A0A5K4F369_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F369, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 66 aa.

						>A0A5K4F369_SCHMA|A0A5K4F369
MVKLKKEALDTLSVSIDNMDNNKICLLSLVDNIVEISSSLLELNNVAQKSLHNWDPNRGCILLQCL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.9	Low	73.4	Confident	152 Å²	152	102.4 Å²	102.4	75%	0.749	52%	0.523	S	S	*	.				0	-59.7	0	-140.2	168.9	89.3	0	0	113.8	K3 L4 K5 V34	M1-K3 PolarHBondContact O-N 3.47Å; M1-L4 PolarHBondContact O-N 3.26Å; M1-K5 PolarHBondContact O-N 2.96Å; M1-V34 HydrophobicContact CG-CG1 3.71Å
2	V	73	Confident	73	Confident	127 Å²	127	101 Å²	101	77%	0.77	52%	0.517	S	S	*	.	H	α-helix	trans	-56.4	-41.7	-173.2	-178	0	0	0	0	114.1	K6	V2-K6 WeakPolarHBondContact O-CB 3.38Å; V2-K6 PolarHBondContact O-N 3.47Å
3	K	78.2	Confident	72.7	Confident	169 Å²	169	101.4 Å²	101.4	74%	0.735	53%	0.534	S	S	*	.	H	α-helix	trans	-61.2	-52.3	176.4	-87.7	-171.5	173.5	-175.1	0	112.8	M1 K5 K6 E7	M1-K3 PolarHBondContact O-N 3.47Å; K3-K5 VanDerWaalsContact C-N 3.32Å; K3-K5 PolarHBondContact O-N 3.36Å; K3-K6 PolarHBondContact O-N 3.25Å; K3-K6 VanDerWaalsContact O-N 3.16Å; K3-E7 WeakPolarHBondContact O-CG 3.42Å; K3-E7 PolarHBondContact O-N 3.24Å
4	L	72.7	Confident	72.1	Confident	79 Å²	79	95.4 Å²	95.4	41%	0.414	50%	0.504	S	S	.	.	H	α-helix	trans	-57.1	-44.4	178.1	-86.4	151.5	0	0	0	112	M1 E7 A8 V34	M1-L4 PolarHBondContact O-N 3.26Å; L4-E7 PolarHBondContact O-N 3.42Å; L4-A8 WeakPolarHBondContact O-CB 3.29Å; L4-A8 PolarHBondContact O-N 3.42Å; L4-V34 HydrophobicContact CB-CG1 4.04Å; L4-V34 HydrophobicContact CB-CG2 4.35Å
5	K	75	Confident	71.5	Confident	78 Å²	78	92.7 Å²	92.7	34%	0.339	50%	0.496	S	S	.	.	H	α-helix	trans	-61.5	-45.6	176.8	-178.9	171.7	177.2	155.1	0	111.8	M1 K3 A8 L9 D31 V34	M1-K5 PolarHBondContact O-N 2.96Å; K3-K5 VanDerWaalsContact C-N 3.32Å; K3-K5 PolarHBondContact O-N 3.36Å; K5-A8 PolarHBondContact O-N 3.48Å; K5-L9 PolarHBondContact O-N 3.36Å; K5-D31 WeakPolarHBondContact CD-OD1 3.46Å; K5-D31 WeakPolarHBondContact CE-OD1 3.46Å; K5-D31 IonicContact NZ-OD1 2.66Å; K5-D31 PolarHBondContact NZ-OD1 3.19Å; K5-D31 IonicContact NZ-OD2 2.87Å; K5-D31 PolarHBondContact NZ-OD2 3.46Å; K5-V34 HydrophobicContact CB-CG2 4.46Å
6	K	76.7	Confident	71.1	Confident	135 Å²	135	93.3 Å²	93.3	59%	0.587	50%	0.498	S	S	*	.	H	α-helix	trans	-62.5	-48.4	178	-175.8	178.4	176.7	-178.5	0	111.5	V2 K3 A8 L9 D10	V2-K6 WeakPolarHBondContact O-CB 3.38Å; V2-K6 PolarHBondContact O-N 3.47Å; K3-K6 PolarHBondContact O-N 3.25Å; K3-K6 VanDerWaalsContact O-N 3.16Å; K6-A8 VanDerWaalsContact C-N 3.31Å; K6-A8 PolarHBondContact O-N 3.02Å; K6-L9 WeakPolarHBondContact O-CB 3.43Å; K6-L9 PolarHBondContact O-N 3.46Å; K6-L9 VanDerWaalsContact O-N 3.17Å; K6-D10 WeakPolarHBondContact O-CB 3.29Å; K6-D10 VanDerWaalsContact O-CG 3.22Å; K6-D10 PolarHBondContact O-N 3.22Å
7	E	75	Confident	70.8	Confident	110 Å²	110	96.9 Å²	96.9	51%	0.514	52%	0.517	S	S	.	.	H	α-helix	trans	-59.7	-40.7	178.4	-73.6	168	-166.4	0	0	112.2	K3 L4 T11	K3-E7 WeakPolarHBondContact O-CG 3.42Å; K3-E7 PolarHBondContact O-N 3.24Å; L4-E7 PolarHBondContact O-N 3.42Å; E7-T11 WeakPolarHBondContact O-CB 3.48Å; E7-T11 PolarHBondContact O-N 3.19Å; E7-T11 PolarHBondContact O-OG1 3.17Å
8	A	71.4	Confident	70.3	Confident	30 Å²	30	98.3 Å²	98.3	25%	0.248	52%	0.524	C	S	.	.	H	α-helix	trans	-65.8	-41.7	175.3	0	0	0	0	0	112.3	L4 K5 K6 T11 L12 V30	L4-A8 WeakPolarHBondContact O-CB 3.29Å; L4-A8 PolarHBondContact O-N 3.42Å; K5-A8 PolarHBondContact O-N 3.48Å; K6-A8 VanDerWaalsContact C-N 3.31Å; K6-A8 PolarHBondContact O-N 3.02Å; A8-T11 PolarHBondContact O-N 3.31Å; A8-L12 WeakPolarHBondContact O-CG 3.22Å; A8-L12 PolarHBondContact O-N 3.49Å; A8-V30 HydrophobicContact CB-CG1 3.58Å
9	L	73.3	Confident	70.1	Confident	31 Å²	31	98.3 Å²	98.3	16%	0.162	52%	0.522	C	S	.	.	H	α-helix	trans	-61.6	-48.1	175.6	-130.6	87.8	0	0	0	111.9	K5 K6 T11 L12 S13 I16 L27	K5-L9 PolarHBondContact O-N 3.36Å; K6-L9 WeakPolarHBondContact O-CB 3.43Å; K6-L9 PolarHBondContact O-N 3.46Å; K6-L9 VanDerWaalsContact O-N 3.17Å; L9-T11 VanDerWaalsContact C-N 3.27Å; L9-T11 PolarHBondContact O-N 3.4Å; L9-L12 PolarHBondContact O-N 2.93Å; L9-S13 PolarHBondContact O-N 3.32Å; L9-I16 HydrophobicContact CD2-CD1 3.99Å; L9-I16 HydrophobicContact CD2-CG1 4.35Å; L9-L27 HydrophobicContact CD1-CD2 3.33Å; L9-L27 HydrophobicContact CG-CD2 4.11Å
10	D	75.7	Confident	70.4	Confident	101 Å²	101	97.2 Å²	97.2	54%	0.54	52%	0.517	S	S	.	.	H	α-helix	trans	-61.6	-40.1	-179.5	-69.7	-16.5	0	0	0	109.6	K6 S13	K6-D10 WeakPolarHBondContact O-CB 3.29Å; K6-D10 VanDerWaalsContact O-CG 3.22Å; K6-D10 PolarHBondContact O-N 3.22Å; D10-S13 PolarHBondContact O-N 2.92Å
11	T	73.2	Confident	70.7	Confident	114 Å²	114	99 Å²	99	70%	0.699	53%	0.527	S	S	*	.	H	α-helix	trans	-66.6	-42.7	177	-57.6	0	0	0	0	112.6	E7 A8 L9 S13	E7-T11 WeakPolarHBondContact O-CB 3.48Å; E7-T11 PolarHBondContact O-N 3.19Å; E7-T11 PolarHBondContact O-OG1 3.17Å; A8-T11 PolarHBondContact O-N 3.31Å; L9-T11 VanDerWaalsContact C-N 3.27Å; L9-T11 PolarHBondContact O-N 3.4Å; T11-S13 PolarHBondContact O-N 2.99Å
12	L	69.4	Low	71.2	Confident	86 Å²	86	97.5 Å²	97.5	45%	0.45	52%	0.522	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.9	-4	178.9	-69.6	171.6	0	0	0	113.2	A8 L9 V14 V30	A8-L12 WeakPolarHBondContact O-CG 3.22Å; A8-L12 PolarHBondContact O-N 3.49Å; L9-L12 PolarHBondContact O-N 2.93Å; L12-V14 HydrophobicContact CB-CG2 3.62Å; L12-V14 PolarHBondContact O-N 3.16Å; L12-V14 VanDerWaalsContact O-N 3.09Å; L12-V30 HydrophobicContact CD1-CG2 3.09Å
13	S	68.5	Low	71.1	Confident	106 Å²	106	93.8 Å²	93.8	74%	0.741	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.8	32.9	-179	-59.3	0	0	0	0	112.7	L9 D10 T11 S15	L9-S13 PolarHBondContact O-N 3.32Å; D10-S13 PolarHBondContact O-N 2.92Å; T11-S13 PolarHBondContact O-N 2.99Å; S13-S15 PolarHBondContact O-N 3.15Å; S13-S15 VanDerWaalsContact O-N 3.11Å
14	V	63.9	Low	71.1	Confident	18 Å²	18	89.3 Å²	89.3	11%	0.109	48%	0.478	C	S	.	.			trans	-79.5	98.6	-177.4	-178.6	0	0	0	0	108.6	L12 I16 K23 L27	L12-V14 HydrophobicContact CB-CG2 3.62Å; L12-V14 PolarHBondContact O-N 3.16Å; L12-V14 VanDerWaalsContact O-N 3.09Å; V14-I16 PolarHBondContact O-N 3.44Å; V14-K23 HydrophobicContact CG1-CB 4.29Å; V14-K23 HydrophobicContact CG1-CD 4.22Å; V14-K23 HydrophobicContact CG1-CG 4.18Å; V14-L27 HydrophobicContact CG1-CD2 4.28Å; V14-L27 HydrophobicContact CG1-CG 4.42Å
15	S	63.8	Low	71.4	Confident	55 Å²	55	89.6 Å²	89.6	39%	0.385	49%	0.486	S	S	.	.			trans	-67.4	124.4	165.4	161.7	0	0	0	0	109.5	S13 D17 K23	S13-S15 PolarHBondContact O-N 3.15Å; S13-S15 VanDerWaalsContact O-N 3.11Å; S15-D17 VanDerWaalsContact C-N 3.26Å; S15-D17 PolarHBondContact OG-N 2.96Å; S15-D17 PolarHBondContact OG-OD2 3.26Å; S15-D17 VanDerWaalsContact OG-OD2 3.14Å; S15-K23 PolarHBondContact O-NZ 3.43Å
16	I	64.9	Low	71.6	Confident	102 Å²	102	89.4 Å²	89.4	52%	0.523	49%	0.488	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.4	-17.8	180	-55.5	173.6	0	0	0	111.2	L9 V14 N18	L9-I16 HydrophobicContact CD2-CD1 3.99Å; L9-I16 HydrophobicContact CD2-CG1 4.35Å; V14-I16 PolarHBondContact O-N 3.44Å; I16-N18 PolarHBondContact O-N 2.89Å; I16-N18 VanDerWaalsContact O-N 3.12Å
17	D	65.7	Low	71.8	Confident	154 Å²	154	84.4 Å²	84.4	82%	0.824	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.6	-16.3	-168.4	-54.2	-52.1	0	0	0	114.2	S15	S15-D17 VanDerWaalsContact C-N 3.26Å; S15-D17 PolarHBondContact OG-N 2.96Å; S15-D17 PolarHBondContact OG-OD2 3.26Å; S15-D17 VanDerWaalsContact OG-OD2 3.14Å
18	N	62.1	Low	72.3	Confident	122 Å²	122	82.1 Å²	82.1	65%	0.652	46%	0.464	S	S	*	.	S	Bend	trans	-143.1	84.1	174.4	-172	14	0	0	0	109.4	I16 D20 K23	I16-N18 PolarHBondContact O-N 2.89Å; I16-N18 VanDerWaalsContact O-N 3.12Å; N18-D20 PolarHBondContact O-N 3.32Å; N18-K23 VanDerWaalsContact O-CD 3.26Å; N18-K23 WeakPolarHBondContact O-CD 3.41Å; N18-K23 WeakPolarHBondContact O-CE 3.24Å; N18-K23 PolarHBondContact O-NZ 2.88Å
19	M	65.9	Low	72.9	Confident	98 Å²	98	85.1 Å²	85.1	48%	0.483	48%	0.475	S	S	.	.			trans	-81.4	102.8	177.1	-72.9	-167	-46	0	0	110.3	I24 L27	M19-I24 HydrophobicContact CB-CG1 4.15Å; M19-I24 HydrophobicContact CE-CG1 4.45Å; M19-I24 HydrophobicContact SD-CG1 4.24Å; M19-L27 HydrophobicContact SD-CD1 3.83Å
20	D	77.2	Confident	73.5	Confident	77 Å²	77	84 Å²	84	41%	0.412	47%	0.47	S	S	.	.			trans	-81.8	172.6	158.1	64.8	20.5	0	0	0	110.7	N18 N22 K23 I24	N18-D20 PolarHBondContact O-N 3.32Å; D20-N22 PolarHBondContact O-N 3.48Å; D20-N22 WeakPolarHBondContact OD1-CB 3.44Å; D20-N22 PolarHBondContact OD1-N 2.82Å; D20-K23 PolarHBondContact O-N 3.47Å; D20-K23 WeakPolarHBondContact OD1-CG 3.31Å; D20-K23 PolarHBondContact OD1-N 2.98Å; D20-I24 PolarHBondContact O-N 3.32Å; D20-I24 VanDerWaalsContact O-N 3.12Å
21	N	76.2	Confident	74	Confident	136 Å²	136	82.1 Å²	82.1	73%	0.727	46%	0.46	S	S	*	.	H	α-helix	trans	-58.2	-31.2	-179.4	-69.7	-15.5	0	0	0	113.1	C25	N21-C25 WeakPolarHBondContact O-CB 3.31Å; N21-C25 PolarHBondContact O-N 3.01Å; N21-C25 VanDerWaalsContact O-N 3.07Å
22	N	73	Confident	74.7	Confident	120 Å²	120	80.8 Å²	80.8	64%	0.642	45%	0.448	S	S	*	.	H	α-helix	trans	-68.7	-43.1	179.4	-69.8	-20.8	0	0	0	110.7	D20 C25 L26	D20-N22 PolarHBondContact O-N 3.48Å; D20-N22 WeakPolarHBondContact OD1-CB 3.44Å; D20-N22 PolarHBondContact OD1-N 2.82Å; N22-C25 WeakPolarHBondContact O-CB 3.42Å; N22-C25 PolarHBondContact O-N 3.34Å; N22-L26 WeakPolarHBondContact O-CG 3.39Å; N22-L26 PolarHBondContact O-N 3.3Å
23	K	72.1	Confident	75.5	Confident	49 Å²	49	81 Å²	81	21%	0.213	45%	0.449	C	S	.	.	H	α-helix	trans	-66	-39	175.9	-72.6	179.7	179.6	-177.6	0	112.6	V14 S15 N18 D20 C25 L26 L27	V14-K23 HydrophobicContact CG1-CB 4.29Å; V14-K23 HydrophobicContact CG1-CD 4.22Å; V14-K23 HydrophobicContact CG1-CG 4.18Å; S15-K23 PolarHBondContact O-NZ 3.43Å; N18-K23 VanDerWaalsContact O-CD 3.26Å; N18-K23 WeakPolarHBondContact O-CD 3.41Å; N18-K23 WeakPolarHBondContact O-CE 3.24Å; N18-K23 PolarHBondContact O-NZ 2.88Å; D20-K23 PolarHBondContact O-N 3.47Å; D20-K23 WeakPolarHBondContact OD1-CG 3.31Å; D20-K23 PolarHBondContact OD1-N 2.98Å; K23-C25 VanDerWaalsContact C-N 3.3Å; K23-C25 PolarHBondContact O-N 2.93Å; K23-L26 PolarHBondContact O-N 2.91Å; K23-L27 VanDerWaalsContact O-CG 3.31Å; K23-L27 WeakPolarHBondContact O-CG 3.48Å; K23-L27 PolarHBondContact O-N 3.27Å
24	I	78.2	Confident	76.4	Confident	74 Å²	74	76.3 Å²	76.3	38%	0.379	42%	0.416	S	S	.	.	H	α-helix	trans	-58.6	-46.9	174.4	-65	171.1	0	0	0	109.9	M19 D20 L26 L27 S28	M19-I24 HydrophobicContact CB-CG1 4.15Å; M19-I24 HydrophobicContact CE-CG1 4.45Å; M19-I24 HydrophobicContact SD-CG1 4.24Å; D20-I24 PolarHBondContact O-N 3.32Å; D20-I24 VanDerWaalsContact O-N 3.12Å; I24-L26 VanDerWaalsContact C-N 3.35Å; I24-L26 PolarHBondContact O-N 2.83Å; I24-L27 PolarHBondContact O-N 2.92Å; I24-S28 PolarHBondContact O-N 3.28Å; I24-S28 PolarHBondContact O-OG 3.4Å
25	C	78.2	Confident	77.5	Confident	85 Å²	85	81 Å²	81	57%	0.574	44%	0.437	S	S	*	.	H	α-helix	trans	-59.3	-44.1	176.3	-174.3	0	0	0	0	112.1	N21 N22 K23 S28 L29	N21-C25 WeakPolarHBondContact O-CB 3.31Å; N21-C25 PolarHBondContact O-N 3.01Å; N21-C25 VanDerWaalsContact O-N 3.07Å; N22-C25 WeakPolarHBondContact O-CB 3.42Å; N22-C25 PolarHBondContact O-N 3.34Å; K23-C25 VanDerWaalsContact C-N 3.3Å; K23-C25 PolarHBondContact O-N 2.93Å; C25-S28 PolarHBondContact O-N 3.43Å; C25-L29 WeakPolarHBondContact O-CB 3.22Å; C25-L29 PolarHBondContact O-N 2.94Å
26	L	80	Confident	78.6	Confident	74 Å²	74	83.2 Å²	83.2	39%	0.387	44%	0.443	S	S	.	.	H	α-helix	trans	-63.3	-41.6	177	-71.7	172.8	0	0	0	112.4	N22 K23 I24 L29 V30	N22-L26 WeakPolarHBondContact O-CG 3.39Å; N22-L26 PolarHBondContact O-N 3.3Å; K23-L26 PolarHBondContact O-N 2.91Å; I24-L26 VanDerWaalsContact C-N 3.35Å; I24-L26 PolarHBondContact O-N 2.83Å; L26-L29 WeakPolarHBondContact O-CB 3.31Å; L26-L29 PolarHBondContact O-N 2.98Å; L26-V30 VanDerWaalsContact O-CG2 3.27Å; L26-V30 WeakPolarHBondContact O-CG2 3.42Å; L26-V30 PolarHBondContact O-N 3.3Å
27	L	80.9	Confident	79.7	Confident	31 Å²	31	81 Å²	81	16%	0.162	44%	0.437	C	S	.	.	H	α-helix	trans	-62.3	-44.4	176.1	-71.4	172.5	0	0	0	111.6	L9 V14 M19 K23 I24 L29 V30 D31	L9-L27 HydrophobicContact CD1-CD2 3.33Å; L9-L27 HydrophobicContact CG-CD2 4.11Å; V14-L27 HydrophobicContact CG1-CD2 4.28Å; V14-L27 HydrophobicContact CG1-CG 4.42Å; M19-L27 HydrophobicContact SD-CD1 3.83Å; K23-L27 VanDerWaalsContact O-CG 3.31Å; K23-L27 WeakPolarHBondContact O-CG 3.48Å; K23-L27 PolarHBondContact O-N 3.27Å; I24-L27 PolarHBondContact O-N 2.92Å; L27-L29 VanDerWaalsContact C-N 3.31Å; L27-L29 PolarHBondContact O-N 2.97Å; L27-V30 PolarHBondContact O-N 3.34Å; L27-D31 PolarHBondContact O-N 3.48Å
28	S	84.4	Confident	80.7	Confident	61 Å²	61	74.8 Å²	74.8	43%	0.427	41%	0.405	S	S	.	.	H	α-helix	trans	-62.8	-38.2	174.7	-61.5	0	0	0	0	112.2	I24 C25 D31 N32	I24-S28 PolarHBondContact O-N 3.28Å; I24-S28 PolarHBondContact O-OG 3.4Å; C25-S28 PolarHBondContact O-N 3.43Å; S28-D31 PolarHBondContact O-N 3.22Å; S28-N32 PolarHBondContact O-N 3.25Å; S28-N32 PolarHBondContact O-ND2 2.96Å
29	L	84.5	Confident	81.9	Confident	93 Å²	93	71.7 Å²	71.7	49%	0.487	39%	0.393	S	S	.	.	H	α-helix	trans	-63.8	-44.5	175.4	-178.9	63.1	0	0	0	111.6	C25 L26 L27 D31 N32 I33	C25-L29 WeakPolarHBondContact O-CB 3.22Å; C25-L29 PolarHBondContact O-N 2.94Å; L26-L29 WeakPolarHBondContact O-CB 3.31Å; L26-L29 PolarHBondContact O-N 2.98Å; L27-L29 VanDerWaalsContact C-N 3.31Å; L27-L29 PolarHBondContact O-N 2.97Å; L29-D31 VanDerWaalsContact C-N 3.31Å; L29-D31 PolarHBondContact O-N 2.91Å; L29-N32 PolarHBondContact O-N 3.44Å; L29-I33 HydrophobicContact CD1-CD1 4.24Å; L29-I33 HydrophobicContact CD1-CG1 4.47Å; L29-I33 HydrophobicContact CG-CD1 3.95Å; L29-I33 VanDerWaalsContact O-CG1 3.31Å; L29-I33 WeakPolarHBondContact O-CG1 3.46Å; L29-I33 PolarHBondContact O-N 3.36Å
30	V	85.2	Confident	82.7	Confident	9 Å²	9	72.1 Å²	72.1	6%	0.055	40%	0.397	C	S	.	.	H	α-helix	trans	-58.3	-45.6	175.2	171	0	0	0	0	110.9	A8 L12 L26 L27 N32 I33 V34	A8-V30 HydrophobicContact CB-CG1 3.58Å; L12-V30 HydrophobicContact CD1-CG2 3.09Å; L26-V30 VanDerWaalsContact O-CG2 3.27Å; L26-V30 WeakPolarHBondContact O-CG2 3.42Å; L26-V30 PolarHBondContact O-N 3.3Å; L27-V30 PolarHBondContact O-N 3.34Å; V30-N32 PolarHBondContact O-N 3.06Å; V30-I33 PolarHBondContact O-N 2.95Å; V30-V34 HydrophobicContact CG1-CG2 4.25Å; V30-V34 WeakPolarHBondContact O-CB 3.39Å; V30-V34 VanDerWaalsContact O-CG2 3.27Å; V30-V34 WeakPolarHBondContact O-CG2 3.44Å; V30-V34 PolarHBondContact O-N 3.38Å
31	D	87.1	Confident	83.1	Confident	61 Å²	61	73.1 Å²	73.1	33%	0.326	40%	0.402	S	S	.	.	H	α-helix	trans	-60.2	-45.8	179.4	-79.2	-19.7	0	0	0	111.6	K5 L27 S28 L29 I33 V34 E35	K5-D31 WeakPolarHBondContact CD-OD1 3.46Å; K5-D31 WeakPolarHBondContact CE-OD1 3.46Å; K5-D31 IonicContact NZ-OD1 2.66Å; K5-D31 PolarHBondContact NZ-OD1 3.19Å; K5-D31 IonicContact NZ-OD2 2.87Å; K5-D31 PolarHBondContact NZ-OD2 3.46Å; L27-D31 PolarHBondContact O-N 3.48Å; S28-D31 PolarHBondContact O-N 3.22Å; L29-D31 VanDerWaalsContact C-N 3.31Å; L29-D31 PolarHBondContact O-N 2.91Å; D31-I33 PolarHBondContact O-N 2.72Å; D31-V34 PolarHBondContact O-N 3.32Å; D31-E35 WeakPolarHBondContact O-CB 3.49Å; D31-E35 PolarHBondContact O-N 2.94Å
32	N	86.7	Confident	83.3	Confident	85 Å²	85	72.7 Å²	72.7	46%	0.455	40%	0.395	S	S	.	.	H	α-helix	trans	-61.9	-42.3	175.6	-72.3	-45.4	0	0	0	112.3	S28 L29 V30 V34 E35 I36	S28-N32 PolarHBondContact O-N 3.25Å; S28-N32 PolarHBondContact O-ND2 2.96Å; L29-N32 PolarHBondContact O-N 3.44Å; V30-N32 PolarHBondContact O-N 3.06Å; N32-V34 PolarHBondContact O-N 3.33Å; N32-E35 PolarHBondContact O-N 2.92Å; N32-I36 WeakPolarHBondContact O-CB 3.3Å; N32-I36 VanDerWaalsContact O-CG1 3.27Å; N32-I36 WeakPolarHBondContact O-CG1 3.45Å; N32-I36 PolarHBondContact O-N 2.74Å
33	I	87.5	Confident	83.5	Confident	91 Å²	91	72.5 Å²	72.5	47%	0.467	39%	0.394	S	S	.	.	H	α-helix	trans	-63.3	-43.5	178.3	-70.8	167.4	0	0	0	110.7	L29 V30 D31 E35 S37	L29-I33 HydrophobicContact CD1-CD1 4.24Å; L29-I33 HydrophobicContact CD1-CG1 4.47Å; L29-I33 HydrophobicContact CG-CD1 3.95Å; L29-I33 VanDerWaalsContact O-CG1 3.31Å; L29-I33 WeakPolarHBondContact O-CG1 3.46Å; L29-I33 PolarHBondContact O-N 3.36Å; V30-I33 PolarHBondContact O-N 2.95Å; D31-I33 PolarHBondContact O-N 2.72Å; I33-E35 VanDerWaalsContact C-N 3.35Å; I33-S37 VanDerWaalsContact O-CB 3.3Å; I33-S37 WeakPolarHBondContact O-CB 3.27Å; I33-S37 PolarHBondContact O-N 2.93Å; I33-S37 PolarHBondContact O-OG 3.5Å
34	V	86.2	Confident	83.8	Confident	8 Å²	8	74 Å²	74	5%	0.048	40%	0.404	C	S	.	.	H	α-helix	trans	-65.9	-39.8	179.4	170.7	0	0	0	0	111	M1 L4 K5 V30 D31 N32 S38	M1-V34 HydrophobicContact CG-CG1 3.71Å; L4-V34 HydrophobicContact CB-CG1 4.04Å; L4-V34 HydrophobicContact CB-CG2 4.35Å; K5-V34 HydrophobicContact CB-CG2 4.46Å; V30-V34 HydrophobicContact CG1-CG2 4.25Å; V30-V34 WeakPolarHBondContact O-CB 3.39Å; V30-V34 VanDerWaalsContact O-CG2 3.27Å; V30-V34 WeakPolarHBondContact O-CG2 3.44Å; V30-V34 PolarHBondContact O-N 3.38Å; D31-V34 PolarHBondContact O-N 3.32Å; N32-V34 PolarHBondContact O-N 3.33Å; V34-S38 WeakPolarHBondContact O-CB 3.46Å; V34-S38 PolarHBondContact O-N 3.3Å; V34-S38 PolarHBondContact O-OG 2.95Å
35	E	87.7	Confident	83.7	Confident	116 Å²	116	74.5 Å²	74.5	54%	0.542	41%	0.408	S	S	.	.	H	α-helix	trans	-62.5	-53.1	175.4	-174.8	174.7	-175.5	0	0	111.2	D31 N32 I33 S37 S38 S39	D31-E35 WeakPolarHBondContact O-CB 3.49Å; D31-E35 PolarHBondContact O-N 2.94Å; N32-E35 PolarHBondContact O-N 2.92Å; I33-E35 VanDerWaalsContact C-N 3.35Å; E35-S37 VanDerWaalsContact C-N 3.3Å; E35-S37 PolarHBondContact O-N 2.91Å; E35-S38 WeakPolarHBondContact O-CB 3.39Å; E35-S38 PolarHBondContact O-N 3.32Å; E35-S39 PolarHBondContact O-N 3.24Å; E35-S39 PolarHBondContact O-OG 2.91Å
36	I	87.3	Confident	83.5	Confident	102 Å²	102	75.2 Å²	75.2	52%	0.523	41%	0.409	S	S	.	.	H	α-helix	trans	-56.2	-46.7	177.8	-69.6	166.3	0	0	0	110.8	N32 S38 S39 L40	N32-I36 WeakPolarHBondContact O-CB 3.3Å; N32-I36 VanDerWaalsContact O-CG1 3.27Å; N32-I36 WeakPolarHBondContact O-CG1 3.45Å; N32-I36 PolarHBondContact O-N 2.74Å; I36-S38 VanDerWaalsContact C-N 3.27Å; I36-S38 PolarHBondContact O-N 3.05Å; I36-S39 PolarHBondContact O-N 2.99Å; I36-L40 HydrophobicContact CG2-CD1 3.89Å; I36-L40 HydrophobicContact CG2-CG 4.34Å; I36-L40 WeakPolarHBondContact O-CB 3.48Å; I36-L40 VanDerWaalsContact O-CG 3.31Å; I36-L40 WeakPolarHBondContact O-CG 3.47Å; I36-L40 PolarHBondContact O-N 2.91Å
37	S	87.5	Confident	83	Confident	55 Å²	55	74.2 Å²	74.2	39%	0.385	41%	0.411	S	S	.	.	H	α-helix	trans	-62.1	-37.3	179.8	-57.9	0	0	0	0	111.8	I33 E35 L41	I33-S37 VanDerWaalsContact O-CB 3.3Å; I33-S37 WeakPolarHBondContact O-CB 3.27Å; I33-S37 PolarHBondContact O-N 2.93Å; I33-S37 PolarHBondContact O-OG 3.5Å; E35-S37 VanDerWaalsContact C-N 3.3Å; E35-S37 PolarHBondContact O-N 2.91Å; S37-L41 WeakPolarHBondContact O-CB 3.27Å; S37-L41 PolarHBondContact O-N 3.46Å
38	S	87.1	Confident	82.4	Confident	24 Å²	24	77 Å²	77	17%	0.168	42%	0.423	C	S	.	.	H	α-helix	trans	-69	-45.5	177.5	-57.6	0	0	0	0	111.1	V34 E35 I36 L40 L41 E42	V34-S38 WeakPolarHBondContact O-CB 3.46Å; V34-S38 PolarHBondContact O-N 3.3Å; V34-S38 PolarHBondContact O-OG 2.95Å; E35-S38 WeakPolarHBondContact O-CB 3.39Å; E35-S38 PolarHBondContact O-N 3.32Å; I36-S38 VanDerWaalsContact C-N 3.27Å; I36-S38 PolarHBondContact O-N 3.05Å; S38-L40 VanDerWaalsContact C-N 3.35Å; S38-L40 PolarHBondContact O-N 3.32Å; S38-L41 WeakPolarHBondContact O-CB 3.49Å; S38-L41 PolarHBondContact O-N 3.46Å; S38-E42 WeakPolarHBondContact O-CG 3.31Å; S38-E42 PolarHBondContact O-N 3.45Å
39	S	87.4	Confident	81.7	Confident	56 Å²	56	81 Å²	81	39%	0.392	43%	0.433	S	S	.	.	H	α-helix	trans	-62	-40.8	176.5	-57.6	0	0	0	0	112.3	E35 I36 L41 E42 L43	E35-S39 PolarHBondContact O-N 3.24Å; E35-S39 PolarHBondContact O-OG 2.91Å; I36-S39 PolarHBondContact O-N 2.99Å; S39-L41 VanDerWaalsContact C-N 3.33Å; S39-L41 PolarHBondContact O-N 3Å; S39-E42 PolarHBondContact O-N 3.45Å; S39-L43 VanDerWaalsContact O-CG 3.31Å; S39-L43 WeakPolarHBondContact O-CG 3.45Å; S39-L43 PolarHBondContact O-N 2.98Å
40	L	83.2	Confident	81	Confident	108 Å²	108	80.1 Å²	80.1	57%	0.565	44%	0.435	S	S	*	.	H	α-helix	trans	-63	-39.8	175	-72.9	173.5	0	0	0	112	I36 S38 L43 N44	I36-L40 HydrophobicContact CG2-CD1 3.89Å; I36-L40 HydrophobicContact CG2-CG 4.34Å; I36-L40 WeakPolarHBondContact O-CB 3.48Å; I36-L40 VanDerWaalsContact O-CG 3.31Å; I36-L40 WeakPolarHBondContact O-CG 3.47Å; I36-L40 PolarHBondContact O-N 2.91Å; S38-L40 VanDerWaalsContact C-N 3.35Å; S38-L40 PolarHBondContact O-N 3.32Å; L40-L43 PolarHBondContact O-N 3.23Å; L40-N44 WeakPolarHBondContact O-CB 3.48Å; L40-N44 PolarHBondContact O-N 3.26Å
41	L	83.8	Confident	80.1	Confident	98 Å²	98	85.2 Å²	85.2	51%	0.513	46%	0.461	S	S	.	.	H	α-helix	trans	-65	-41.8	176.2	-175.4	65.8	0	0	0	111.7	S37 S38 S39 N44 N45	S37-L41 WeakPolarHBondContact O-CB 3.27Å; S37-L41 PolarHBondContact O-N 3.46Å; S38-L41 WeakPolarHBondContact O-CB 3.49Å; S38-L41 PolarHBondContact O-N 3.46Å; S39-L41 VanDerWaalsContact C-N 3.33Å; S39-L41 PolarHBondContact O-N 3Å; L41-N44 PolarHBondContact O-N 2.96Å; L41-N45 PolarHBondContact O-N 3.35Å; L41-N45 PolarHBondContact O-ND2 3.05Å
42	E	81.8	Confident	79.1	Confident	127 Å²	127	89.4 Å²	89.4	59%	0.593	48%	0.478	S	S	*	.	H	α-helix	trans	-63	-45.2	175.7	-72.8	177.1	-177.1	0	0	111.9	S38 S39 N44 N45 V46	S38-E42 WeakPolarHBondContact O-CG 3.31Å; S38-E42 PolarHBondContact O-N 3.45Å; S39-E42 PolarHBondContact O-N 3.45Å; E42-N44 VanDerWaalsContact C-N 3.31Å; E42-N44 PolarHBondContact O-N 3.44Å; E42-N45 PolarHBondContact O-N 3.32Å; E42-V46 WeakPolarHBondContact O-CG2 3.36Å; E42-V46 PolarHBondContact O-N 3.38Å
43	L	76.9	Confident	78.2	Confident	116 Å²	116	91.1 Å²	91.1	61%	0.607	49%	0.487	S	S	*	.	H	α-helix	trans	-59.7	-42.7	174.7	-72.8	171.3	0	0	0	111.7	S39 L40 V46 A47	S39-L43 VanDerWaalsContact O-CG 3.31Å; S39-L43 WeakPolarHBondContact O-CG 3.45Å; S39-L43 PolarHBondContact O-N 2.98Å; L40-L43 PolarHBondContact O-N 3.23Å; L43-V46 PolarHBondContact O-N 3.04Å; L43-A47 WeakPolarHBondContact O-CB 3.27Å; L43-A47 PolarHBondContact O-N 3.23Å
44	N	77.8	Confident	77.3	Confident	79 Å²	79	94.3 Å²	94.3	42%	0.422	49%	0.494	S	S	.	.	H	α-helix	trans	-63.7	-42.1	176.6	-173.1	40.9	0	0	0	111.7	L40 L41 E42 V46 A47 Q48	L40-N44 WeakPolarHBondContact O-CB 3.48Å; L40-N44 PolarHBondContact O-N 3.26Å; L41-N44 PolarHBondContact O-N 2.96Å; E42-N44 VanDerWaalsContact C-N 3.31Å; E42-N44 PolarHBondContact O-N 3.44Å; N44-V46 VanDerWaalsContact C-N 3.3Å; N44-V46 PolarHBondContact O-N 3.23Å; N44-A47 PolarHBondContact O-N 3.46Å; N44-Q48 WeakPolarHBondContact O-CB 3.42Å; N44-Q48 WeakPolarHBondContact O-CG 2.94Å; N44-Q48 PolarHBondContact O-N 3.27Å
45	N	75.8	Confident	76.7	Confident	86 Å²	86	97 Å²	97	46%	0.46	51%	0.508	S	S	.	.	H	α-helix	trans	-62.1	-38.6	176.4	-71	-22.5	0	0	0	111.9	L41 E42 K49	L41-N45 PolarHBondContact O-N 3.35Å; L41-N45 PolarHBondContact O-ND2 3.05Å; E42-N45 PolarHBondContact O-N 3.32Å; N45-K49 VanDerWaalsContact O-CB 3.22Å; N45-K49 WeakPolarHBondContact O-CB 3.18Å; N45-K49 PolarHBondContact O-N 3.45Å
46	V	75.2	Confident	75.8	Confident	100 Å²	100	95.1 Å²	95.1	61%	0.606	51%	0.506	S	S	*	.	H	α-helix	trans	-66.7	-45.9	175.2	173.6	0	0	0	0	111	E42 L43 N44 K49 S50	E42-V46 WeakPolarHBondContact O-CG2 3.36Å; E42-V46 PolarHBondContact O-N 3.38Å; L43-V46 PolarHBondContact O-N 3.04Å; N44-V46 VanDerWaalsContact C-N 3.3Å; N44-V46 PolarHBondContact O-N 3.23Å; V46-K49 PolarHBondContact O-N 3.07Å; V46-S50 PolarHBondContact O-N 3.45Å; V46-S50 PolarHBondContact O-OG 3.01Å
47	A	69	Low	75.1	Confident	52 Å²	52	95.9 Å²	95.9	43%	0.43	51%	0.511	S	S	.	.	H	α-helix	trans	-64.9	-40.3	179.1	0	0	0	0	0	112.5	L43 N44 S50 L51	L43-A47 WeakPolarHBondContact O-CB 3.27Å; L43-A47 PolarHBondContact O-N 3.23Å; N44-A47 PolarHBondContact O-N 3.46Å; A47-S50 WeakPolarHBondContact CA-OG 3.45Å; A47-S50 PolarHBondContact O-N 2.88Å; A47-S50 PolarHBondContact O-OG 2.87Å; A47-L51 VanDerWaalsContact O-CB 3.31Å; A47-L51 WeakPolarHBondContact O-CB 3.35Å; A47-L51 PolarHBondContact O-N 2.66Å
48	Q	67.4	Low	74	Confident	90 Å²	90	102 Å²	102	42%	0.421	53%	0.525	S	S	.	.	H	α-helix	trans	-66.3	-43.8	174	-75.8	-171.5	-23	0	0	111.1	N44 S50 L51 H52	N44-Q48 WeakPolarHBondContact O-CB 3.42Å; N44-Q48 WeakPolarHBondContact O-CG 2.94Å; N44-Q48 PolarHBondContact O-N 3.27Å; Q48-S50 VanDerWaalsContact C-N 3.32Å; Q48-S50 PolarHBondContact O-N 2.95Å; Q48-L51 PolarHBondContact O-N 2.9Å; Q48-H52 WeakPolarHBondContact O-CB 3.39Å; Q48-H52 PolarHBondContact O-CD2 3.38Å; Q48-H52 PolarHBondContact O-N 3.16Å
49	K	71.2	Confident	72.8	Confident	146 Å²	146	101.4 Å²	101.4	64%	0.635	52%	0.523	S	S	*	.	H	α-helix	trans	-62.4	-39.9	177.4	-172.8	176.8	-178.7	-179.3	0	111.9	N45 V46 N53	N45-K49 VanDerWaalsContact O-CB 3.22Å; N45-K49 WeakPolarHBondContact O-CB 3.18Å; N45-K49 PolarHBondContact O-N 3.45Å; V46-K49 PolarHBondContact O-N 3.07Å; K49-N53 VanDerWaalsContact O-CB 3.24Å; K49-N53 WeakPolarHBondContact O-CB 3.35Å; K49-N53 PolarHBondContact O-N 3.38Å; K49-N53 PolarHBondContact O-ND2 3.09Å
50	S	70.2	Confident	71.6	Confident	74 Å²	74	101.7 Å²	101.7	52%	0.517	52%	0.524	S	S	.	.	H	α-helix	trans	-68.4	-38.3	176.1	64.9	0	0	0	0	112	V46 A47 Q48 N53 W54	V46-S50 PolarHBondContact O-N 3.45Å; V46-S50 PolarHBondContact O-OG 3.01Å; A47-S50 WeakPolarHBondContact CA-OG 3.45Å; A47-S50 PolarHBondContact O-N 2.88Å; A47-S50 PolarHBondContact O-OG 2.87Å; Q48-S50 VanDerWaalsContact C-N 3.32Å; Q48-S50 PolarHBondContact O-N 2.95Å; S50-N53 CarbonylContact O-C 3.46Å; S50-N53 PolarHBondContact O-N 3.26Å; S50-W54 WeakPolarHBondContact O-CB 3.49Å; S50-W54 PolarHBondContact O-N 3.28Å
51	L	65.9	Low	70.6	Confident	116 Å²	116	101.6 Å²	101.6	61%	0.607	52%	0.523	S	S	*	.	H	α-helix	trans	-67.2	-43.1	175.9	-170.4	71.6	0	0	0	112.3	A47 Q48 N53 W54	A47-L51 VanDerWaalsContact O-CB 3.31Å; A47-L51 WeakPolarHBondContact O-CB 3.35Å; A47-L51 PolarHBondContact O-N 2.66Å; Q48-L51 PolarHBondContact O-N 2.9Å; L51-N53 VanDerWaalsContact C-N 3.3Å; L51-N53 PolarHBondContact O-N 3.03Å; L51-W54 WeakPolarHBondContact O-CB 3.49Å; L51-W54 PolarHBondContact O-N 2.99Å; L51-W54 VanDerWaalsContact O-N 3.15Å
52	H	65.9	Low	69.3	Low	149 Å²	149	103 Å²	103	69%	0.69	53%	0.53	S	S	*	.	H	α-helix	trans	-69.4	-29.1	176.9	-71.1	-56.1	0	0	0	112.7	Q48 W54	Q48-H52 WeakPolarHBondContact O-CB 3.39Å; Q48-H52 PolarHBondContact O-CD2 3.38Å; Q48-H52 PolarHBondContact O-N 3.16Å; H52-W54 VanDerWaalsContact C-N 3.32Å
53	N	68.4	Low	68.3	Low	120 Å²	120	103 Å²	103	64%	0.642	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90	3.4	172.8	-67.5	-19.5	0	0	0	113	K49 S50 L51 D55	K49-N53 VanDerWaalsContact O-CB 3.24Å; K49-N53 WeakPolarHBondContact O-CB 3.35Å; K49-N53 PolarHBondContact O-N 3.38Å; K49-N53 PolarHBondContact O-ND2 3.09Å; S50-N53 CarbonylContact O-C 3.46Å; S50-N53 PolarHBondContact O-N 3.26Å; L51-N53 VanDerWaalsContact C-N 3.3Å; L51-N53 PolarHBondContact O-N 3.03Å; N53-D55 PolarHBondContact O-N 2.71Å; N53-D55 VanDerWaalsContact O-N 3.16Å
54	W	68.2	Low	67.5	Low	158 Å²	158	104.8 Å²	104.8	60%	0.598	54%	0.539	S	S	*	.			trans	-70.5	114.1	178.7	-178.3	61.3	0	0	0	108.7	S50 L51 H52 P56	S50-W54 WeakPolarHBondContact O-CB 3.49Å; S50-W54 PolarHBondContact O-N 3.28Å; L51-W54 WeakPolarHBondContact O-CB 3.49Å; L51-W54 PolarHBondContact O-N 2.99Å; L51-W54 VanDerWaalsContact O-N 3.15Å; H52-W54 VanDerWaalsContact C-N 3.32Å; W54-P56 HydrophobicContact CH2-CB 4.36Å; W54-P56 HydrophobicContact CZ3-CB 4.26Å; W54-P56 VanDerWaalsContact O-CD 3.29Å; W54-P56 WeakPolarHBondContact O-CD 3.31Å
55	D	72.3	Confident	66.9	Low	64 Å²	64	106.2 Å²	106.2	34%	0.342	55%	0.554	S	S	.	*			trans	-82.7	111	172.8	-179.4	-6.7	0	0	0	108.6	N53 N57 R58 G59	N53-D55 PolarHBondContact O-N 2.71Å; N53-D55 VanDerWaalsContact O-N 3.16Å; D55-N57 PolarHBondContact O-N 3.22Å; D55-N57 VanDerWaalsContact O-N 3.17Å; D55-N57 VanDerWaalsContact OD1-CB 3.29Å; D55-N57 WeakPolarHBondContact OD1-CB 3.43Å; D55-N57 PolarHBondContact OD1-N 3.19Å; D55-N57 PolarHBondContact OD1-ND2 2.92Å; D55-R58 HydrophobicContact CB-CB 4.22Å; D55-R58 HydrophobicContact CB-CG 3.97Å; D55-R58 WeakPolarHBondContact O-CB 3.43Å; D55-R58 PolarHBondContact O-N 3.17Å; D55-G59 PolarHBondContact O-N 3.2Å
56	P	69.4	Low	65.9	Low	77 Å²	77	111.5 Å²	111.5	50%	0.5	58%	0.581	S	S	.	*	H	α-helix	trans	-60.7	-25.6	-179.9	23.3	-32.1	0	0	0	112.6	W54 R58 G59 C60	W54-P56 HydrophobicContact CH2-CB 4.36Å; W54-P56 HydrophobicContact CZ3-CB 4.26Å; W54-P56 VanDerWaalsContact O-CD 3.29Å; W54-P56 WeakPolarHBondContact O-CD 3.31Å; P56-R58 VanDerWaalsContact C-N 3.34Å; P56-G59 PolarHBondContact O-N 3.18Å; P56-C60 PolarHBondContact O-N 3.41Å
57	N	73.2	Confident	65.4	Low	118 Å²	118	112.1 Å²	112.1	63%	0.631	58%	0.58	S	S	*	*	H	α-helix	trans	-68.3	-34.9	175.2	-62.2	-43.9	0	0	0	111.6	D55 G59 C60 I61	D55-N57 PolarHBondContact O-N 3.22Å; D55-N57 VanDerWaalsContact O-N 3.17Å; D55-N57 VanDerWaalsContact OD1-CB 3.29Å; D55-N57 WeakPolarHBondContact OD1-CB 3.43Å; D55-N57 PolarHBondContact OD1-N 3.19Å; D55-N57 PolarHBondContact OD1-ND2 2.92Å; N57-G59 VanDerWaalsContact C-N 3.35Å; N57-C60 WeakPolarHBondContact O-CB 3.26Å; N57-C60 PolarHBondContact O-N 2.97Å; N57-I61 PolarHBondContact O-N 2.99Å
58	R	65	Low	65.2	Low	184 Å²	184	115.2 Å²	115.2	69%	0.694	59%	0.588	S	S	*	*	H	α-helix	trans	-69	-34.5	171.9	-68.3	-176.1	178.6	-160.4	-3	111.9	D55 P56 C60 I61 L62	D55-R58 HydrophobicContact CB-CB 4.22Å; D55-R58 HydrophobicContact CB-CG 3.97Å; D55-R58 WeakPolarHBondContact O-CB 3.43Å; D55-R58 PolarHBondContact O-N 3.17Å; P56-R58 VanDerWaalsContact C-N 3.34Å; R58-C60 VanDerWaalsContact C-N 3.28Å; R58-C60 PolarHBondContact O-N 2.88Å; R58-I61 PolarHBondContact O-N 3.12Å; R58-L62 PolarHBondContact O-N 2.98Å
59	G	61.3	Low	65.1	Low	11 Å²	11	116.6 Å²	116.6	11%	0.113	60%	0.597	C	S	.	*	H	α-helix	trans	-60.9	-38.3	171.7	0	0	0	0	0	112.5	D55 P56 N57 L62 L63	D55-G59 PolarHBondContact O-N 3.2Å; P56-G59 PolarHBondContact O-N 3.18Å; N57-G59 VanDerWaalsContact C-N 3.35Å; G59-L62 PolarHBondContact O-N 3.42Å; G59-L63 PolarHBondContact O-N 2.86Å
60	C	60.7	Low	64.8	Low	63 Å²	63	114.9 Å²	114.9	43%	0.426	60%	0.595	S	S	.	*	H	α-helix	trans	-64.9	-39.6	178.3	-144.6	0	0	0	0	112.4	P56 N57 R58 L62 L63 Q64	P56-C60 PolarHBondContact O-N 3.41Å; N57-C60 WeakPolarHBondContact O-CB 3.26Å; N57-C60 PolarHBondContact O-N 2.97Å; R58-C60 VanDerWaalsContact C-N 3.28Å; R58-C60 PolarHBondContact O-N 2.88Å; C60-L62 VanDerWaalsContact C-N 3.33Å; C60-L62 PolarHBondContact O-N 3.17Å; C60-L63 PolarHBondContact O-N 3.11Å; C60-Q64 WeakPolarHBondContact O-CG 3.5Å; C60-Q64 PolarHBondContact O-N 3.36Å
61	I	62.9	Low	64.4	Low	105 Å²	105	117.4 Å²	117.4	54%	0.538	60%	0.6	S	S	.	*	H	α-helix	trans	-60.3	-43.1	176.8	-64.1	171.5	0	0	0	111	N57 R58 L63 Q64 C65	N57-I61 PolarHBondContact O-N 2.99Å; R58-I61 PolarHBondContact O-N 3.12Å; I61-L63 VanDerWaalsContact C-N 3.35Å; I61-L63 PolarHBondContact O-N 3.29Å; I61-Q64 PolarHBondContact O-N 3.12Å; I61-C65 PolarHBondContact O-N 3.37Å; I61-C65 PolarHBondContact O-SG 3.39Å; I61-C65 VanDerWaalsContact O-SG 3.36Å
62	L	57.7	Low	64.3	Low	127 Å²	127	117.5 Å²	117.5	67%	0.665	60%	0.6	S	S	*	*	H	α-helix	trans	-66.3	-36.4	179.1	-74.6	169.6	0	0	0	112.6	R58 G59 C60 L66	R58-L62 PolarHBondContact O-N 2.98Å; G59-L62 PolarHBondContact O-N 3.42Å; C60-L62 VanDerWaalsContact C-N 3.33Å; C60-L62 PolarHBondContact O-N 3.17Å; L62-L66 PolarHBondContact O-N 3.14Å
63	L	59.6	Low	64.2	Low	127 Å²	127	115.3 Å²	115.3	67%	0.665	59%	0.593	S	S	*	*	H	α-helix	trans	-75.2	-29	178	-77.9	173.5	0	0	0	113.5	G59 C60 I61 C65	G59-L63 PolarHBondContact O-N 2.86Å; C60-L63 PolarHBondContact O-N 3.11Å; I61-L63 VanDerWaalsContact C-N 3.35Å; I61-L63 PolarHBondContact O-N 3.29Å; L63-C65 VanDerWaalsContact C-N 3.32Å
64	Q	61.2	Low	63.9	Low	154 Å²	154	114.9 Å²	114.9	72%	0.72	59%	0.589	S	S	*	*	H	α-helix	trans	-77.7	-19.1	175.7	-72.6	178.5	-15.7	0	0	113.1	C60 I61	C60-Q64 WeakPolarHBondContact O-CG 3.5Å; C60-Q64 PolarHBondContact O-N 3.36Å; I61-Q64 PolarHBondContact O-N 3.12Å
65	C	65.4	Low	63.5	Low	109 Å²	109	111.3 Å²	111.3	74%	0.736	59%	0.589	S	S	*	*			trans	-91.8	-5.9	175.2	-65.9	0	0	0	0	114	I61 L63	I61-C65 PolarHBondContact O-N 3.37Å; I61-C65 PolarHBondContact O-SG 3.39Å; I61-C65 VanDerWaalsContact O-SG 3.36Å; L63-C65 VanDerWaalsContact C-N 3.32Å
66	L	53.7	Low	62.7	Low	197 Å²	197	115.6 Å²	115.6	100%	1.031	61%	0.611	S	S	*	*			trans	-96.1	0	171.6	-78.7	166.7	0	0	0	110.1	L62	L62-L66 PolarHBondContact O-N 3.14Å

Retrieved 66 of 66 residues in 63.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).