	S	S	*	.	H	α-helix	trans	-59.6	-44.3	174.3	-79	175.7	-177.9	168.9	0	112	D16 L17 R22 N23 V24	D16-K20 WeakPolarHBondContact O-CB 3.37Å; D16-K20 WeakPolarHBondContact O-CG 3.5Å; D16-K20 PolarHBondContact O-N 3.22Å; L17-K20 PolarHBondContact O-N 3.44Å; K20-R22 VanDerWaalsContact C-N 3.31Å; K20-R22 PolarHBondContact O-N 2.89Å; K20-N23 PolarHBondContact O-N 3.44Å; K20-V24 WeakPolarHBondContact O-CG2 3.4Å; K20-V24 PolarHBondContact O-N 2.88Å
21	S	94.6	Very high	93.6	Very high	72 Å²	72	103.4 Å²	103.4	50%	0.503	53%	0.528	S	S	.	.	H	α-helix	trans	-60.5	-41.8	177.3	-172.9	0	0	0	0	111.5	L17 V18 E19 V24 E25	L17-S21 WeakPolarHBondContact O-CB 3.43Å; L17-S21 PolarHBondContact O-N 3.45Å; V18-S21 PolarHBondContact O-N 3.18Å; E19-S21 PolarHBondContact O-N 2.98Å; S21-V24 PolarHBondContact O-N 3.26Å; S21-E25 WeakPolarHBondContact O-CB 3.38Å; S21-E25 PolarHBondContact O-N 2.95Å
22	R	96.1	Very high	94.4	Very high	153 Å²	153	100 Å²	100	58%	0.577	52%	0.516	S	S	*	.	H	α-helix	trans	-64.6	-39.7	176.5	-76.5	176.6	175.6	172.6	-0.1	112.5	V18 E19 K20 E25 A26	V18-R22 WeakPolarHBondContact O-CG 3.37Å; V18-R22 PolarHBondContact O-N 2.91Å; E19-R22 PolarHBondContact O-N 3.49Å; K20-R22 VanDerWaalsContact C-N 3.31Å; K20-R22 PolarHBondContact O-N 2.89Å; R22-E25 PolarHBondContact O-N 2.97Å; R22-A26 WeakPolarHBondContact O-CB 3.47Å; R22-A26 PolarHBondContact O-N 2.79Å
23	N	96	Very high	94.9	Very high	91 Å²	91	102.4 Å²	102.4	49%	0.487	52%	0.519	S	S	.	.	H	α-helix	trans	-65.1	-45.3	176.8	-68	-20	0	0	0	111.2	E19 K20 E25 A26 D27	E19-N23 PolarHBondContact O-N 3.41Å; E19-N23 PolarHBondContact O-ND2 3.37Å; K20-N23 PolarHBondContact O-N 3.44Å; N23-E25 VanDerWaalsContact C-N 3.31Å; N23-E25 PolarHBondContact O-N 2.98Å; N23-A26 PolarHBondContact O-N 2.86Å; N23-D27 PolarHBondContact O-N 2.9Å
24	V	96.5	Very high	95.4	Very high	87 Å²	87	102.6 Å²	102.6	53%	0.527	52%	0.52	S	S	.	.	H	α-helix	trans	-62.1	-40.8	175.2	173.2	0	0	0	0	111.2	K20 S21 A26 D27 V28	K20-V24 WeakPolarHBondContact O-CG2 3.4Å; K20-V24 PolarHBondContact O-N 2.88Å; S21-V24 PolarHBondContact O-N 3.26Å; V24-A26 VanDerWaalsContact C-N 3.32Å; V24-A26 PolarHBondContact O-N 2.9Å; V24-D27 PolarHBondContact O-N 3.21Å; V24-V28 HydrophobicContact CG1-CG2 4.22Å; V24-V28 WeakPolarHBondContact O-CB 3.26Å; V24-V28 VanDerWaalsContact O-CG2 3.25Å; V24-V28 WeakPolarHBondContact O-CG2 3.5Å; V24-V28 PolarHBondContact O-N 3.4Å
25	E	96.2	Very high	95.8	Very high	136 Å²	136	101.7 Å²	101.7	64%	0.636	52%	0.515	S	S	*	.	H	α-helix	trans	-61.5	-41.1	176.3	-169.9	177.9	-180	0	0	111.6	S21 R22 N23 F29	S21-E25 WeakPolarHBondContact O-CB 3.38Å; S21-E25 PolarHBondContact O-N 2.95Å; R22-E25 PolarHBondContact O-N 2.97Å; N23-E25 VanDerWaalsContact C-N 3.31Å; N23-E25 PolarHBondContact O-N 2.98Å; E25-F29 VanDerWaalsContact O-CB 3.26Å; E25-F29 WeakPolarHBondContact O-CB 3.23Å; E25-F29 PolarHBondContact O-N 3.47Å
26	A	96.4	Very high	96.1	Very high	49 Å²	49	99.9 Å²	99.9	41%	0.405	51%	0.511	S	S	.	.	H	α-helix	trans	-65.4	-46.9	175.1	0	0	0	0	0	112.3	R22 N23 V24 V28 F29 D30	R22-A26 WeakPolarHBondContact O-CB 3.47Å; R22-A26 PolarHBondContact O-N 2.79Å; N23-A26 PolarHBondContact O-N 2.86Å; V24-A26 VanDerWaalsContact C-N 3.32Å; V24-A26 PolarHBondContact O-N 2.9Å; A26-V28 PolarHBondContact O-N 2.92Å; A26-F29 WeakPolarHBondContact O-CB 3.44Å; A26-F29 PolarHBondContact O-N 3.46Å; A26-D30 PolarHBondContact O-N 2.94Å
27	D	97.1	Very high	96.4	Very high	111 Å²	111	98.5 Å²	98.5	59%	0.594	51%	0.513	S	S	*	.	H	α-helix	trans	-60.3	-45.9	178.5	-71.8	-18.6	0	0	0	111.3	N23 V24 F29 D30 E31	N23-D27 PolarHBondContact O-N 2.9Å; V24-D27 PolarHBondContact O-N 3.21Å; D27-F29 VanDerWaalsContact C-N 3.32Å; D27-F29 PolarHBondContact O-N 3.19Å; D27-D30 PolarHBondContact O-N 3.4Å; D27-E31 PolarHBondContact O-N 3Å
28	V	97.5	Very high	96.7	Very high	69 Å²	69	99.8 Å²	99.8	42%	0.418	51%	0.509	S	S	.	.	H	α-helix	trans	-63.6	-39.4	176.6	170.2	0	0	0	0	110.9	V24 A26 E31 I32	V24-V28 HydrophobicContact CG1-CG2 4.22Å; V24-V28 WeakPolarHBondContact O-CB 3.26Å; V24-V28 VanDerWaalsContact O-CG2 3.25Å; V24-V28 WeakPolarHBondContact O-CG2 3.5Å; V24-V28 PolarHBondContact O-N 3.4Å; A26-V28 PolarHBondContact O-N 2.92Å; V28-E31 PolarHBondContact O-N 3.47Å; V28-I32 HydrophobicContact CG1-CD1 3.79Å; V28-I32 HydrophobicContact CG1-CG1 4.37Å; V28-I32 WeakPolarHBondContact O-CB 3.25Å; V28-I32 VanDerWaalsContact O-CG1 3.23Å; V28-I32 WeakPolarHBondContact O-CG1 3.38Å; V28-I32 PolarHBondContact O-N 3.38Å
29	F	97.5	Very high	96.9	Very high	118 Å²	118	103.8 Å²	103.8	52%	0.518	52%	0.517	S	S	.	.	H	α-helix	trans	-64.5	-40.3	178.1	-174.1	-106.9	0	0	0	112.2	E25 A26 D27 I32 K33	E25-F29 VanDerWaalsContact O-CB 3.26Å; E25-F29 WeakPolarHBondContact O-CB 3.23Å; E25-F29 PolarHBondContact O-N 3.47Å; A26-F29 WeakPolarHBondContact O-CB 3.44Å; A26-F29 PolarHBondContact O-N 3.46Å; D27-F29 VanDerWaalsContact C-N 3.32Å; D27-F29 PolarHBondContact O-N 3.19Å; F29-I32 PolarHBondContact O-N 3.33Å; F29-K33 HydrophobicContact CD1-CD 4.38Å; F29-K33 HydrophobicContact CE1-CD 4.15Å; F29-K33 VanDerWaalsContact CE1-NZ 3.29Å; F29-K33 PolarHBondContact O-N 3.27Å
30	D	97.3	Very high	97.1	Very high	94 Å²	94	103 Å²	103	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-69.7	-39	176.1	-78.1	-17	0	0	0	112	A26 D27 I32 K33 D34	A26-D30 PolarHBondContact O-N 2.94Å; D27-D30 PolarHBondContact O-N 3.4Å; D30-I32 PolarHBondContact O-N 2.91Å; D30-K33 WeakPolarHBondContact O-CB 3.41Å; D30-K33 PolarHBondContact O-N 3Å; D30-K33 IonicContact OD1-NZ 3.99Å; D30-D34 PolarHBondContact O-N 3.23Å
31	E	97.7	Very high	97.2	Very high	126 Å²	126	101 Å²	101	59%	0.589	51%	0.514	S	S	*	.	H	α-helix	trans	-63.6	-41.1	173.6	-168.8	174.1	-165.9	0	0	111.8	D27 V28 K33 D34 L35	D27-E31 PolarHBondContact O-N 3Å; V28-E31 PolarHBondContact O-N 3.47Å; E31-K33 VanDerWaalsContact C-N 3.32Å; E31-K33 PolarHBondContact O-N 3.43Å; E31-D34 PolarHBondContact O-N 3.06Å; E31-L35 HydrophobicContact CG-CD1 4.32Å; E31-L35 WeakPolarHBondContact O-CB 3.5Å; E31-L35 VanDerWaalsContact O-CG 3.32Å; E31-L35 WeakPolarHBondContact O-CG 3.44Å; E31-L35 PolarHBondContact O-N 3.42Å
32	I	97.8	Very high	97.4	Very high	83 Å²	83	101.7 Å²	101.7	43%	0.426	51%	0.511	S	S	.	.	H	α-helix	trans	-60.9	-42.3	174.5	-73.2	168.4	0	0	0	110.8	V28 F29 D30 L35 L36	V28-I32 HydrophobicContact CG1-CD1 3.79Å; V28-I32 HydrophobicContact CG1-CG1 4.37Å; V28-I32 WeakPolarHBondContact O-CB 3.25Å; V28-I32 VanDerWaalsContact O-CG1 3.23Å; V28-I32 WeakPolarHBondContact O-CG1 3.38Å; V28-I32 PolarHBondContact O-N 3.38Å; F29-I32 PolarHBondContact O-N 3.33Å; D30-I32 PolarHBondContact O-N 2.91Å; I32-L35 PolarHBondContact O-N 3.38Å; I32-L36 HydrophobicContact CG2-CD1 3.89Å; I32-L36 HydrophobicContact CG2-CG 4.33Å; I32-L36 WeakPolarHBondContact O-CB 3.32Å; I32-L36 VanDerWaalsContact O-CG 3.25Å; I32-L36 WeakPolarHBondContact O-CG 3.32Å; I32-L36 PolarHBondContact O-N 3.49Å
33	K	97.9	Very high	97.5	Very high	110 Å²	110	98.2 Å²	98.2	48%	0.478	50%	0.502	S	S	.	.	H	α-helix	trans	-61.3	-45.4	176.1	-83.2	176.8	176.1	166.7	0	111.9	F29 D30 E31 L36 A37	F29-K33 HydrophobicContact CD1-CD 4.38Å; F29-K33 HydrophobicContact CE1-CD 4.15Å; F29-K33 VanDerWaalsContact CE1-NZ 3.29Å; F29-K33 PolarHBondContact O-N 3.27Å; D30-K33 WeakPolarHBondContact O-CB 3.41Å; D30-K33 PolarHBondContact O-N 3Å; D30-K33 IonicContact OD1-NZ 3.99Å; E31-K33 VanDerWaalsContact C-N 3.32Å; E31-K33 PolarHBondContact O-N 3.43Å; K33-L36 PolarHBondContact O-N 3.48Å; K33-A37 WeakPolarHBondContact O-CB 3.25Å; K33-A37 PolarHBondContact O-N 3.45Å
34	D	97.8	Very high	97.6	Very high	109 Å²	109	100.1 Å²	100.1	58%	0.583	51%	0.508	S	S	*	.	H	α-helix	trans	-63.4	-44.3	178.4	-170.5	56.7	0	0	0	111.3	D30 E31 L36 A37 R38	D30-D34 PolarHBondContact O-N 3.23Å; E31-D34 PolarHBondContact O-N 3.06Å; D34-L36 VanDerWaalsContact C-N 3.33Å; D34-L36 PolarHBondContact O-N 2.94Å; D34-A37 WeakPolarHBondContact O-CB 3.4Å; D34-A37 PolarHBondContact O-N 3.18Å; D34-R38 WeakPolarHBondContact O-CB 3.42Å; D34-R38 PolarHBondContact O-N 2.9Å
35	L	98	Very high	97.7	Very high	81 Å²	81	101.1 Å²	101.1	42%	0.424	51%	0.505	S	S	.	.	H	α-helix	trans	-60.7	-40.7	175.6	-74.2	174.9	0	0	0	112.5	E31 I32 R38 R39	E31-L35 HydrophobicContact CG-CD1 4.32Å; E31-L35 WeakPolarHBondContact O-CB 3.5Å; E31-L35 VanDerWaalsContact O-CG 3.32Å; E31-L35 WeakPolarHBondContact O-CG 3.44Å; E31-L35 PolarHBondContact O-N 3.42Å; I32-L35 PolarHBondContact O-N 3.38Å; L35-R38 PolarHBondContact O-N 3.33Å; L35-R39 WeakPolarHBondContact O-CB 3.4Å; L35-R39 PolarHBondContact O-N 2.91Å
36	L	97.9	Very high	97.7	Very high	97 Å²	97	99.5 Å²	99.5	51%	0.508	50%	0.5	S	S	.	.	H	α-helix	trans	-66.2	-41.2	175.8	-74.5	173	0	0	0	111.9	I32 K33 D34 R39 S40	I32-L36 HydrophobicContact CG2-CD1 3.89Å; I32-L36 HydrophobicContact CG2-CG 4.33Å; I32-L36 WeakPolarHBondContact O-CB 3.32Å; I32-L36 VanDerWaalsContact O-CG 3.25Å; I32-L36 WeakPolarHBondContact O-CG 3.32Å; I32-L36 PolarHBondContact O-N 3.49Å; K33-L36 PolarHBondContact O-N 3.48Å; D34-L36 VanDerWaalsContact C-N 3.33Å; D34-L36 PolarHBondContact O-N 2.94Å; L36-R39 PolarHBondContact O-N 3.32Å; L36-S40 PolarHBondContact O-N 2.96Å
37	A	97.7	Very high	97.8	Very high	61 Å²	61	104.6 Å²	104.6	50%	0.504	51%	0.513	S	S	.	.	H	α-helix	trans	-61.3	-47.6	175.2	0	0	0	0	0	111	K33 D34 R39 S40 E41	K33-A37 WeakPolarHBondContact O-CB 3.25Å; K33-A37 PolarHBondContact O-N 3.45Å; D34-A37 WeakPolarHBondContact O-CB 3.4Å; D34-A37 PolarHBondContact O-N 3.18Å; A37-R39 PolarHBondContact O-N 3.35Å; A37-S40 WeakPolarHBondContact O-CB 3.48Å; A37-S40 PolarHBondContact O-N 3.35Å; A37-E41 PolarHBondContact O-N 3.43Å; A37-E41 VanDerWaalsContact O-N 3.07Å
38	R	98	Very high	97.7	Very high	148 Å²	148	105.7 Å²	105.7	56%	0.558	51%	0.513	S	S	*	.	H	α-helix	trans	-63.3	-40.5	177.8	-164	175.9	75.6	162.1	0.6	112.4	D34 L35 S40 E41 I42	D34-R38 WeakPolarHBondContact O-CB 3.42Å; D34-R38 PolarHBondContact O-N 2.9Å; L35-R38 PolarHBondContact O-N 3.33Å; R38-S40 VanDerWaalsContact C-N 3.34Å; R38-S40 PolarHBondContact O-N 2.98Å; R38-E41 PolarHBondContact O-N 3.38Å; R38-I42 HydrophobicContact CG-CD1 4.4Å; R38-I42 WeakPolarHBondContact O-CG1 3.42Å; R38-I42 PolarHBondContact O-N 3.48Å
39	R	98.1	Very high	97.7	Very high	150 Å²	150	107.4 Å²	107.4	57%	0.566	52%	0.518	S	S	*	.	H	α-helix	trans	-59.5	-45.9	174.5	179.4	-171.7	162.7	-165.2	-4.7	111.1	L35 L36 A37 E41 I42 E43	L35-R39 WeakPolarHBondContact O-CB 3.4Å; L35-R39 PolarHBondContact O-N 2.91Å; L36-R39 PolarHBondContact O-N 3.32Å; A37-R39 PolarHBondContact O-N 3.35Å; R39-E41 VanDerWaalsContact C-N 3.3Å; R39-E41 PolarHBondContact O-N 2.91Å; R39-I42 PolarHBondContact O-N 3.22Å; R39-E43 IonicContact CZ-OE1 3.85Å; R39-E43 VanDerWaalsContact CZ-OE1 3.24Å; R39-E43 IonicContact NE-OE1 3.95Å; R39-E43 PolarHBondContact NE-OE1 3.49Å; R39-E43 IonicContact NH2-OE1 2.68Å; R39-E43 PolarHBondContact NH2-OE1 3.22Å; R39-E43 PolarHBondContact O-N 3.42Å
40	S	97.8	Very high	97.6	Very high	76 Å²	76	106.9 Å²	106.9	53%	0.531	52%	0.521	S	S	.	.	H	α-helix	trans	-59.2	-42.3	178	-173.7	0	0	0	0	111.7	L36 A37 R38 I42 E43 H44	L36-S40 PolarHBondContact O-N 2.96Å; A37-S40 WeakPolarHBondContact O-CB 3.48Å; A37-S40 PolarHBondContact O-N 3.35Å; R38-S40 VanDerWaalsContact C-N 3.34Å; R38-S40 PolarHBondContact O-N 2.98Å; S40-I42 PolarHBondContact O-N 3.03Å; S40-E43 PolarHBondContact O-N 3.3Å; S40-H44 PolarHBondContact O-N 3.45Å
41	E	98.1	Very high	97.4	Very high	100 Å²	100	105.9 Å²	105.9	47%	0.467	52%	0.521	S	S	.	.	H	α-helix	trans	-63.2	-42.4	176.7	-160.2	-163.2	164.5	0	0	112.3	A37 R38 R39 H44 K45	A37-E41 PolarHBondContact O-N 3.43Å; A37-E41 VanDerWaalsContact O-N 3.07Å; R38-E41 PolarHBondContact O-N 3.38Å; R39-E41 VanDerWaalsContact C-N 3.3Å; R39-E41 PolarHBondContact O-N 2.91Å; E41-H44 PolarHBondContact O-N 2.89Å; E41-K45 WeakPolarHBondContact O-CG 3.38Å; E41-K45 PolarHBondContact O-N 2.88Å; E41-K45 WeakPolarHBondContact OE1-CE 3.45Å; E41-K45 IonicContact OE1-NZ 2.79Å; E41-K45 PolarHBondContact OE1-NZ 3.49Å; E41-K45 IonicContact OE2-NZ 2.86Å
42	I	98.3	Very high	97.3	Very high	86 Å²	86	103.5 Å²	103.5	44%	0.441	51%	0.512	S	S	.	.	H	α-helix	trans	-64.2	-46	176.5	-69.4	168.7	0	0	0	110.8	R38 R39 S40 H44 K45 L46	R38-I42 HydrophobicContact CG-CD1 4.4Å; R38-I42 WeakPolarHBondContact O-CG1 3.42Å; R38-I42 PolarHBondContact O-N 3.48Å; R39-I42 PolarHBondContact O-N 3.22Å; S40-I42 PolarHBondContact O-N 3.03Å; I42-H44 VanDerWaalsContact C-N 3.26Å; I42-H44 PolarHBondContact O-N 3.48Å; I42-K45 PolarHBondContact O-N 2.89Å; I42-K45 VanDerWaalsContact O-N 3.16Å; I42-L46 HydrophobicContact CG2-CD1 4.22Å; I42-L46 WeakPolarHBondContact O-CB 3.44Å; I42-L46 PolarHBondContact O-N 3.38Å
43	E	98.4	Very high	97.1	Very high	81 Å²	81	103.8 Å²	103.8	38%	0.379	51%	0.514	S	S	.	.	H	α-helix	trans	-59.3	-38.9	176.7	-78.8	-178.4	-174.8	0	0	111.6	R39 S40 L46 K47	R39-E43 IonicContact CZ-OE1 3.85Å; R39-E43 VanDerWaalsContact CZ-OE1 3.24Å; R39-E43 IonicContact NE-OE1 3.95Å; R39-E43 PolarHBondContact NE-OE1 3.49Å; R39-E43 IonicContact NH2-OE1 2.68Å; R39-E43 PolarHBondContact NH2-OE1 3.22Å; R39-E43 PolarHBondContact O-N 3.42Å; S40-E43 PolarHBondContact O-N 3.3Å; E43-L46 PolarHBondContact O-N 3.07Å; E43-K47 WeakPolarHBondContact O-CG 3.49Å; E43-K47 PolarHBondContact O-N 3.35Å
44	H	97.7	Very high	96.9	Very high	131 Å²	131	101.8 Å²	101.8	61%	0.606	51%	0.512	S	S	*	.	H	α-helix	trans	-64.2	-45.8	174.3	-177.1	-87.9	0	0	0	112.1	S40 E41 I42 L46 K47 K48	S40-H44 PolarHBondContact O-N 3.45Å; E41-H44 PolarHBondContact O-N 2.89Å; I42-H44 VanDerWaalsContact C-N 3.26Å; I42-H44 PolarHBondContact O-N 3.48Å; H44-L46 VanDerWaalsContact C-N 3.33Å; H44-L46 PolarHBondContact O-N 2.97Å; H44-K47 PolarHBondContact O-N 2.66Å; H44-K48 PolarHBondContact O-N 3.25Å
45	K	97.6	Very high	96.7	Very high	108 Å²	108	100.8 Å²	100.8	47%	0.47	51%	0.506	S	S	.	.	H	α-helix	trans	-61.6	-40.9	175.4	-72.5	173.7	-174.9	165.5	0	111.7	E41 I42 K48 I49	E41-K45 WeakPolarHBondContact O-CG 3.38Å; E41-K45 PolarHBondContact O-N 2.88Å; E41-K45 WeakPolarHBondContact OE1-CE 3.45Å; E41-K45 IonicContact OE1-NZ 2.79Å; E41-K45 PolarHBondContact OE1-NZ 3.49Å; E41-K45 IonicContact OE2-NZ 2.86Å; I42-K45 PolarHBondContact O-N 2.89Å; I42-K45 VanDerWaalsContact O-N 3.16Å; K45-K48 WeakPolarHBondContact O-CB 3.49Å; K45-K48 PolarHBondContact O-N 3.22Å; K45-I49 WeakPolarHBondContact O-CG1 3.41Å; K45-I49 PolarHBondContact O-N 3.46Å
46	L	97.6	Very high	96.6	Very high	102 Å²	102	103.4 Å²	103.4	53%	0.534	52%	0.515	S	S	.	.	H	α-helix	trans	-62.6	-46.1	175.9	-107.6	160.4	0	0	0	111.7	I42 E43 H44 K48 I49 N50	I42-L46 HydrophobicContact CG2-CD1 4.22Å; I42-L46 WeakPolarHBondContact O-CB 3.44Å; I42-L46 PolarHBondContact O-N 3.38Å; E43-L46 PolarHBondContact O-N 3.07Å; H44-L46 VanDerWaalsContact C-N 3.33Å; H44-L46 PolarHBondContact O-N 2.97Å; L46-K48 VanDerWaalsContact C-N 3.29Å; L46-K48 PolarHBondContact O-N 2.96Å; L46-I49 PolarHBondContact O-N 3.33Å; L46-N50 WeakPolarHBondContact O-CB 3.41Å; L46-N50 PolarHBondContact O-N 3.29Å
47	K	97.2	Very high	96.4	Very high	155 Å²	155	104.5 Å²	104.5	67%	0.674	52%	0.517	S	S	*	.	H	α-helix	trans	-58.1	-42.8	173.9	-79	177.8	-180	174.4	0	111.6	E43 H44 N50 S51	E43-K47 WeakPolarHBondContact O-CG 3.49Å; E43-K47 PolarHBondContact O-N 3.35Å; H44-K47 PolarHBondContact O-N 2.66Å; K47-N50 PolarHBondContact O-N 3.24Å; K47-S51 PolarHBondContact O-N 2.99Å
48	K	96.4	Very high	96.3	Very high	135 Å²	135	107.7 Å²	107.7	59%	0.587	52%	0.519	S	S	*	.	H	α-helix	trans	-61.8	-47.2	176.3	-170.9	175.8	-179.4	178.6	0	111.6	H44 K45 L46 N50 S51 L52	H44-K48 PolarHBondContact O-N 3.25Å; K45-K48 WeakPolarHBondContact O-CB 3.49Å; K45-K48 PolarHBondContact O-N 3.22Å; L46-K48 VanDerWaalsContact C-N 3.29Å; L46-K48 PolarHBondContact O-N 2.96Å; K48-N50 VanDerWaalsContact C-N 3.34Å; K48-N50 PolarHBondContact O-N 2.92Å; K48-S51 PolarHBondContact O-N 3.46Å; K48-S51 PolarHBondContact O-OG 3.16Å; K48-L52 WeakPolarHBondContact O-CG 3.46Å; K48-L52 PolarHBondContact O-N 2.98Å
49	I	96	Very high	96.3	Very high	104 Å²	104	105.7 Å²	105.7	53%	0.533	52%	0.519	S	S	.	.	H	α-helix	trans	-58.9	-47.3	175.5	-70	168.1	0	0	0	110.5	K45 L46 S51 L52 I53	K45-I49 WeakPolarHBondContact O-CG1 3.41Å; K45-I49 PolarHBondContact O-N 3.46Å; L46-I49 PolarHBondContact O-N 3.33Å; I49-S51 PolarHBondContact O-N 2.83Å; I49-L52 WeakPolarHBondContact O-CB 3.45Å; I49-L52 PolarHBondContact O-N 2.68Å; I49-I53 PolarHBondContact O-N 2.86Å
50	N	95.9	Very high	96.2	Very high	107 Å²	107	103.9 Å²	103.9	57%	0.572	52%	0.517	S	S	*	.	H	α-helix	trans	-60	-35.2	179.9	-120.6	12.1	0	0	0	112.3	L46 K47 K48 L52 I53 P54	L46-N50 WeakPolarHBondContact O-CB 3.41Å; L46-N50 PolarHBondContact O-N 3.29Å; K47-N50 PolarHBondContact O-N 3.24Å; K48-N50 VanDerWaalsContact C-N 3.34Å; K48-N50 PolarHBondContact O-N 2.92Å; N50-L52 VanDerWaalsContact C-N 3.25Å; N50-L52 PolarHBondContact O-N 3.4Å; N50-I53 PolarHBondContact O-N 3.26Å; N50-I53 WeakPolarHBondContact OD1-CD1 3.47Å; N50-P54 WeakPolarHBondContact O-CD 3.18Å
51	S	94.2	Very high	96.2	Very high	74 Å²	74	102.8 Å²	102.8	52%	0.517	51%	0.507	S	S	.	.	H	α-helix	trans	-68.1	-23.3	176.5	75.2	0	0	0	0	113.7	K47 K48 I49	K47-S51 PolarHBondContact O-N 2.99Å; K48-S51 PolarHBondContact O-N 3.46Å; K48-S51 PolarHBondContact O-OG 3.16Å; I49-S51 PolarHBondContact O-N 2.83Å
52	L	94.8	Very high	96.2	Very high	75 Å²	75	102.7 Å²	102.7	39%	0.393	51%	0.51	S	S	.	.	H	α-helix	trans	-88.9	-21.3	-179.7	-65.3	169.8	0	0	0	113.3	K48 I49 N50 D55 F56	K48-L52 WeakPolarHBondContact O-CG 3.46Å; K48-L52 PolarHBondContact O-N 2.98Å; I49-L52 WeakPolarHBondContact O-CB 3.45Å; I49-L52 PolarHBondContact O-N 2.68Å; N50-L52 VanDerWaalsContact C-N 3.25Å; N50-L52 PolarHBondContact O-N 3.4Å; L52-D55 PolarHBondContact O-N 3.04Å; L52-D55 VanDerWaalsContact O-N 3.08Å; L52-F56 HydrophobicContact CB-CD2 4.39Å; L52-F56 HydrophobicContact CB-CE2 4.19Å; L52-F56 WeakPolarHBondContact O-CD2 3.35Å; L52-F56 PolarHBondContact O-N 3.44Å; L52-F56 VanDerWaalsContact O-N 3.14Å
53	I	94.3	Very high	96.1	Very high	90 Å²	90	101.4 Å²	101.4	46%	0.462	51%	0.513	S	S	.	.	H	α-helix	trans	-54.5	-45.2	-179.4	-68.4	174.1	0	0	0	112.7	I49 N50 D55 F56 H57	I49-I53 PolarHBondContact O-N 2.86Å; N50-I53 PolarHBondContact O-N 3.26Å; N50-I53 WeakPolarHBondContact OD1-CD1 3.47Å; I53-D55 VanDerWaalsContact C-N 3.26Å; I53-D55 PolarHBondContact O-N 3.32Å; I53-F56 PolarHBondContact O-N 3.03Å; I53-H57 PolarHBondContact O-N 3.48Å
54	P	93.3	Very high	96.1	Very high	68 Å²	68	102 Å²	102	44%	0.442	52%	0.515	S	S	.	.	H	α-helix	trans	-60.7	-34	177.4	-24.5	35.1	0	0	0	113.6	N50 H57 K58	N50-P54 WeakPolarHBondContact O-CD 3.18Å; P54-H57 PolarHBondContact O-N 3.38Å; P54-K58 WeakPolarHBondContact O-CG 3.47Å; P54-K58 PolarHBondContact O-N 3.08Å
55	D	93.7	Very high	96.1	Very high	87 Å²	87	99.4 Å²	99.4	47%	0.465	51%	0.506	S	S	.	.	H	α-helix	trans	-71.8	-38.1	179.1	-69	-21.7	0	0	0	111.2	L52 I53 H57 K58 L59	L52-D55 PolarHBondContact O-N 3.04Å; L52-D55 VanDerWaalsContact O-N 3.08Å; I53-D55 VanDerWaalsContact C-N 3.26Å; I53-D55 PolarHBondContact O-N 3.32Å; D55-H57 VanDerWaalsContact C-N 3.33Å; D55-H57 PolarHBondContact O-N 3.24Å; D55-K58 PolarHBondContact O-N 3.43Å; D55-K58 IonicContact OD1-NZ 3.24Å; D55-L59 WeakPolarHBondContact O-CB 3.45Å; D55-L59 PolarHBondContact O-N 3.29Å
56	F	94.7	Very high	96.1	Very high	136 Å²	136	97.4 Å²	97.4	60%	0.596	51%	0.506	S	S	*	.	H	α-helix	trans	-62.2	-39.7	171.3	-77.7	-66.2	0	0	0	112.3	L52 I53 L59 Q60	L52-F56 HydrophobicContact CB-CD2 4.39Å; L52-F56 HydrophobicContact CB-CE2 4.19Å; L52-F56 WeakPolarHBondContact O-CD2 3.35Å; L52-F56 PolarHBondContact O-N 3.44Å; L52-F56 VanDerWaalsContact O-N 3.14Å; I53-F56 PolarHBondContact O-N 3.03Å; F56-L59 HydrophobicContact CD1-CD2 4.48Å; F56-L59 WeakPolarHBondContact O-CB 3.43Å; F56-L59 PolarHBondContact O-N 3.06Å; F56-Q60 WeakPolarHBondContact O-CB 3.48Å; F56-Q60 PolarHBondContact O-N 3.35Å
57	H	95.1	Very high	96.2	Very high	120 Å²	120	96.6 Å²	96.6	56%	0.556	51%	0.508	S	S	*	.	H	α-helix	trans	-63.6	-44.6	175.3	-177.2	-80.2	0	0	0	111.8	I53 P54 D55 L59 Q60 V61	I53-H57 PolarHBondContact O-N 3.48Å; P54-H57 PolarHBondContact O-N 3.38Å; D55-H57 VanDerWaalsContact C-N 3.33Å; D55-H57 PolarHBondContact O-N 3.24Å; H57-L59 VanDerWaalsContact C-N 3.31Å; H57-L59 PolarHBondContact O-N 3.31Å; H57-Q60 PolarHBondContact O-N 3.14Å; H57-V61 WeakPolarHBondContact O-CG2 3.33Å; H57-V61 PolarHBondContact O-N 2.86Å
58	K	95.9	Very high	96.2	Very high	128 Å²	128	95.3 Å²	95.3	56%	0.557	50%	0.503	S	S	*	.	H	α-helix	trans	-60.4	-42.2	173.9	-71.2	172.6	-173.5	166.5	0	111.6	P54 D55 Q60 V61 N62	P54-K58 WeakPolarHBondContact O-CG 3.47Å; P54-K58 PolarHBondContact O-N 3.08Å; D55-K58 PolarHBondContact O-N 3.43Å; D55-K58 IonicContact OD1-NZ 3.24Å; K58-Q60 VanDerWaalsContact C-N 3.34Å; K58-Q60 PolarHBondContact O-N 2.97Å; K58-V61 PolarHBondContact O-N 3.34Å; K58-N62 WeakPolarHBondContact O-CB 3.45Å; K58-N62 PolarHBondContact O-N 2.95Å
59	L	96.7	Very high	96.3	Very high	107 Å²	107	94.8 Å²	94.8	56%	0.56	51%	0.505	S	S	*	.	H	α-helix	trans	-61.5	-42.8	177.2	-178.1	62.4	0	0	0	111.4	D55 F56 H57 N62 A63	D55-L59 WeakPolarHBondContact O-CB 3.45Å; D55-L59 PolarHBondContact O-N 3.29Å; F56-L59 HydrophobicContact CD1-CD2 4.48Å; F56-L59 WeakPolarHBondContact O-CB 3.43Å; F56-L59 PolarHBondContact O-N 3.06Å; H57-L59 VanDerWaalsContact C-N 3.31Å; H57-L59 PolarHBondContact O-N 3.31Å; L59-N62 PolarHBondContact O-N 3.13Å; L59-A63 WeakPolarHBondContact O-CB 3.39Å; L59-A63 PolarHBondContact O-N 2.87Å
60	Q	97.7	Very high	96.4	Very high	111 Å²	111	94.7 Å²	94.7	52%	0.519	51%	0.51	S	S	.	.	H	α-helix	trans	-60.1	-50.3	175.5	-179	-178.4	-2.2	0	0	111.7	F56 H57 K58 N62 A63 E64	F56-Q60 WeakPolarHBondContact O-CB 3.48Å; F56-Q60 PolarHBondContact O-N 3.35Å; H57-Q60 PolarHBondContact O-N 3.14Å; K58-Q60 VanDerWaalsContact C-N 3.34Å; K58-Q60 PolarHBondContact O-N 2.97Å; Q60-N62 VanDerWaalsContact C-N 3.28Å; Q60-N62 PolarHBondContact O-N 3.5Å; Q60-A63 WeakPolarHBondContact O-CB 3.49Å; Q60-A63 PolarHBondContact O-N 3.4Å; Q60-A63 VanDerWaalsContact O-N 3.13Å; Q60-E64 PolarHBondContact NE2-OE1 3.29Å; Q60-E64 PolarHBondContact O-N 3.34Å
61	V	97.1	Very high	96.5	Very high	54 Å²	54	91.7 Å²	91.7	33%	0.327	50%	0.504	S	S	.	.	H	α-helix	trans	-58.8	-41.6	177.8	172.2	0	0	0	0	111.1	H57 K58 E64 N65	H57-V61 WeakPolarHBondContact O-CG2 3.33Å; H57-V61 PolarHBondContact O-N 2.86Å; K58-V61 PolarHBondContact O-N 3.34Å; V61-E64 PolarHBondContact O-N 2.97Å; V61-N65 WeakPolarHBondContact O-CB 3.49Å; V61-N65 VanDerWaalsContact O-CG 3.28Å; V61-N65 PolarHBondContact O-N 3.38Å; V61-N65 PolarHBondContact O-ND2 3.34Å
62	N	97	Very high	96.7	Very high	97 Å²	97	92.2 Å²	92.2	52%	0.519	51%	0.507	S	S	.	.	H	α-helix	trans	-65.3	-39.1	176.6	-75.7	-7.2	0	0	0	112.7	K58 L59 Q60 N65 S66	K58-N62 WeakPolarHBondContact O-CB 3.45Å; K58-N62 PolarHBondContact O-N 2.95Å; L59-N62 PolarHBondContact O-N 3.13Å; Q60-N62 VanDerWaalsContact C-N 3.28Å; Q60-N62 PolarHBondContact O-N 3.5Å; N62-N65 PolarHBondContact O-N 3.5Å; N62-S66 WeakPolarHBondContact O-CB 3.45Å; N62-S66 PolarHBondContact O-N 2.91Å; N62-S66 PolarHBondContact O-OG 2.79Å
63	A	97.8	Very high	96.8	Very high	60 Å²	60	91.4 Å²	91.4	50%	0.496	51%	0.511	S	S	.	.	H	α-helix	trans	-64.5	-43.2	175.8	0	0	0	0	0	111.4	L59 Q60 S66 S67	L59-A63 WeakPolarHBondContact O-CB 3.39Å; L59-A63 PolarHBondContact O-N 2.87Å; Q60-A63 WeakPolarHBondContact O-CB 3.49Å; Q60-A63 PolarHBondContact O-N 3.4Å; Q60-A63 VanDerWaalsContact O-N 3.13Å; A63-S66 PolarHBondContact O-N 2.9Å; A63-S67 WeakPolarHBondContact O-CB 3.5Å; A63-S67 PolarHBondContact O-N 3.29Å
64	E	98.2	Very high	97	Very high	94 Å²	94	90.4 Å²	90.4	44%	0.439	51%	0.512	S	S	.	.	H	α-helix	trans	-62.7	-44.4	175.5	-74.3	178.1	-166.1	0	0	112.2	Q60 V61 S67 K68	Q60-E64 PolarHBondContact NE2-OE1 3.29Å; Q60-E64 PolarHBondContact O-N 3.34Å; V61-E64 PolarHBondContact O-N 2.97Å; E64-S67 WeakPolarHBondContact O-CB 3.49Å; E64-S67 PolarHBondContact O-N 2.92Å; E64-K68 WeakPolarHBondContact O-CG 3.42Å; E64-K68 PolarHBondContact O-N 3.36Å
65	N	97.7	Very high	97.3	Very high	75 Å²	75	94 Å²	94	40%	0.401	52%	0.52	S	S	.	.	H	α-helix	trans	-63.3	-42.3	176.4	-72.4	-22.6	0	0	0	111.9	V61 N62 S67 K68 L69	V61-N65 WeakPolarHBondContact O-CB 3.49Å; V61-N65 VanDerWaalsContact O-CG 3.28Å; V61-N65 PolarHBondContact O-N 3.38Å; V61-N65 PolarHBondContact O-ND2 3.34Å; N62-N65 PolarHBondContact O-N 3.5Å; N65-S67 VanDerWaalsContact C-N 3.35Å; N65-S67 PolarHBondContact O-N 2.99Å; N65-K68 PolarHBondContact O-N 3.47Å; N65-L69 WeakPolarHBondContact O-CG 3.45Å; N65-L69 PolarHBondContact O-N 3.02Å
66	S	97.9	Very high	97.5	Very high	67 Å²	67	95.2 Å²	95.2	47%	0.469	53%	0.526	S	S	.	.	H	α-helix	trans	-63	-42.1	176.3	-58.3	0	0	0	0	111.4	N62 A63 K68 L69 V70	N62-S66 WeakPolarHBondContact O-CB 3.45Å; N62-S66 PolarHBondContact O-N 2.91Å; N62-S66 PolarHBondContact O-OG 2.79Å; A63-S66 PolarHBondContact O-N 2.9Å; S66-K68 VanDerWaalsContact C-N 3.35Å; S66-K68 PolarHBondContact O-N 3.39Å; S66-L69 PolarHBondContact O-N 3.25Å; S66-V70 WeakPolarHBondContact O-CG2 3.37Å; S66-V70 PolarHBondContact O-N 3.27Å
67	S	98.2	Very high	97.7	Very high	84 Å²	84	91.4 Å²	91.4	59%	0.587	52%	0.52	S	S	*	.	H	α-helix	trans	-59	-44.9	175	-178.9	0	0	0	0	111.9	A63 E64 N65 L69 V70 G71	A63-S67 WeakPolarHBondContact O-CB 3.5Å; A63-S67 PolarHBondContact O-N 3.29Å; E64-S67 WeakPolarHBondContact O-CB 3.49Å; E64-S67 PolarHBondContact O-N 2.92Å; N65-S67 VanDerWaalsContact C-N 3.35Å; N65-S67 PolarHBondContact O-N 2.99Å; S67-L69 PolarHBondContact O-N 2.93Å; S67-V70 PolarHBondContact O-N 2.93Å; S67-G71 PolarHBondContact O-N 3.34Å
68	K	98.1	Very high	97.8	Very high	128 Å²	128	91.6 Å²	91.6	56%	0.557	53%	0.525	S	S	*	.	H	α-helix	trans	-60.4	-44.2	175.2	-70.6	170.1	-172.6	167.4	0	112	E64 N65 S66 G71 C72	E64-K68 WeakPolarHBondContact O-CG 3.42Å; E64-K68 PolarHBondContact O-N 3.36Å; N65-K68 PolarHBondContact O-N 3.47Å; S66-K68 VanDerWaalsContact C-N 3.35Å; S66-K68 PolarHBondContact O-N 3.39Å; K68-G71 PolarHBondContact O-N 2.93Å; K68-C72 PolarHBondContact O-N 3.47Å; K68-C72 PolarHBondContact O-SG 3.33Å; K68-C72 VanDerWaalsContact O-SG 3.39Å
69	L	98.1	Very high	97.9	Very high	124 Å²	124	91 Å²	91	65%	0.649	52%	0.524	S	S	*	.	H	α-helix	trans	-62.3	-44.6	177.5	-75.6	172.1	0	0	0	112.2	N65 S66 S67 G71 C72 A73	N65-L69 WeakPolarHBondContact O-CG 3.45Å; N65-L69 PolarHBondContact O-N 3.02Å; S66-L69 PolarHBondContact O-N 3.25Å; S67-L69 PolarHBondContact O-N 2.93Å; L69-G71 VanDerWaalsContact C-N 3.31Å; L69-G71 PolarHBondContact O-N 2.87Å; L69-C72 PolarHBondContact O-N 3.23Å; L69-A73 WeakPolarHBondContact O-CB 3.38Å; L69-A73 PolarHBondContact O-N 3.46Å
70	V	98.1	Very high	98	Very high	103 Å²	103	90.9 Å²	90.9	62%	0.624	52%	0.523	S	S	*	.	H	α-helix	trans	-61.3	-41.8	175.5	171.4	0	0	0	0	110.8	S66 S67 A73 S74	S66-V70 WeakPolarHBondContact O-CG2 3.37Å; S66-V70 PolarHBondContact O-N 3.27Å; S67-V70 PolarHBondContact O-N 2.93Å; V70-A73 PolarHBondContact O-N 2.95Å; V70-S74 WeakPolarHBondContact O-CB 3.42Å; V70-S74 PolarHBondContact O-N 3.28Å
71	G	98	Very high	98	Very high	43 Å²	43	88.4 Å²	88.4	44%	0.443	52%	0.518	S	S	.	.	H	α-helix	trans	-59.8	-45.8	174.1	0	0	0	0	0	113	S67 K68 L69 S74 K75	S67-G71 PolarHBondContact O-N 3.34Å; K68-G71 PolarHBondContact O-N 2.93Å; L69-G71 VanDerWaalsContact C-N 3.31Å; L69-G71 PolarHBondContact O-N 2.87Å; G71-S74 PolarHBondContact O-N 3.05Å; G71-K75 PolarHBondContact O-N 2.88Å
72	C	97.7	Very high	98	Very high	86 Å²	86	87 Å²	87	58%	0.581	51%	0.514	S	S	*	.	H	α-helix	trans	-62.5	-44.9	175.4	-71.9	0	0	0	0	112.3	K68 L69 S74 K75 L76	K68-C72 PolarHBondContact O-N 3.47Å; K68-C72 PolarHBondContact O-SG 3.33Å; K68-C72 VanDerWaalsContact O-SG 3.39Å; L69-C72 PolarHBondContact O-N 3.23Å; C72-S74 VanDerWaalsContact C-N 3.33Å; C72-S74 PolarHBondContact O-N 3.45Å; C72-K75 PolarHBondContact O-N 3.36Å; C72-L76 PolarHBondContact O-N 3.46Å
73	A	98.2	Very high	98.1	Very high	58 Å²	58	89.1 Å²	89.1	48%	0.479	52%	0.519	S	S	.	.	H	α-helix	trans	-61.4	-42	178	0	0	0	0	0	111.5	L69 V70 L76 A77	L69-A73 WeakPolarHBondContact O-CB 3.38Å; L69-A73 PolarHBondContact O-N 3.46Å; V70-A73 PolarHBondContact O-N 2.95Å; A73-L76 PolarHBondContact O-N 3.41Å; A73-A77 WeakPolarHBondContact O-CB 3.4Å; A73-A77 PolarHBondContact O-N 3.39Å
74	S	98.4	Very high	98.1	Very high	69 Å²	69	90.4 Å²	90.4	48%	0.483	52%	0.52	S	S	.	.	H	α-helix	trans	-60.5	-47.1	174.8	178.8	0	0	0	0	111.9	V70 G71 C72 L76 A77 L78	V70-S74 WeakPolarHBondContact O-CB 3.42Å; V70-S74 PolarHBondContact O-N 3.28Å; G71-S74 PolarHBondContact O-N 3.05Å; C72-S74 VanDerWaalsContact C-N 3.33Å; C72-S74 PolarHBondContact O-N 3.45Å; S74-L76 VanDerWaalsContact C-N 3.32Å; S74-L76 PolarHBondContact O-N 2.92Å; S74-A77 PolarHBondContact O-N 3.48Å; S74-L78 WeakPolarHBondContact O-CG 3.49Å; S74-L78 PolarHBondContact O-N 3.16Å
75	K	98	Very high	98.1	Very high	143 Å²	143	92 Å²	92	62%	0.622	53%	0.528	S	S	*	.	H	α-helix	trans	-60.5	-42.2	176.9	-172.1	175.4	-178.5	178.2	0	112.1	G71 C72 L78 Q79	G71-K75 PolarHBondContact O-N 2.88Å; C72-K75 PolarHBondContact O-N 3.36Å; K75-L78 PolarHBondContact O-N 3.24Å; K75-Q79 WeakPolarHBondContact O-CG 3.4Å; K75-Q79 PolarHBondContact O-N 3.15Å; K75-Q79 VanDerWaalsContact O-N 3.15Å
76	L	98.1	Very high	98.1	Very high	113 Å²	113	94.7 Å²	94.7	59%	0.592	54%	0.538	S	S	*	.	H	α-helix	trans	-65.2	-41.8	177	-169.2	110.5	0	0	0	111.6	C72 A73 S74 L78 Q79 L80	C72-L76 PolarHBondContact O-N 3.46Å; A73-L76 PolarHBondContact O-N 3.41Å; S74-L76 VanDerWaalsContact C-N 3.32Å; S74-L76 PolarHBondContact O-N 2.92Å; L76-L78 VanDerWaalsContact C-N 3.34Å; L76-L78 PolarHBondContact O-N 2.89Å; L76-Q79 PolarHBondContact O-N 3.45Å; L76-L80 WeakPolarHBondContact O-CB 3.43Å; L76-L80 PolarHBondContact O-N 3.02Å
77	A	98.5	Very high	98.1	Very high	56 Å²	56	97.2 Å²	97.2	46%	0.463	55%	0.545	S	S	.	.	H	α-helix	trans	-60.9	-41.7	177.1	0	0	0	0	0	112	A73 S74 L80 S81	A73-A77 WeakPolarHBondContact O-CB 3.4Å; A73-A77 PolarHBondContact O-N 3.39Å; S74-A77 PolarHBondContact O-N 3.48Å; A77-L80 PolarHBondContact O-N 2.89Å; A77-S81 PolarHBondContact O-N 3.31Å
78	L	97.9	Very high	98.1	Very high	124 Å²	124	96.6 Å²	96.6	65%	0.649	54%	0.536	S	S	*	.	H	α-helix	trans	-62.5	-43.4	174.7	-71	172.4	0	0	0	112.2	S74 K75 L76 L80 S81 G82	S74-L78 WeakPolarHBondContact O-CG 3.49Å; S74-L78 PolarHBondContact O-N 3.16Å; K75-L78 PolarHBondContact O-N 3.24Å; L76-L78 VanDerWaalsContact C-N 3.34Å; L76-L78 PolarHBondContact O-N 2.89Å; L78-L80 VanDerWaalsContact C-N 3.33Å; L78-L80 PolarHBondContact O-N 3.22Å; L78-S81 WeakPolarHBondContact O-CB 3.45Å; L78-S81 PolarHBondContact O-N 2.95Å; L78-G82 PolarHBondContact O-N 3.29Å; L78-G82 VanDerWaalsContact O-N 3.12Å
79	Q	98	Very high	98.1	Very high	116 Å²	116	97.8 Å²	97.8	54%	0.542	54%	0.541	S	S	.	.	H	α-helix	trans	-64.1	-39.2	176.2	-71.3	180	-38.7	0	0	112.2	K75 L76 K83	K75-Q79 WeakPolarHBondContact O-CG 3.4Å; K75-Q79 PolarHBondContact O-N 3.15Å; K75-Q79 VanDerWaalsContact O-N 3.15Å; L76-Q79 PolarHBondContact O-N 3.45Å; Q79-K83 PolarHBondContact O-N 3.45Å; Q79-K83 VanDerWaalsContact O-N 3.16Å
80	L	98.3	Very high	98.2	Very high	103 Å²	103	95.7 Å²	95.7	54%	0.539	53%	0.534	S	S	.	.	H	α-helix	trans	-65.4	-42.7	176	-176.8	60.4	0	0	0	111.2	L76 A77 L78 G82 K83 V84	L76-L80 WeakPolarHBondContact O-CB 3.43Å; L76-L80 PolarHBondContact O-N 3.02Å; A77-L80 PolarHBondContact O-N 2.89Å; L78-L80 VanDerWaalsContact C-N 3.33Å; L78-L80 PolarHBondContact O-N 3.22Å; L80-G82 PolarHBondContact O-N 3.11Å; L80-K83 PolarHBondContact O-N 3.45Å; L80-K83 VanDerWaalsContact O-N 3.15Å; L80-V84 WeakPolarHBondContact O-CG2 3.39Å; L80-V84 PolarHBondContact O-N 2.93Å
81	S	98.2	Very high	98.2	Very high	60 Å²	60	96.3 Å²	96.3	42%	0.42	53%	0.528	S	S	.	.	H	α-helix	trans	-55.5	-50.4	175.3	-165.7	0	0	0	0	111.4	A77 L78 K83 V84 E85	A77-S81 PolarHBondContact O-N 3.31Å; L78-S81 WeakPolarHBondContact O-CB 3.45Å; L78-S81 PolarHBondContact O-N 2.95Å; S81-K83 VanDerWaalsContact C-N 3.28Å; S81-K83 PolarHBondContact O-N 2.99Å; S81-V84 WeakPolarHBondContact O-CB 3.33Å; S81-V84 PolarHBondContact O-N 3.44Å; S81-V84 VanDerWaalsContact O-N 3.07Å; S81-E85 PolarHBondContact O-N 3.15Å
82	G	97.7	Very high	98.2	Very high	24 Å²	24	97.5 Å²	97.5	25%	0.247	52%	0.524	C	S	.	.	H	α-helix	trans	-61.5	-34.7	178.4	0	0	0	0	0	113.3	L78 L80 Q86	L78-G82 PolarHBondContact O-N 3.29Å; L78-G82 VanDerWaalsContact O-N 3.12Å; L80-G82 PolarHBondContact O-N 3.11Å; G82-Q86 WeakPolarHBondContact O-CG 3.5Å; G82-Q86 PolarHBondContact O-N 3.12Å; G82-Q86 VanDerWaalsContact O-N 3.11Å
83	K	98.1	Very high	98.2	Very high	142 Å²	142	98.7 Å²	98.7	62%	0.617	52%	0.521	S	S	*	.	H	α-helix	trans	-69.1	-37.3	173.8	-76.6	175.8	176	-78.5	0	112.6	Q79 L80 S81 Q86 L87	Q79-K83 PolarHBondContact O-N 3.45Å; Q79-K83 VanDerWaalsContact O-N 3.16Å; L80-K83 PolarHBondContact O-N 3.45Å; L80-K83 VanDerWaalsContact O-N 3.15Å; S81-K83 VanDerWaalsContact C-N 3.28Å; S81-K83 PolarHBondContact O-N 2.99Å; K83-Q86 PolarHBondContact O-N 3.07Å; K83-L87 WeakPolarHBondContact O-CB 3.48Å; K83-L87 PolarHBondContact O-N 3.34Å
84	V	98.4	Very high	98.2	Very high	86 Å²	86	99.8 Å²	99.8	52%	0.521	52%	0.521	S	S	.	.	H	α-helix	trans	-65.3	-41.1	176.2	170.1	0	0	0	0	110.6	L80 S81 L87 D88	L80-V84 WeakPolarHBondContact O-CG2 3.39Å; L80-V84 PolarHBondContact O-N 2.93Å; S81-V84 WeakPolarHBondContact O-CB 3.33Å; S81-V84 PolarHBondContact O-N 3.44Å; S81-V84 VanDerWaalsContact O-N 3.07Å; V84-L87 WeakPolarHBondContact O-CB 3.48Å; V84-L87 PolarHBondContact O-N 3.37Å; V84-D88 PolarHBondContact O-N 3Å
85	E	98	Very high	98.2	Very high	127 Å²	127	100.5 Å²	100.5	59%	0.593	52%	0.519	S	S	*	.	H	α-helix	trans	-62.3	-44.8	175.1	-71	167.4	-162.8	0	0	112.1	S81 L87 D88 F89	S81-E85 PolarHBondContact O-N 3.15Å; E85-L87 VanDerWaalsContact C-N 3.31Å; E85-L87 PolarHBondContact O-N 3.44Å; E85-D88 PolarHBondContact O-N 3.09Å; E85-F89 PolarHBondContact O-N 3.32Å
86	Q	98	Very high	98.2	Very high	132 Å²	132	100.2 Å²	100.2	62%	0.617	52%	0.518	S	S	*	.	H	α-helix	trans	-61	-40.9	174.3	-72.4	173.7	12.2	0	0	112	G82 K83 F89 V90	G82-Q86 WeakPolarHBondContact O-CG 3.5Å; G82-Q86 PolarHBondContact O-N 3.12Å; G82-Q86 VanDerWaalsContact O-N 3.11Å; K83-Q86 PolarHBondContact O-N 3.07Å; Q86-F89 WeakPolarHBondContact O-CB 3.46Å; Q86-F89 PolarHBondContact O-N 3.48Å; Q86-V90 WeakPolarHBondContact O-CG2 3.5Å; Q86-V90 PolarHBondContact O-N 2.9Å; Q86-V90 VanDerWaalsContact O-N 3.09Å
87	L	98.3	Very high	98.2	Very high	120 Å²	120	97.7 Å²	97.7	63%	0.628	51%	0.509	S	S	*	.	H	α-helix	trans	-64.7	-41.3	177.3	-177.6	62.1	0	0	0	111.6	K83 V84 E85 F89 V90 K91	K83-L87 WeakPolarHBondContact O-CB 3.48Å; K83-L87 PolarHBondContact O-N 3.34Å; V84-L87 WeakPolarHBondContact O-CB 3.48Å; V84-L87 PolarHBondContact O-N 3.37Å; E85-L87 VanDerWaalsContact C-N 3.31Å; E85-L87 PolarHBondContact O-N 3.44Å; L87-F89 VanDerWaalsContact C-N 3.34Å; L87-V90 PolarHBondContact O-N 3.05Å; L87-K91 WeakPolarHBondContact O-CB 3.33Å; L87-K91 PolarHBondContact O-N 3.25Å
88	D	98.4	Very high	98.2	Very high	72 Å²	72	98.8 Å²	98.8	39%	0.385	51%	0.51	S	S	.	.	H	α-helix	trans	-64.8	-38.8	176.6	-165.9	67.2	0	0	0	111.7	V84 E85 V90 K91 N92	V84-D88 PolarHBondContact O-N 3Å; E85-D88 PolarHBondContact O-N 3.09Å; D88-V90 PolarHBondContact O-N 3.35Å; D88-K91 PolarHBondContact O-N 3.45Å; D88-K91 IonicContact OD1-NZ 3.6Å; D88-N92 WeakPolarHBondContact O-CB 3.42Å; D88-N92 VanDerWaalsContact O-CG 3.22Å; D88-N92 PolarHBondContact O-N 2.92Å; D88-N92 PolarHBondContact O-ND2 2.92Å; D88-N92 VanDerWaalsContact O-ND2 3.11Å; D88-N92 PolarHBondContact OD2-ND2 3.37Å
89	F	98.2	Very high	98.2	Very high	152 Å²	152	97.4 Å²	97.4	67%	0.667	50%	0.503	S	S	*	.	H	α-helix	trans	-57.7	-49.6	172.3	177.1	-94.2	0	0	0	112.2	E85 Q86 L87 N92 H93	E85-F89 PolarHBondContact O-N 3.32Å; Q86-F89 WeakPolarHBondContact O-CB 3.46Å; Q86-F89 PolarHBondContact O-N 3.48Å; L87-F89 VanDerWaalsContact C-N 3.34Å; F89-N92 PolarHBondContact O-N 3.28Å; F89-H93 PolarHBondContact O-N 2.88Å
90	V	98.5	Very high	98.2	Very high	81 Å²	81	98.5 Å²	98.5	49%	0.491	51%	0.506	S	S	.	.	H	α-helix	trans	-63.2	-44.2	178.7	173.4	0	0	0	0	111	Q86 L87 D88 N92 H93 V94	Q86-V90 WeakPolarHBondContact O-CG2 3.5Å; Q86-V90 PolarHBondContact O-N 2.9Å; Q86-V90 VanDerWaalsContact O-N 3.09Å; L87-V90 PolarHBondContact O-N 3.05Å; D88-V90 PolarHBondContact O-N 3.35Å; V90-N92 PolarHBondContact O-N 3.16Å; V90-H93 WeakPolarHBondContact O-CB 3.41Å; V90-H93 PolarHBondContact O-N 3.17Å; V90-H93 VanDerWaalsContact O-N 3.17Å; V90-V94 HydrophobicContact CG1-CG2 4.46Å; V90-V94 WeakPolarHBondContact O-CG2 3.36Å; V90-V94 PolarHBondContact O-N 2.89Å
91	K	98.4	Very high	98.2	Very high	115 Å²	115	98.3 Å²	98.3	50%	0.5	51%	0.505	S	S	.	.	H	α-helix	trans	-56.1	-48.7	175.8	172.3	-167.5	161.6	-158	0	111.4	L87 D88 H93 V94 L95	L87-K91 WeakPolarHBondContact O-CB 3.33Å; L87-K91 PolarHBondContact O-N 3.25Å; D88-K91 PolarHBondContact O-N 3.45Å; D88-K91 IonicContact OD1-NZ 3.6Å; K91-H93 VanDerWaalsContact C-N 3.27Å; K91-H93 PolarHBondContact O-N 3.44Å; K91-V94 PolarHBondContact O-N 3.35Å; K91-V94 VanDerWaalsContact O-N 3.16Å; K91-L95 HydrophobicContact CG-CD1 4.32Å; K91-L95 WeakPolarHBondContact O-CG 3.44Å; K91-L95 PolarHBondContact O-N 3.11Å
92	N	98.3	Very high	98.3	Very high	68 Å²	68	98.6 Å²	98.6	36%	0.364	51%	0.507	S	S	.	.	H	α-helix	trans	-63.2	-35.1	179.4	-70.9	-30.9	0	0	0	111.9	D88 F89 V90 K96	D88-N92 WeakPolarHBondContact O-CB 3.42Å; D88-N92 VanDerWaalsContact O-CG 3.22Å; D88-N92 PolarHBondContact O-N 2.92Å; D88-N92 PolarHBondContact O-ND2 2.92Å; D88-N92 VanDerWaalsContact O-ND2 3.11Å; D88-N92 PolarHBondContact OD2-ND2 3.37Å; F89-N92 PolarHBondContact O-N 3.28Å; V90-N92 PolarHBondContact O-N 3.16Å; N92-K96 WeakPolarHBondContact O-CG 3.34Å; N92-K96 PolarHBondContact O-N 2.96Å
93	H	98.1	Very high	98.3	Very high	112 Å²	112	103.5 Å²	103.5	52%	0.519	52%	0.523	S	S	.	.	H	α-helix	trans	-65.9	-44.8	172.8	-172.9	-86.8	0	0	0	112.1	F89 V90 K91 L95 K96 C97	F89-H93 PolarHBondContact O-N 2.88Å; V90-H93 WeakPolarHBondContact O-CB 3.41Å; V90-H93 PolarHBondContact O-N 3.17Å; V90-H93 VanDerWaalsContact O-N 3.17Å; K91-H93 VanDerWaalsContact C-N 3.27Å; K91-H93 PolarHBondContact O-N 3.44Å; H93-L95 VanDerWaalsContact C-N 3.34Å; H93-L95 PolarHBondContact O-N 3.4Å; H93-K96 PolarHBondContact O-N 3.06Å; H93-C97 PolarHBondContact O-N 3.11Å; H93-C97 VanDerWaalsContact O-N 3.12Å
94	V	98.6	Very high	98.3	Very high	80 Å²	80	102 Å²	102	49%	0.485	52%	0.521	S	S	.	.	H	α-helix	trans	-60.5	-43.1	176.5	171.4	0	0	0	0	111.2	V90 K91 K96 C97 V98	V90-V94 HydrophobicContact CG1-CG2 4.46Å; V90-V94 WeakPolarHBondContact O-CG2 3.36Å; V90-V94 PolarHBondContact O-N 2.89Å; K91-V94 PolarHBondContact O-N 3.35Å; K91-V94 VanDerWaalsContact O-N 3.16Å; V94-K96 VanDerWaalsContact C-N 3.34Å; V94-K96 PolarHBondContact O-N 3.12Å; V94-C97 WeakPolarHBondContact O-CA 3.44Å; V94-C97 WeakPolarHBondContact O-CB 3.42Å; V94-C97 PolarHBondContact O-N 3.41Å; V94-V98 HydrophobicContact CG1-CG2 4.43Å; V94-V98 WeakPolarHBondContact O-CG2 3.45Å; V94-V98 PolarHBondContact O-N 2.9Å
95	L	98.5	Very high	98.2	Very high	84 Å²	84	101.9 Å²	101.9	44%	0.44	52%	0.516	S	S	.	.	H	α-helix	trans	-59.1	-43.7	176.7	-72.2	174.2	0	0	0	112	K91 H93 C97 V98 D99	K91-L95 HydrophobicContact CG-CD1 4.32Å; K91-L95 WeakPolarHBondContact O-CG 3.44Å; K91-L95 PolarHBondContact O-N 3.11Å; H93-L95 VanDerWaalsContact C-N 3.34Å; H93-L95 PolarHBondContact O-N 3.4Å; L95-C97 VanDerWaalsContact C-N 3.27Å; L95-C97 PolarHBondContact O-N 3.26Å; L95-V98 WeakPolarHBondContact O-CB 3.41Å; L95-V98 PolarHBondContact O-N 2.94Å; L95-V98 VanDerWaalsContact O-N 3.1Å; L95-D99 PolarHBondContact O-N 3.1Å
96	K	98.3	Very high	98.2	Very high	137 Å²	137	99.5 Å²	99.5	60%	0.596	51%	0.511	S	S	*	.	H	α-helix	trans	-59.9	-36.7	173.9	-71	174.3	-178.2	178.3	0	112.7	N92 H93 V94 K100	N92-K96 WeakPolarHBondContact O-CG 3.34Å; N92-K96 PolarHBondContact O-N 2.96Å; H93-K96 PolarHBondContact O-N 3.06Å; V94-K96 VanDerWaalsContact C-N 3.34Å; V94-K96 PolarHBondContact O-N 3.12Å; K96-K100 WeakPolarHBondContact O-CG 3.49Å; K96-K100 PolarHBondContact O-N 3.31Å; K96-K100 VanDerWaalsContact O-N 3.11Å
97	C	98.1	Very high	98.2	Very high	61 Å²	61	97.9 Å²	97.9	41%	0.412	51%	0.51	S	S	.	.	H	α-helix	trans	-67.7	-39.9	174.8	-72	0	0	0	0	111.9	H93 V94 L95 K100 L101	H93-C97 PolarHBondContact O-N 3.11Å; H93-C97 VanDerWaalsContact O-N 3.12Å; V94-C97 WeakPolarHBondContact O-CA 3.44Å; V94-C97 WeakPolarHBondContact O-CB 3.42Å; V94-C97 PolarHBondContact O-N 3.41Å; L95-C97 VanDerWaalsContact C-N 3.27Å; L95-C97 PolarHBondContact O-N 3.26Å; C97-K100 PolarHBondContact O-N 3.2Å; C97-L101 PolarHBondContact O-N 2.93Å
98	V	98.3	Very high	98.2	Very high	79 Å²	79	100.1 Å²	100.1	48%	0.479	51%	0.51	S	S	.	.	H	α-helix	trans	-62.6	-43.9	175.3	172.1	0	0	0	0	110.9	V94 L95 K100 L101 S102	V94-V98 HydrophobicContact CG1-CG2 4.43Å; V94-V98 WeakPolarHBondContact O-CG2 3.45Å; V94-V98 PolarHBondContact O-N 2.9Å; L95-V98 WeakPolarHBondContact O-CB 3.41Å; L95-V98 PolarHBondContact O-N 2.94Å; L95-V98 VanDerWaalsContact O-N 3.1Å; V98-K100 PolarHBondContact O-N 2.94Å; V98-L101 WeakPolarHBondContact O-CB 3.46Å; V98-L101 PolarHBondContact O-N 3.14Å; V98-L101 VanDerWaalsContact O-N 3.14Å; V98-S102 PolarHBondContact O-N 2.92Å
99	D	98.3	Very high	98.1	Very high	95 Å²	95	101.1 Å²	101.1	51%	0.508	52%	0.515	S	S	.	.	H	α-helix	trans	-61	-45.7	176.4	-70	-20.7	0	0	0	111.7	L95 L101 S102 H103	L95-D99 PolarHBondContact O-N 3.1Å; D99-L101 VanDerWaalsContact C-N 3.28Å; D99-L101 PolarHBondContact O-N 3.46Å; D99-S102 WeakPolarHBondContact O-CB 3.34Å; D99-S102 PolarHBondContact O-N 3.21Å; D99-H103 PolarHBondContact O-CD2 3.47Å; D99-H103 PolarHBondContact O-N 3.46Å
100	K	98.2	Very high	98	Very high	139 Å²	139	97.4 Å²	97.4	60%	0.604	51%	0.508	S	S	*	.	H	α-helix	trans	-58	-41.7	173.9	-74.4	176	-178.9	-178.1	0	111.9	K96 C97 V98 S102 H103 I104	K96-K100 WeakPolarHBondContact O-CG 3.49Å; K96-K100 PolarHBondContact O-N 3.31Å; K96-K100 VanDerWaalsContact O-N 3.11Å; C97-K100 PolarHBondContact O-N 3.2Å; V98-K100 PolarHBondContact O-N 2.94Å; K100-S102 VanDerWaalsContact C-N 3.34Å; K100-H103 PolarHBondContact O-N 3.31Å; K100-I104 WeakPolarHBondContact O-CG1 3.47Å; K100-I104 PolarHBondContact O-N 2.95Å
101	L	98.4	Very high	97.9	Very high	99 Å²	99	96.3 Å²	96.3	52%	0.518	51%	0.508	S	S	.	.	H	α-helix	trans	-64	-41	178	-171.9	66.4	0	0	0	111.4	C97 V98 D99 H103 I104 I105	C97-L101 PolarHBondContact O-N 2.93Å; V98-L101 WeakPolarHBondContact O-CB 3.46Å; V98-L101 PolarHBondContact O-N 3.14Å; V98-L101 VanDerWaalsContact O-N 3.14Å; D99-L101 VanDerWaalsContact C-N 3.28Å; D99-L101 PolarHBondContact O-N 3.46Å; L101-H103 VanDerWaalsContact C-N 3.34Å; L101-H103 PolarHBondContact O-N 3.32Å; L101-I104 PolarHBondContact O-N 3.01Å; L101-I105 HydrophobicContact CG-CD1 4.27Å; L101-I105 WeakPolarHBondContact O-CG1 3.35Å; L101-I105 PolarHBondContact O-N 3.12Å
102	S	98.3	Very high	97.8	Very high	66 Å²	66	94.2 Å²	94.2	46%	0.462	50%	0.501	S	S	.	.	H	α-helix	trans	-58.3	-44.9	174.3	-175.8	0	0	0	0	111.9	V98 D99 K100 I104 I105 T106	V98-S102 PolarHBondContact O-N 2.92Å; D99-S102 WeakPolarHBondContact O-CB 3.34Å; D99-S102 PolarHBondContact O-N 3.21Å; K100-S102 VanDerWaalsContact C-N 3.34Å; S102-I104 PolarHBondContact O-N 3.17Å; S102-I105 PolarHBondContact O-N 3.4Å; S102-T106 PolarHBondContact O-N 3.49Å; S102-T106 PolarHBondContact O-OG1 3Å
103	H	98	Very high	97.5	Very high	126 Å²	126	92.4 Å²	92.4	58%	0.583	50%	0.498	S	S	*	.	H	α-helix	trans	-62.2	-42.4	174.5	-67.8	-55	0	0	0	112.7	D99 K100 L101 I105 T106 V107	D99-H103 PolarHBondContact O-CD2 3.47Å; D99-H103 PolarHBondContact O-N 3.46Å; K100-H103 PolarHBondContact O-N 3.31Å; L101-H103 VanDerWaalsContact C-N 3.34Å; L101-H103 PolarHBondContact O-N 3.32Å; H103-I105 VanDerWaalsContact C-N 3.35Å; H103-I105 PolarHBondContact O-N 3.37Å; H103-T106 WeakPolarHBondContact O-CB 3.35Å; H103-T106 PolarHBondContact O-N 3.05Å; H103-V107 WeakPolarHBondContact O-CG2 3.5Å; H103-V107 PolarHBondContact O-N 3.3Å
104	I	97.9	Very high	97.3	Very high	110 Å²	110	91.9 Å²	91.9	56%	0.564	50%	0.503	S	S	*	.	H	α-helix	trans	-61.1	-43.7	176.4	-69.4	166.2	0	0	0	111.1	K100 L101 S102 T106 V107 R108	K100-I104 WeakPolarHBondContact O-CG1 3.47Å; K100-I104 PolarHBondContact O-N 2.95Å; L101-I104 PolarHBondContact O-N 3.01Å; S102-I104 PolarHBondContact O-N 3.17Å; I104-T106 VanDerWaalsContact C-N 3.27Å; I104-T106 PolarHBondContact O-N 3.36Å; I104-V107 PolarHBondContact O-N 3.46Å; I104-R108 WeakPolarHBondContact O-CB 3.4Å; I104-R108 PolarHBondContact O-N 3.18Å
105	I	97.9	Very high	96.9	Very high	84 Å²	84	95.4 Å²	95.4	43%	0.431	51%	0.512	S	S	.	.	H	α-helix	trans	-60.1	-41.9	176.4	-69.2	166.3	0	0	0	110.4	L101 S102 H103 R108 N109	L101-I105 HydrophobicContact CG-CD1 4.27Å; L101-I105 WeakPolarHBondContact O-CG1 3.35Å; L101-I105 PolarHBondContact O-N 3.12Å; S102-I105 PolarHBondContact O-N 3.4Å; H103-I105 VanDerWaalsContact C-N 3.35Å; H103-I105 PolarHBondContact O-N 3.37Å; I105-R108 WeakPolarHBondContact O-CB 3.43Å; I105-R108 PolarHBondContact O-N 3.18Å; I105-N109 VanDerWaalsContact O-CG 3.28Å; I105-N109 PolarHBondContact O-N 3.46Å; I105-N109 PolarHBondContact O-ND2 3.01Å
106	T	98.1	Very high	96.5	Very high	77 Å²	77	99 Å²	99	47%	0.472	52%	0.519	S	S	.	.	H	α-helix	trans	-63.2	-49.1	178.7	-57.7	0	0	0	0	111.1	S102 H103 I104 R108 N109 S110	S102-T106 PolarHBondContact O-N 3.49Å; S102-T106 PolarHBondContact O-OG1 3Å; H103-T106 WeakPolarHBondContact O-CB 3.35Å; H103-T106 PolarHBondContact O-N 3.05Å; I104-T106 VanDerWaalsContact C-N 3.27Å; I104-T106 PolarHBondContact O-N 3.36Å; T106-R108 VanDerWaalsContact C-N 3.32Å; T106-R108 PolarHBondContact O-N 2.98Å; T106-N109 PolarHBondContact O-N 3.24Å; T106-S110 PolarHBondContact O-N 2.89Å; T106-S110 PolarHBondContact O-OG 2.91Å
107	V	97.9	Very high	95.9	Very high	99 Å²	99	96.5 Å²	96.5	60%	0.6	52%	0.518	S	S	*	.	H	α-helix	trans	-59.7	-42.6	176.8	171.8	0	0	0	0	111.3	H103 I104 N109 S110 A111	H103-V107 WeakPolarHBondContact O-CG2 3.5Å; H103-V107 PolarHBondContact O-N 3.3Å; I104-V107 PolarHBondContact O-N 3.46Å; V107-N109 VanDerWaalsContact C-N 3.35Å; V107-N109 PolarHBondContact O-N 3.36Å; V107-S110 PolarHBondContact O-N 2.93Å; V107-A111 WeakPolarHBondContact O-CB 3.39Å; V107-A111 PolarHBondContact O-N 3.41Å
108	R	97.9	Very high	95.2	Very high	166 Å²	166	98.6 Å²	98.6	63%	0.626	53%	0.525	S	S	*	.	H	α-helix	trans	-57.8	-47.3	175.4	178.9	-169.5	176.9	-168.1	-0.1	111.3	I104 I105 T106 S110 A111 I112	I104-R108 WeakPolarHBondContact O-CB 3.4Å; I104-R108 PolarHBondContact O-N 3.18Å; I105-R108 WeakPolarHBondContact O-CB 3.43Å; I105-R108 PolarHBondContact O-N 3.18Å; T106-R108 VanDerWaalsContact C-N 3.32Å; T106-R108 PolarHBondContact O-N 2.98Å; R108-S110 VanDerWaalsContact C-N 3.33Å; R108-S110 PolarHBondContact O-N 2.94Å; R108-A111 PolarHBondContact O-N 3.26Å; R108-I112 HydrophobicContact CG-CD1 3.99Å; R108-I112 WeakPolarHBondContact O-CG1 3.38Å; R108-I112 PolarHBondContact O-N 3.48Å
109	N	97.2	Very high	94.5	Very high	94 Å²	94	99.6 Å²	99.6	50%	0.503	53%	0.531	S	S	.	.	H	α-helix	trans	-63.7	-40.8	-179.6	-70.6	-16.7	0	0	0	111.4	I105 T106 V107 I112 G113	I105-N109 VanDerWaalsContact O-CG 3.28Å; I105-N109 PolarHBondContact O-N 3.46Å; I105-N109 PolarHBondContact O-ND2 3.01Å; T106-N109 PolarHBondContact O-N 3.24Å; V107-N109 VanDerWaalsContact C-N 3.35Å; V107-N109 PolarHBondContact O-N 3.36Å; N109-I112 PolarHBondContact O-N 3.15Å; N109-G113 PolarHBondContact O-N 3.19Å
110	S	96	Very high	93.7	Very high	73 Å²	73	100.6 Å²	100.6	51%	0.51	54%	0.536	S	S	.	.	H	α-helix	trans	-61.3	-45	173.3	-60.3	0	0	0	0	112.2	T106 V107 R108 I112 G113 V114	T106-S110 PolarHBondContact O-N 2.89Å; T106-S110 PolarHBondContact O-OG 2.91Å; V107-S110 PolarHBondContact O-N 2.93Å; R108-S110 VanDerWaalsContact C-N 3.33Å; R108-S110 PolarHBondContact O-N 2.94Å; S110-I112 VanDerWaalsContact C-N 3.34Å; S110-I112 PolarHBondContact O-N 3.44Å; S110-G113 PolarHBondContact O-N 2.97Å; S110-G113 VanDerWaalsContact O-N 3.15Å; S110-V114 WeakPolarHBondContact O-CG2 3.33Å; S110-V114 PolarHBondContact O-N 3.34Å
111	A	95.4	Very high	92.5	Very high	59 Å²	59	96.8 Å²	96.8	49%	0.488	53%	0.527	S	S	.	.	H	α-helix	trans	-62.9	-39.1	177.5	0	0	0	0	0	112.4	V107 R108 G113 V114 K115	V107-A111 WeakPolarHBondContact O-CB 3.39Å; V107-A111 PolarHBondContact O-N 3.41Å; R108-A111 PolarHBondContact O-N 3.26Å; A111-G113 VanDerWaalsContact C-N 3.35Å; A111-V114 PolarHBondContact O-N 2.93Å; A111-K115 WeakPolarHBondContact O-CB 3.5Å; A111-K115 PolarHBondContact O-N 2.93Å
112	I	95.5	Very high	90.8	Very high	71 Å²	71	98 Å²	98	36%	0.364	53%	0.528	S	S	.	.	H	α-helix	trans	-62.5	-43.5	172.9	-69.1	167.2	0	0	0	110.6	R108 N109 S110 K115 R116	R108-I112 HydrophobicContact CG-CD1 3.99Å; R108-I112 WeakPolarHBondContact O-CG1 3.38Å; R108-I112 PolarHBondContact O-N 3.48Å; N109-I112 PolarHBondContact O-N 3.15Å; S110-I112 VanDerWaalsContact C-N 3.34Å; S110-I112 PolarHBondContact O-N 3.44Å; I112-K115 PolarHBondContact O-N 3.43Å; I112-R116 PolarHBondContact O-N 3.44Å
113	G	93.7	Very high	88.9	Confident	29 Å²	29	98.8 Å²	98.8	30%	0.299	53%	0.527	S	S	.	.	H	α-helix	trans	-58	-49.7	175.6	0	0	0	0	0	112.3	N109 S110 A111 K115 R116 C117	N109-G113 PolarHBondContact O-N 3.19Å; S110-G113 PolarHBondContact O-N 2.97Å; S110-G113 VanDerWaalsContact O-N 3.15Å; A111-G113 VanDerWaalsContact C-N 3.35Å; G113-K115 PolarHBondContact O-N 3.03Å; G113-R116 WeakPolarHBondContact O-CB 3.4Å; G113-R116 PolarHBondContact O-N 3.35Å; G113-C117 PolarHBondContact O-N 3.35Å; G113-C117 PolarHBondContact O-SG 3.45Å
114	V	92.6	Very high	87	Confident	102 Å²	102	99 Å²	99	62%	0.618	53%	0.532	S	S	*	.	H	α-helix	trans	-59.5	-45.6	176.2	173.2	0	0	0	0	111.4	S110 A111 R116 C117 L118	S110-V114 WeakPolarHBondContact O-CG2 3.33Å; S110-V114 PolarHBondContact O-N 3.34Å; A111-V114 PolarHBondContact O-N 2.93Å; V114-R116 VanDerWaalsContact C-N 3.28Å; V114-R116 PolarHBondContact O-N 3.16Å; V114-C117 PolarHBondContact O-N 3.45Å; V114-L118 PolarHBondContact O-N 3.31Å
115	K	91.1	Very high	85.1	Confident	153 Å²	153	99.1 Å²	99.1	67%	0.665	53%	0.53	S	S	*	.	H	α-helix	trans	-58.6	-40.6	177.5	-175.8	177.6	-179.8	179	0	111.6	A111 I112 G113 L118 V119	A111-K115 WeakPolarHBondContact O-CB 3.5Å; A111-K115 PolarHBondContact O-N 2.93Å; I112-K115 PolarHBondContact O-N 3.43Å; G113-K115 PolarHBondContact O-N 3.03Å; K115-L118 PolarHBondContact O-N 3.15Å; K115-V119 WeakPolarHBondContact O-CG2 3.49Å; K115-V119 PolarHBondContact O-N 2.95Å; K115-V119 VanDerWaalsContact O-N 3.15Å
116	R	89.5	Confident	83.3	Confident	159 Å²	159	98.1 Å²	98.1	60%	0.6	53%	0.53	S	S	*	.	H	α-helix	trans	-64.9	-47.8	177	-167.3	-177.3	-63	154.4	0.5	111.4	I112 G113 V114 L118 V119 D120	I112-R116 PolarHBondContact O-N 3.44Å; G113-R116 WeakPolarHBondContact O-CB 3.4Å; G113-R116 PolarHBondContact O-N 3.35Å; V114-R116 VanDerWaalsContact C-N 3.28Å; V114-R116 PolarHBondContact O-N 3.16Å; R116-L118 VanDerWaalsContact C-N 3.28Å; R116-L118 PolarHBondContact O-N 2.95Å; R116-V119 PolarHBondContact O-N 3.27Å; R116-V119 VanDerWaalsContact O-N 3.16Å; R116-D120 WeakPolarHBondContact O-CB 3.21Å; R116-D120 VanDerWaalsContact O-CG 3.3Å; R116-D120 PolarHBondContact O-N 2.87Å
117	C	86.3	Confident	81.6	Confident	85 Å²	85	99.4 Å²	99.4	57%	0.574	53%	0.533	S	S	*	.	H	α-helix	trans	-58.5	-39.1	176	-65.3	0	0	0	0	112.6	G113 V114 D120 S121	G113-C117 PolarHBondContact O-N 3.35Å; G113-C117 PolarHBondContact O-SG 3.45Å; V114-C117 PolarHBondContact O-N 3.45Å; C117-D120 PolarHBondContact O-N 2.9Å; C117-S121 WeakPolarHBondContact O-CB 3.45Å; C117-S121 PolarHBondContact O-N 2.84Å; C117-S121 PolarHBondContact O-OG 2.83Å; C117-S121 VanDerWaalsContact O-OG 3.08Å
118	L	82.9	Confident	80	Confident	105 Å²	105	98.7 Å²	98.7	55%	0.55	53%	0.529	S	S	.	.	H	α-helix	trans	-62.5	-44.9	177.3	-175.3	64.9	0	0	0	111.4	V114 K115 R116 S121 L123	V114-L118 PolarHBondContact O-N 3.31Å; K115-L118 PolarHBondContact O-N 3.15Å; R116-L118 VanDerWaalsContact C-N 3.28Å; R116-L118 PolarHBondContact O-N 2.95Å; L118-S121 PolarHBondContact O-OG 3.25Å; L118-L123 HydrophobicContact CD1-CB 4.47Å; L118-L123 HydrophobicContact CD1-CD1 3.84Å
119	V	83.4	Confident	78.5	Confident	101 Å²	101	94.4 Å²	94.4	61%	0.612	52%	0.521	S	S	*	.	H	α-helix	trans	-65.1	-46	176.2	173.7	0	0	0	0	111.2	K115 R116 S121 K122	K115-V119 WeakPolarHBondContact O-CG2 3.49Å; K115-V119 PolarHBondContact O-N 2.95Å; K115-V119 VanDerWaalsContact O-N 3.15Å; R116-V119 PolarHBondContact O-N 3.27Å; R116-V119 VanDerWaalsContact O-N 3.16Å; V119-S121 PolarHBondContact O-N 3.46Å; V119-K122 PolarHBondContact O-N 3.44Å
120	D	81.2	Confident	77.1	Confident	115 Å²	115	93.7 Å²	93.7	62%	0.615	52%	0.522	S	S	*	.	H	α-helix	trans	-68.4	-33.8	-176.9	-68.3	-16.7	0	0	0	112.5	R116 C117 K122	R116-D120 WeakPolarHBondContact O-CB 3.21Å; R116-D120 VanDerWaalsContact O-CG 3.3Å; R116-D120 PolarHBondContact O-N 2.87Å; C117-D120 PolarHBondContact O-N 2.9Å; D120-K122 PolarHBondContact O-N 2.96Å; D120-K122 VanDerWaalsContact O-N 3.09Å
121	S	73	Confident	75.7	Confident	60 Å²	60	95.7 Å²	95.7	42%	0.42	53%	0.527	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.8	-5.2	178	66.3	0	0	0	0	114.2	C117 L118 V119 L123	C117-S121 WeakPolarHBondContact O-CB 3.45Å; C117-S121 PolarHBondContact O-N 2.84Å; C117-S121 PolarHBondContact O-OG 2.83Å; C117-S121 VanDerWaalsContact O-OG 3.08Å; L118-S121 PolarHBondContact O-OG 3.25Å; V119-S121 PolarHBondContact O-N 3.46Å; S121-L123 PolarHBondContact O-N 3.29Å; S121-L123 VanDerWaalsContact OG-CD1 3.27Å; S121-L123 WeakPolarHBondContact OG-CD1 3.4Å; S121-L123 WeakPolarHBondContact OG-CG 3.34Å
122	K	62.8	Low	74.4	Confident	123 Å²	123	98.6 Å²	98.6	54%	0.535	53%	0.53	S	S	.	.	T	Hydrogen-bonded Turn	trans	44.4	35	-175.7	-65.6	-160.5	179.5	-175.3	0	113	V119 D120 D124 E125 P126	V119-K122 PolarHBondContact O-N 3.44Å; D120-K122 PolarHBondContact O-N 2.96Å; D120-K122 VanDerWaalsContact O-N 3.09Å; K122-D124 PolarHBondContact O-N 3.08Å; K122-E125 HydrophobicContact CB-CB 4.34Å; K122-E125 WeakPolarHBondContact CD-OE2 2.94Å; K122-E125 IonicContact NZ-OE1 3.69Å; K122-E125 IonicContact NZ-OE2 2.97Å; K122-E125 PolarHBondContact NZ-OE2 3.09Å; K122-E125 WeakPolarHBondContact O-CB 3.39Å; K122-E125 PolarHBondContact O-N 2.97Å; K122-P126 WeakPolarHBondContact O-CD 3.14Å
123	L	58.9	Low	73.4	Confident	83 Å²	83	100 Å²	100	44%	0.435	54%	0.538	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.9	-18.6	-174.1	-88.6	164	0	0	0	113.6	L118 S121 E125 P126 L127	L118-L123 HydrophobicContact CD1-CB 4.47Å; L118-L123 HydrophobicContact CD1-CD1 3.84Å; S121-L123 PolarHBondContact O-N 3.29Å; S121-L123 VanDerWaalsContact OG-CD1 3.27Å; S121-L123 WeakPolarHBondContact OG-CD1 3.4Å; S121-L123 WeakPolarHBondContact OG-CG 3.34Å; L123-E125 VanDerWaalsContact C-N 3.34Å; L123-P126 WeakPolarHBondContact O-CD 3.43Å; L123-L127 WeakPolarHBondContact O-CB 3.27Å; L123-L127 WeakPolarHBondContact O-CD1 2.99Å; L123-L127 WeakPolarHBondContact O-CG 3.33Å; L123-L127 PolarHBondContact O-N 3Å
124	D	57.3	Low	72.5	Confident	130 Å²	130	106.4 Å²	106.4	70%	0.695	55%	0.553	S	S	*	*	H	α-helix	trans	-65.5	-32.6	170.7	-68.9	-30.4	0	0	0	113	K122 V128	K122-D124 PolarHBondContact O-N 3.08Å; D124-V128 WeakPolarHBondContact O-CB 3.4Å; D124-V128 WeakPolarHBondContact O-CG2 3.4Å; D124-V128 PolarHBondContact O-N 3.45Å
125	E	57.9	Low	71.6	Confident	113 Å²	113	109.1 Å²	109.1	53%	0.528	56%	0.556	S	S	.	*	H	α-helix	trans	-70.5	-49.4	-177.5	-143.6	164.6	-145.5	0	0	112.8	K122 L123 V128 T129	K122-E125 HydrophobicContact CB-CB 4.34Å; K122-E125 WeakPolarHBondContact CD-OE2 2.94Å; K122-E125 IonicContact NZ-OE1 3.69Å; K122-E125 IonicContact NZ-OE2 2.97Å; K122-E125 PolarHBondContact NZ-OE2 3.09Å; K122-E125 WeakPolarHBondContact O-CB 3.39Å; K122-E125 PolarHBondContact O-N 2.97Å; L123-E125 VanDerWaalsContact C-N 3.34Å; E125-V128 PolarHBondContact O-N 2.88Å; E125-T129 WeakPolarHBondContact O-CB 3.39Å; E125-T129 PolarHBondContact O-N 3.49Å; E125-T129 PolarHBondContact O-OG1 2.94Å
126	P	61.1	Low	70.8	Confident	64 Å²	64	111.4 Å²	111.4	42%	0.416	56%	0.561	S	S	.	*	H	α-helix	trans	-70.6	-29.4	173.6	26.6	-29.6	0	0	0	112.8	K122 L123 T129 C130	K122-P126 WeakPolarHBondContact O-CD 3.14Å; L123-P126 WeakPolarHBondContact O-CD 3.43Å; P126-T129 PolarHBondContact O-N 3.48Å; P126-C130 VanDerWaalsContact O-CB 3.29Å; P126-C130 WeakPolarHBondContact O-CB 3.32Å; P126-C130 PolarHBondContact O-N 3.4Å; P126-C130 PolarHBondContact O-SG 3.48Å
127	L	61.7	Low	69.8	Low	103 Å²	103	114.4 Å²	114.4	54%	0.539	57%	0.572	S	S	.	*	H	α-helix	trans	-66.6	-43.7	173.1	-82.9	166.9	0	0	0	111.9	L123 T129 C130 L131	L123-L127 WeakPolarHBondContact O-CB 3.27Å; L123-L127 WeakPolarHBondContact O-CD1 2.99Å; L123-L127 WeakPolarHBondContact O-CG 3.33Å; L123-L127 PolarHBondContact O-N 3Å; L127-T129 VanDerWaalsContact C-N 3.3Å; L127-T129 PolarHBondContact O-N 3.23Å; L127-C130 PolarHBondContact O-N 2.89Å; L127-L131 WeakPolarHBondContact O-CB 3.29Å; L127-L131 PolarHBondContact O-N 2.66Å
128	V	65	Low	69	Low	85 Å²	85	117.7 Å²	117.7	52%	0.515	58%	0.577	S	S	.	*	H	α-helix	trans	-64.3	-37.4	174.2	170.5	0	0	0	0	111.1	D124 E125 L131 H132	D124-V128 WeakPolarHBondContact O-CB 3.4Å; D124-V128 WeakPolarHBondContact O-CG2 3.4Å; D124-V128 PolarHBondContact O-N 3.45Å; E125-V128 PolarHBondContact O-N 2.88Å; V128-L131 PolarHBondContact O-N 3.4Å; V128-H132 WeakPolarHBondContact O-CB 3.44Å; V128-H132 PolarHBondContact O-N 3.46Å
129	T	65	Low	67.8	Low	75 Å²	75	120.9 Å²	120.9	46%	0.46	60%	0.601	S	S	.	*	H	α-helix	trans	-68.1	-44	176.7	-48	0	0	0	0	111.4	E125 P126 L127 L131 H132 I133	E125-T129 WeakPolarHBondContact O-CB 3.39Å; E125-T129 PolarHBondContact O-N 3.49Å; E125-T129 PolarHBondContact O-OG1 2.94Å; P126-T129 PolarHBondContact O-N 3.48Å; L127-T129 VanDerWaalsContact C-N 3.3Å; L127-T129 PolarHBondContact O-N 3.23Å; T129-L131 PolarHBondContact O-N 2.98Å; T129-H132 PolarHBondContact O-N 3.33Å; T129-I133 HydrophobicContact CG2-CD1 4.05Å; T129-I133 WeakPolarHBondContact O-CB 3.49Å; T129-I133 VanDerWaalsContact O-CG1 3.25Å; T129-I133 WeakPolarHBondContact O-CG1 3.45Å; T129-I133 PolarHBondContact O-N 3.49Å
130	C	68.5	Low	67.1	Low	79 Å²	79	121.9 Å²	121.9	53%	0.534	60%	0.6	S	S	.	*	H	α-helix	trans	-63.5	-39.3	174.3	-75.9	0	0	0	0	112.2	P126 L127 I133 W134	P126-C130 VanDerWaalsContact O-CB 3.29Å; P126-C130 WeakPolarHBondContact O-CB 3.32Å; P126-C130 PolarHBondContact O-N 3.4Å; P126-C130 PolarHBondContact O-SG 3.48Å; L127-C130 PolarHBondContact O-N 2.89Å; C130-I133 PolarHBondContact O-N 3.49Å; C130-W134 VanDerWaalsContact O-CB 3.29Å; C130-W134 WeakPolarHBondContact O-CB 3.29Å; C130-W134 PolarHBondContact O-N 3.28Å
131	L	66.2	Low	66.3	Low	116 Å²	116	122.2 Å²	122.2	61%	0.607	60%	0.599	S	S	*	*	H	α-helix	trans	-64	-41.1	172.8	-108.6	131.5	0	0	0	111.7	L127 V128 T129 W134 K135	L127-L131 WeakPolarHBondContact O-CB 3.29Å; L127-L131 PolarHBondContact O-N 2.66Å; V128-L131 PolarHBondContact O-N 3.4Å; T129-L131 PolarHBondContact O-N 2.98Å; L131-W134 PolarHBondContact O-N 2.93Å; L131-K135 WeakPolarHBondContact O-CB 3.25Å; L131-K135 PolarHBondContact O-N 2.92Å
132	H	69	Low	65.9	Low	119 Å²	119	125.7 Å²	125.7	55%	0.551	61%	0.609	S	S	*	*	H	α-helix	trans	-64	-45.4	174.5	-105.1	90.5	0	0	0	112.2	V128 T129 W134 K135 W136	V128-H132 WeakPolarHBondContact O-CB 3.44Å; V128-H132 PolarHBondContact O-N 3.46Å; T129-H132 PolarHBondContact O-N 3.33Å; H132-W134 VanDerWaalsContact C-N 3.35Å; H132-K135 PolarHBondContact O-N 3.38Å; H132-W136 PolarHBondContact O-N 2.82Å
133	I	74.4	Confident	66.1	Low	102 Å²	102	125.8 Å²	125.8	52%	0.523	61%	0.614	S	S	.	*	H	α-helix	trans	-62.6	-42.7	176.8	-68.6	165.6	0	0	0	110.5	T129 C130 K135 W136 R137	T129-I133 HydrophobicContact CG2-CD1 4.05Å; T129-I133 WeakPolarHBondContact O-CB 3.49Å; T129-I133 VanDerWaalsContact O-CG1 3.25Å; T129-I133 WeakPolarHBondContact O-CG1 3.45Å; T129-I133 PolarHBondContact O-N 3.49Å; C130-I133 PolarHBondContact O-N 3.49Å; I133-K135 VanDerWaalsContact C-N 3.34Å; I133-K135 PolarHBondContact O-N 3.46Å; I133-W136 PolarHBondContact O-N 3.25Å; I133-R137 PolarHBondContact O-N 3.31Å
134	W	74.7	Confident	66.6	Low	162 Å²	162	128.5 Å²	128.5	61%	0.614	63%	0.625	S	S	*	*	H	α-helix	trans	-65.4	-37.4	177.2	-169.3	81.1	0	0	0	112.4	C130 L131 H132 R137 K138	C130-W134 VanDerWaalsContact O-CB 3.29Å; C130-W134 WeakPolarHBondContact O-CB 3.29Å; C130-W134 PolarHBondContact O-N 3.28Å; L131-W134 PolarHBondContact O-N 2.93Å; H132-W134 VanDerWaalsContact C-N 3.35Å; W134-R137 PolarHBondContact O-N 3.45Å; W134-K138 HydrophobicContact CH2-CD 4.25Å; W134-K138 VanDerWaalsContact CH2-NZ 3.31Å; W134-K138 HydrophobicContact CZ2-CD 4.45Å; W134-K138 HydrophobicContact CZ3-CD 4.42Å
135	K	74	Confident	67.2	Low	160 Å²	160	128.4 Å²	128.4	70%	0.696	62%	0.62	S	S	*	*	H	α-helix	trans	-67.9	-40.6	175.7	-157.8	174.3	-174.9	179.9	0	111.8	L131 H132 I133 R137 K138 T139	L131-K135 WeakPolarHBondContact O-CB 3.25Å; L131-K135 PolarHBondContact O-N 2.92Å; H132-K135 PolarHBondContact O-N 3.38Å; I133-K135 VanDerWaalsContact C-N 3.34Å; I133-K135 PolarHBondContact O-N 3.46Å; K135-R137 VanDerWaalsContact C-N 3.35Å; K135-R137 PolarHBondContact O-N 2.86Å; K135-K138 PolarHBondContact O-N 3.44Å; K135-T139 PolarHBondContact O-OG1 2.85Å
136	W	73.6	Confident	67.9	Low	200 Å²	200	129.5 Å²	129.5	76%	0.758	63%	0.627	S	S	*	*	H	α-helix	trans	-64.6	-34.6	174.5	-103.4	85.2	0	0	0	113.3	H132 I133 K138 T139	H132-W136 PolarHBondContact O-N 2.82Å; I133-W136 PolarHBondContact O-N 3.25Å; W136-K138 PolarHBondContact O-N 3.25Å; W136-T139 PolarHBondContact O-OG1 3.03Å
137	R	69.9	Low	68.4	Low	223 Å²	223	134.5 Å²	134.5	84%	0.842	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.9	-8.4	178.9	-126.1	-179.4	-166.4	173.4	4.2	114.5	I133 W134 K135	I133-R137 PolarHBondContact O-N 3.31Å; W134-R137 PolarHBondContact O-N 3.45Å; K135-R137 VanDerWaalsContact C-N 3.35Å; K135-R137 PolarHBondContact O-N 2.86Å
138	K	67.4	Low	68.9	Low	154 Å²	154	137.2 Å²	137.2	67%	0.67	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.6	-2	-174.5	-128.6	-178.9	-176.7	178.9	0	113.8	W134 K135 W136	W134-K138 HydrophobicContact CH2-CD 4.25Å; W134-K138 VanDerWaalsContact CH2-NZ 3.31Å; W134-K138 HydrophobicContact CZ2-CD 4.45Å; W134-K138 HydrophobicContact CZ3-CD 4.42Å; K135-K138 PolarHBondContact O-N 3.44Å; W136-K138 PolarHBondContact O-N 3.25Å
139	T	59.6	Low	69.3	Low	171 Å²	171	141.9 Å²	141.9	100%	1.049	66%	0.664	S	S	*	*			trans	-109.4	0	171	20.1	0	0	0	0	109	K135 W136	K135-T139 PolarHBondContact O-OG1 2.85Å; W136-T139 PolarHBondContact O-OG1 3.03Å

Retrieved 139 of 139 residues in 89.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).