A0A5K4F382_SCHMA Loading...

DUF2508 family protein

AlphaFold DB , UniProt , Accession A0A5K4F382, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 93 aa.

						>A0A5K4F382_SCHMA|A0A5K4F382
MDSNIPESKNNQTAVEDTYQQMRKLCENYKLFSKLDNNSNDLDELYSTSLNLSYIRDDYETIKHELSVIKANRQIARDALLAAGFQCPDDPPT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.5	Very low	59.6	Low	233 Å²	233	129.1 Å²	129.1	100%	1.148	69%	0.692	S	S	*	*				0	85.5	0	-80.2	-176.5	170	0	0	106.2	S3	M1-S3 PolarHBondContact O-N 3.22Å
2	D	46.3	Very low	61.7	Low	155 Å²	155	130.1 Å²	130.1	83%	0.829	69%	0.69	S	S	*	*			trans	-78.6	99.3	169.5	-82.5	-34.2	0	0	0	107	N4	D2-N4 PolarHBondContact O-N 3.24Å
3	S	53.9	Low	63.7	Low	109 Å²	109	126.1 Å²	126.1	76%	0.762	67%	0.673	S	S	*	*			trans	-70.8	78.8	171.7	-63.8	0	0	0	0	108.2	M1 I5	M1-S3 PolarHBondContact O-N 3.22Å; S3-I5 VanDerWaalsContact C-N 3.29Å; S3-I5 PolarHBondContact O-N 2.85Å
4	N	57	Low	65.1	Low	145 Å²	145	120.6 Å²	120.6	78%	0.775	66%	0.655	S	S	*	*			trans	-59.8	97.9	161.4	-82.8	-32.6	0	0	0	106.8	D2 P6	D2-N4 PolarHBondContact O-N 3.24Å; N4-P6 VanDerWaalsContact O-CD 3.29Å; N4-P6 WeakPolarHBondContact O-CD 3.44Å; N4-P6 VanDerWaalsContact O-N 3.1Å
5	I	59.8	Low	66.7	Low	128 Å²	128	119.5 Å²	119.5	66%	0.656	65%	0.653	S	S	*	*			trans	-58.2	116.8	165.1	-60.7	176.4	0	0	0	104.7	S3 E7 K9	S3-I5 VanDerWaalsContact C-N 3.29Å; S3-I5 PolarHBondContact O-N 2.85Å; I5-E7 PolarHBondContact O-N 2.77Å; I5-K9 HydrophobicContact CG2-CB 4.07Å
6	P	55.4	Low	68.2	Low	66 Å²	66	118.2 Å²	118.2	43%	0.429	64%	0.641	S	S	.	*			trans	-62.5	130.6	-175.6	19.4	-24.1	0	0	0	107.8	N4 S8 K9	N4-P6 VanDerWaalsContact O-CD 3.29Å; N4-P6 WeakPolarHBondContact O-CD 3.44Å; N4-P6 VanDerWaalsContact O-N 3.1Å; P6-S8 PolarHBondContact O-N 3.05Å; P6-K9 HydrophobicContact CG-CB 4.49Å; P6-K9 HydrophobicContact CG-CD 4.32Å; P6-K9 HydrophobicContact CG-CG 4.31Å; P6-K9 WeakPolarHBondContact O-CB 3.29Å; P6-K9 PolarHBondContact O-N 2.9Å
7	E	62.1	Low	69.5	Low	159 Å²	159	116.6 Å²	116.6	74%	0.743	63%	0.632	S	S	*	*	H	α-helix	trans	-46.9	-29.6	-178.4	-147.3	170.9	-165.9	0	0	112.5	I5 N10 N11	I5-E7 PolarHBondContact O-N 2.77Å; E7-N10 PolarHBondContact O-N 2.91Å; E7-N11 PolarHBondContact O-N 3.27Å
8	S	64.4	Low	70.5	Confident	79 Å²	79	114.1 Å²	114.1	55%	0.552	62%	0.621	S	S	*	*	H	α-helix	trans	-61.1	-38.8	172.7	67	0	0	0	0	114.5	P6 N10 Q12	P6-S8 PolarHBondContact O-N 3.05Å; S8-N10 VanDerWaalsContact C-N 3.34Å; S8-Q12 WeakPolarHBondContact O-CB 3.32Å; S8-Q12 PolarHBondContact O-N 2.98Å
9	K	63.6	Low	71.6	Confident	129 Å²	129	115 Å²	115	56%	0.561	62%	0.615	S	S	*	*	H	α-helix	trans	-65.5	-39.3	174.9	-91	-173.5	175	-179.5	0	111.3	I5 P6 Q12 T13	I5-K9 HydrophobicContact CG2-CB 4.07Å; P6-K9 HydrophobicContact CG-CB 4.49Å; P6-K9 HydrophobicContact CG-CD 4.32Å; P6-K9 HydrophobicContact CG-CG 4.31Å; P6-K9 WeakPolarHBondContact O-CB 3.29Å; P6-K9 PolarHBondContact O-N 2.9Å; K9-Q12 PolarHBondContact O-N 3.08Å; K9-T13 PolarHBondContact O-N 3.01Å; K9-T13 PolarHBondContact O-OG1 3.33Å; K9-T13 VanDerWaalsContact O-OG1 3.08Å
10	N	72.9	Confident	72.5	Confident	113 Å²	113	113.2 Å²	113.2	60%	0.604	60%	0.603	S	S	*	*	H	α-helix	trans	-68	-42.4	-179.4	-142.3	19.3	0	0	0	111.1	E7 S8 Q12 T13 A14	E7-N10 PolarHBondContact O-N 2.91Å; S8-N10 VanDerWaalsContact C-N 3.34Å; N10-Q12 VanDerWaalsContact C-N 3.33Å; N10-Q12 PolarHBondContact O-N 3.47Å; N10-T13 PolarHBondContact O-N 3.05Å; N10-A14 PolarHBondContact O-N 3.42Å
11	N	79.1	Confident	73.2	Confident	104 Å²	104	114.2 Å²	114.2	56%	0.556	60%	0.604	S	S	*	*	H	α-helix	trans	-63.8	-38.6	173.8	-72.3	-16.1	0	0	0	112.1	E7 A14 V15	E7-N11 PolarHBondContact O-N 3.27Å; N11-A14 PolarHBondContact O-N 3.02Å; N11-V15 VanDerWaalsContact O-CG2 3.28Å; N11-V15 WeakPolarHBondContact O-CG2 3.28Å; N11-V15 PolarHBondContact O-N 3.43Å
12	Q	84.1	Confident	75.4	Confident	141 Å²	141	109.2 Å²	109.2	66%	0.659	58%	0.58	S	S	*	*	H	α-helix	trans	-67.3	-40.1	178.9	-163.7	169.6	11.9	0	0	112.1	S8 K9 N10 V15 E16	S8-Q12 WeakPolarHBondContact O-CB 3.32Å; S8-Q12 PolarHBondContact O-N 2.98Å; K9-Q12 PolarHBondContact O-N 3.08Å; N10-Q12 VanDerWaalsContact C-N 3.33Å; N10-Q12 PolarHBondContact O-N 3.47Å; Q12-V15 PolarHBondContact O-N 3.38Å; Q12-E16 PolarHBondContact O-N 3Å
13	T	87.8	Confident	77.5	Confident	78 Å²	78	107.7 Å²	107.7	48%	0.479	56%	0.562	S	S	.	*	H	α-helix	trans	-63.6	-43.7	173.3	-56.2	0	0	0	0	111.5	K9 N10 V15 E16 D17	K9-T13 PolarHBondContact O-N 3.01Å; K9-T13 PolarHBondContact O-OG1 3.33Å; K9-T13 VanDerWaalsContact O-OG1 3.08Å; N10-T13 PolarHBondContact O-N 3.05Å; T13-V15 VanDerWaalsContact C-N 3.33Å; T13-V15 PolarHBondContact O-N 2.89Å; T13-E16 PolarHBondContact O-N 3.24Å; T13-D17 PolarHBondContact O-N 3.4Å
14	A	83.9	Confident	78.9	Confident	50 Å²	50	109.3 Å²	109.3	41%	0.413	56%	0.556	S	S	.	*	H	α-helix	trans	-62.5	-38.7	178	0	0	0	0	0	112.8	N10 N11 T18	N10-A14 PolarHBondContact O-N 3.42Å; N11-A14 PolarHBondContact O-N 3.02Å; A14-T18 WeakPolarHBondContact O-CB 3.44Å; A14-T18 PolarHBondContact O-N 3.14Å; A14-T18 PolarHBondContact O-OG1 3.39Å
15	V	89.3	Confident	80.1	Confident	103 Å²	103	108.5 Å²	108.5	62%	0.624	55%	0.55	S	S	*	*	H	α-helix	trans	-66.2	-43.9	175.3	170.7	0	0	0	0	111	N11 Q12 T13 T18 Y19	N11-V15 VanDerWaalsContact O-CG2 3.28Å; N11-V15 WeakPolarHBondContact O-CG2 3.28Å; N11-V15 PolarHBondContact O-N 3.43Å; Q12-V15 PolarHBondContact O-N 3.38Å; T13-V15 VanDerWaalsContact C-N 3.33Å; T13-V15 PolarHBondContact O-N 2.89Å; V15-T18 PolarHBondContact O-N 2.99Å; V15-Y19 WeakPolarHBondContact O-CB 3.41Å; V15-Y19 PolarHBondContact O-N 2.75Å
16	E	90.7	Very high	81	Confident	99 Å²	99	106.2 Å²	106.2	46%	0.463	55%	0.545	S	S	.	.	H	α-helix	trans	-63.2	-44.8	177.5	-172.2	61.7	-145.3	0	0	111.4	Q12 T13 T18 Y19 Q20	Q12-E16 PolarHBondContact O-N 3Å; T13-E16 PolarHBondContact O-N 3.24Å; E16-T18 VanDerWaalsContact C-N 3.31Å; E16-T18 PolarHBondContact O-N 3.5Å; E16-Y19 WeakPolarHBondContact O-CB 3.45Å; E16-Y19 PolarHBondContact O-N 3.33Å; E16-Y19 VanDerWaalsContact O-N 3.14Å; E16-Q20 WeakPolarHBondContact O-CG 3.39Å; E16-Q20 PolarHBondContact O-N 3.02Å; E16-Q20 PolarHBondContact OE1-NE2 3.39Å
17	D	89.4	Confident	82.2	Confident	91 Å²	91	108 Å²	108	49%	0.487	55%	0.548	S	S	.	.	H	α-helix	trans	-60.5	-42.1	176.5	-78.3	-17.4	0	0	0	111.6	T13 Y19 Q20 Q21	T13-D17 PolarHBondContact O-N 3.4Å; D17-Y19 VanDerWaalsContact C-N 3.34Å; D17-Y19 PolarHBondContact O-N 2.9Å; D17-Q20 PolarHBondContact O-N 2.82Å; D17-Q21 VanDerWaalsContact O-CG 3.3Å; D17-Q21 WeakPolarHBondContact O-CG 3.3Å; D17-Q21 PolarHBondContact O-N 2.89Å
18	T	88.6	Confident	83	Confident	71 Å²	71	104.5 Å²	104.5	44%	0.436	53%	0.534	S	S	.	.	H	α-helix	trans	-63	-42.4	175.9	-56.6	0	0	0	0	111	A14 V15 E16 Q21 M22	A14-T18 WeakPolarHBondContact O-CB 3.44Å; A14-T18 PolarHBondContact O-N 3.14Å; A14-T18 PolarHBondContact O-OG1 3.39Å; V15-T18 PolarHBondContact O-N 2.99Å; E16-T18 VanDerWaalsContact C-N 3.31Å; E16-T18 PolarHBondContact O-N 3.5Å; T18-Q21 PolarHBondContact O-N 3.3Å; T18-M22 PolarHBondContact O-N 2.89Å
19	Y	91.5	Very high	83.6	Confident	132 Å²	132	108.7 Å²	108.7	52%	0.518	54%	0.539	S	S	.	.	H	α-helix	trans	-63	-44.9	177.3	179.7	-98.5	0	0	0	111.9	V15 E16 D17 Q21 M22 R23	V15-Y19 WeakPolarHBondContact O-CB 3.41Å; V15-Y19 PolarHBondContact O-N 2.75Å; E16-Y19 WeakPolarHBondContact O-CB 3.45Å; E16-Y19 PolarHBondContact O-N 3.33Å; E16-Y19 VanDerWaalsContact O-N 3.14Å; D17-Y19 VanDerWaalsContact C-N 3.34Å; D17-Y19 PolarHBondContact O-N 2.9Å; Y19-Q21 VanDerWaalsContact C-N 3.33Å; Y19-Q21 PolarHBondContact O-N 3.36Å; Y19-M22 PolarHBondContact O-N 3.43Å; Y19-R23 WeakPolarHBondContact O-CB 3.47Å; Y19-R23 PolarHBondContact O-N 3.23Å
20	Q	89.6	Confident	84.2	Confident	79 Å²	79	109.2 Å²	109.2	37%	0.369	54%	0.541	S	S	.	.	H	α-helix	trans	-64	-38.4	177.3	-65.9	-56.5	-28	0	0	112	E16 D17 R23 K24	E16-Q20 WeakPolarHBondContact O-CG 3.39Å; E16-Q20 PolarHBondContact O-N 3.02Å; E16-Q20 PolarHBondContact OE1-NE2 3.39Å; D17-Q20 PolarHBondContact O-N 2.82Å; Q20-R23 PolarHBondContact O-N 3.06Å; Q20-K24 PolarHBondContact O-N 2.97Å
21	Q	87.3	Confident	84.2	Confident	135 Å²	135	109.2 Å²	109.2	63%	0.631	54%	0.541	S	S	*	.	H	α-helix	trans	-62.9	-47.1	174.2	-73	176.1	42.7	0	0	111.8	D17 T18 Y19 R23 K24 L25	D17-Q21 VanDerWaalsContact O-CG 3.3Å; D17-Q21 WeakPolarHBondContact O-CG 3.3Å; D17-Q21 PolarHBondContact O-N 2.89Å; T18-Q21 PolarHBondContact O-N 3.3Å; Y19-Q21 VanDerWaalsContact C-N 3.33Å; Y19-Q21 PolarHBondContact O-N 3.36Å; Q21-R23 VanDerWaalsContact C-N 3.33Å; Q21-R23 PolarHBondContact O-N 3.31Å; Q21-K24 PolarHBondContact O-N 3.45Å; Q21-L25 PolarHBondContact O-N 3.4Å
22	M	87.7	Confident	83.7	Confident	127 Å²	127	110 Å²	110	63%	0.626	54%	0.539	S	S	*	.	H	α-helix	trans	-60.7	-41.7	176	-79	-174.7	171.4	0	0	112.1	T18 Y19 K24 L25 C26	T18-M22 PolarHBondContact O-N 2.89Å; Y19-M22 PolarHBondContact O-N 3.43Å; M22-K24 PolarHBondContact O-N 3.46Å; M22-L25 WeakPolarHBondContact O-CB 3.41Å; M22-L25 PolarHBondContact O-N 3.04Å; M22-C26 PolarHBondContact O-N 2.95Å
23	R	88.5	Confident	82.9	Confident	124 Å²	124	105.4 Å²	105.4	47%	0.468	52%	0.523	S	S	.	.	H	α-helix	trans	-59.6	-46.8	177.5	-170.2	-177.2	-166.2	161.5	10.8	111.6	Y19 Q20 Q21 L25 C26 E27	Y19-R23 WeakPolarHBondContact O-CB 3.47Å; Y19-R23 PolarHBondContact O-N 3.23Å; Q20-R23 PolarHBondContact O-N 3.06Å; Q21-R23 VanDerWaalsContact C-N 3.33Å; Q21-R23 PolarHBondContact O-N 3.31Å; R23-L25 VanDerWaalsContact C-N 3.28Å; R23-L25 PolarHBondContact O-N 3.49Å; R23-C26 PolarHBondContact O-N 3.39Å; R23-E27 IonicContact NE-OE1 3.75Å; R23-E27 WeakPolarHBondContact O-CG 3.47Å; R23-E27 PolarHBondContact O-N 3.43Å
24	K	84.9	Confident	81.8	Confident	143 Å²	143	109.5 Å²	109.5	62%	0.622	53%	0.534	S	S	*	.	H	α-helix	trans	-62	-37.9	178.3	-146	176.4	-170.9	179.6	0	111.7	Q20 Q21 M22 E27 N28	Q20-K24 PolarHBondContact O-N 2.97Å; Q21-K24 PolarHBondContact O-N 3.45Å; M22-K24 PolarHBondContact O-N 3.46Å; K24-E27 PolarHBondContact O-N 3.23Å; K24-N28 PolarHBondContact O-N 2.98Å
25	L	81.1	Confident	80.5	Confident	127 Å²	127	110.5 Å²	110.5	67%	0.665	53%	0.532	S	S	*	.	H	α-helix	trans	-66.1	-42.9	176.9	-146.4	143.1	0	0	0	111.4	Q21 M22 R23 N28 Y29	Q21-L25 PolarHBondContact O-N 3.4Å; M22-L25 WeakPolarHBondContact O-CB 3.41Å; M22-L25 PolarHBondContact O-N 3.04Å; R23-L25 VanDerWaalsContact C-N 3.28Å; R23-L25 PolarHBondContact O-N 3.49Å; L25-N28 PolarHBondContact O-N 3.39Å; L25-Y29 PolarHBondContact O-N 2.99Å
26	C	80.1	Confident	78.8	Confident	81 Å²	81	110.3 Å²	110.3	55%	0.547	53%	0.528	S	S	.	.	H	α-helix	trans	-64.5	-38.7	173	-80.7	0	0	0	0	113.4	M22 R23 Y29 K30	M22-C26 PolarHBondContact O-N 2.95Å; R23-C26 PolarHBondContact O-N 3.39Å; C26-Y29 PolarHBondContact O-N 2.92Å; C26-K30 PolarHBondContact O-N 3.03Å
27	E	80.2	Confident	77.1	Confident	102 Å²	102	112.7 Å²	112.7	48%	0.477	54%	0.543	S	S	.	.	H	α-helix	trans	-65.4	-44.4	177.1	-76.4	174.2	-178.9	0	0	111.6	R23 K24 Y29 K30 L31	R23-E27 IonicContact NE-OE1 3.75Å; R23-E27 WeakPolarHBondContact O-CG 3.47Å; R23-E27 PolarHBondContact O-N 3.43Å; K24-E27 PolarHBondContact O-N 3.23Å; E27-Y29 PolarHBondContact O-N 3.35Å; E27-K30 PolarHBondContact O-N 3.5Å; E27-L31 PolarHBondContact O-N 3.08Å; E27-L31 VanDerWaalsContact O-N 3.08Å
28	N	78.9	Confident	75.6	Confident	86 Å²	86	112.9 Å²	112.9	46%	0.46	54%	0.544	S	S	.	.	H	α-helix	trans	-60.4	-45.6	173.5	-79.6	-14.1	0	0	0	111.4	K24 L25 K30 L31 F32	K24-N28 PolarHBondContact O-N 2.98Å; L25-N28 PolarHBondContact O-N 3.39Å; N28-K30 VanDerWaalsContact C-N 3.3Å; N28-K30 PolarHBondContact O-N 3.28Å; N28-L31 VanDerWaalsContact O-CB 3.3Å; N28-L31 WeakPolarHBondContact O-CB 3.47Å; N28-L31 PolarHBondContact O-N 3.01Å; N28-F32 WeakPolarHBondContact O-CD2 3.3Å; N28-F32 PolarHBondContact O-N 3.07Å
29	Y	76.4	Confident	74.2	Confident	167 Å²	167	111.7 Å²	111.7	66%	0.655	54%	0.539	S	S	*	.	H	α-helix	trans	-58.6	-42.2	177.5	-171.4	-88.5	0	0	0	112	L25 C26 E27 L31 F32 S33	L25-Y29 PolarHBondContact O-N 2.99Å; C26-Y29 PolarHBondContact O-N 2.92Å; E27-Y29 PolarHBondContact O-N 3.35Å; Y29-L31 VanDerWaalsContact C-N 3.29Å; Y29-L31 PolarHBondContact O-N 3.47Å; Y29-F32 PolarHBondContact O-N 3.46Å; Y29-S33 WeakPolarHBondContact O-CB 3.3Å; Y29-S33 PolarHBondContact O-N 3.27Å; Y29-S33 PolarHBondContact O-OG 3.4Å
30	K	75.9	Confident	72.9	Confident	141 Å²	141	111.2 Å²	111.2	61%	0.613	55%	0.546	S	S	*	.	H	α-helix	trans	-63.7	-33.4	175.7	-77.4	179.6	-180	177.3	0	113.3	C26 E27 N28 S33 K34	C26-K30 PolarHBondContact O-N 3.03Å; E27-K30 PolarHBondContact O-N 3.5Å; N28-K30 VanDerWaalsContact C-N 3.3Å; N28-K30 PolarHBondContact O-N 3.28Å; K30-S33 WeakPolarHBondContact CA-OG 3.14Å; K30-S33 PolarHBondContact O-OG 3.14Å; K30-K34 WeakPolarHBondContact O-CB 3.48Å; K30-K34 WeakPolarHBondContact O-CG 3.37Å; K30-K34 PolarHBondContact O-N 3.26Å; K30-K34 VanDerWaalsContact O-N 3.14Å
31	L	73.9	Confident	72.1	Confident	113 Å²	113	111.1 Å²	111.1	59%	0.592	55%	0.548	S	S	*	.	H	α-helix	trans	-64.9	-46.9	174.5	-107.5	146.2	0	0	0	110.6	E27 N28 Y29 K34 L35	E27-L31 PolarHBondContact O-N 3.08Å; E27-L31 VanDerWaalsContact O-N 3.08Å; N28-L31 VanDerWaalsContact O-CB 3.3Å; N28-L31 WeakPolarHBondContact O-CB 3.47Å; N28-L31 PolarHBondContact O-N 3.01Å; Y29-L31 VanDerWaalsContact C-N 3.29Å; Y29-L31 PolarHBondContact O-N 3.47Å; L31-K34 PolarHBondContact O-N 2.76Å; L31-L35 PolarHBondContact O-N 3.32Å
32	F	67.6	Low	71.4	Confident	119 Å²	119	107.6 Å²	107.6	52%	0.522	53%	0.533	S	S	.	.	H	α-helix	trans	-70	-37.7	176.3	-71.2	-67.4	0	0	0	113.1	N28 Y29 K34 L35 D36	N28-F32 WeakPolarHBondContact O-CD2 3.3Å; N28-F32 PolarHBondContact O-N 3.07Å; Y29-F32 PolarHBondContact O-N 3.46Å; F32-K34 PolarHBondContact O-N 3.09Å; F32-L35 HydrophobicContact CD1-CD1 4.28Å; F32-L35 WeakPolarHBondContact O-CA 3.34Å; F32-L35 VanDerWaalsContact O-CB 3.3Å; F32-L35 WeakPolarHBondContact O-CB 3.31Å; F32-L35 PolarHBondContact O-N 3.33Å; F32-L35 VanDerWaalsContact O-N 3.09Å; F32-D36 PolarHBondContact O-N 3.47Å
33	S	67.4	Low	70.9	Confident	46 Å²	46	106.1 Å²	106.1	32%	0.322	53%	0.528	S	S	.	.	H	α-helix	trans	-69.7	-23.7	178.4	79.8	0	0	0	0	112.6	Y29 K30 D36	Y29-S33 WeakPolarHBondContact O-CB 3.3Å; Y29-S33 PolarHBondContact O-N 3.27Å; Y29-S33 PolarHBondContact O-OG 3.4Å; K30-S33 WeakPolarHBondContact CA-OG 3.14Å; K30-S33 PolarHBondContact O-OG 3.14Å; S33-D36 VanDerWaalsContact O-CB 3.31Å; S33-D36 WeakPolarHBondContact O-CB 3.47Å; S33-D36 PolarHBondContact O-N 3.07Å
34	K	65.2	Low	70.4	Confident	164 Å²	164	106.3 Å²	106.3	71%	0.713	53%	0.534	S	S	*	.	H	α-helix	trans	-75.7	-31.9	170.9	-81.4	-178.4	178.3	-175.7	0	112.1	K30 L31 F32 N37	K30-K34 WeakPolarHBondContact O-CB 3.48Å; K30-K34 WeakPolarHBondContact O-CG 3.37Å; K30-K34 PolarHBondContact O-N 3.26Å; K30-K34 VanDerWaalsContact O-N 3.14Å; L31-K34 PolarHBondContact O-N 2.76Å; F32-K34 PolarHBondContact O-N 3.09Å; K34-N37 PolarHBondContact O-N 2.78Å
35	L	57.1	Low	70.1	Confident	71 Å²	71	105.4 Å²	105.4	37%	0.372	54%	0.535	S	S	.	.	H	α-helix	trans	-66.6	-26.2	169.2	-82.1	154.2	0	0	0	111.6	L31 F32 N37 N38 L42	L31-L35 PolarHBondContact O-N 3.32Å; F32-L35 HydrophobicContact CD1-CD1 4.28Å; F32-L35 WeakPolarHBondContact O-CA 3.34Å; F32-L35 VanDerWaalsContact O-CB 3.3Å; F32-L35 WeakPolarHBondContact O-CB 3.31Å; F32-L35 PolarHBondContact O-N 3.33Å; F32-L35 VanDerWaalsContact O-N 3.09Å; L35-N37 PolarHBondContact O-N 3.21Å; L35-N38 CarbonylContact O-C 3.04Å; L35-N38 WeakPolarHBondContact O-CA 3.41Å; L35-N38 WeakPolarHBondContact O-CB 3.22Å; L35-N38 PolarHBondContact O-N 3.43Å; L35-L42 HydrophobicContact CB-CD1 4.12Å
36	D	53.1	Low	70.1	Confident	98 Å²	98	106.4 Å²	106.4	52%	0.524	53%	0.531	S	S	.	.	G	3₁₀ helix	trans	-64.6	-18.9	176.6	-137.2	8.7	0	0	0	113.7	F32 S33 N38 S39	F32-D36 PolarHBondContact O-N 3.47Å; S33-D36 VanDerWaalsContact O-CB 3.31Å; S33-D36 WeakPolarHBondContact O-CB 3.47Å; S33-D36 PolarHBondContact O-N 3.07Å; D36-N38 PolarHBondContact O-N 3.01Å; D36-S39 WeakPolarHBondContact O-CB 3.36Å; D36-S39 PolarHBondContact O-N 3.35Å
37	N	54.3	Low	70.1	Confident	149 Å²	149	105.3 Å²	105.3	80%	0.797	52%	0.524	S	S	*	.	G	3₁₀ helix	trans	-70.6	-14.7	167	-76.7	-26.2	0	0	0	112.9	K34 L35	K34-N37 PolarHBondContact O-N 2.78Å; L35-N37 PolarHBondContact O-N 3.21Å
38	N	58	Low	70.2	Confident	95 Å²	95	103.8 Å²	103.8	51%	0.508	52%	0.522	S	S	.	.	G	3₁₀ helix	trans	-111.9	49.8	161.3	-70.9	0.3	0	0	0	108.8	L35 D36 N40 D41	L35-N38 CarbonylContact O-C 3.04Å; L35-N38 WeakPolarHBondContact O-CA 3.41Å; L35-N38 WeakPolarHBondContact O-CB 3.22Å; L35-N38 PolarHBondContact O-N 3.43Å; D36-N38 PolarHBondContact O-N 3.01Å; N38-N40 PolarHBondContact O-N 2.68Å; N38-D41 HydrophobicContact CB-CB 4.42Å; N38-D41 WeakPolarHBondContact CB-OD2 3.32Å; N38-D41 PolarHBondContact ND2-OD2 2.74Å; N38-D41 PolarHBondContact O-N 2.88Å
39	S	59	Low	70.5	Confident	47 Å²	47	102.7 Å²	102.7	33%	0.329	52%	0.521	S	S	.	.	H	α-helix	trans	-49.3	-28	-175	82.9	0	0	0	0	113.6	D36 D41 L42 D43	D36-S39 WeakPolarHBondContact O-CB 3.36Å; D36-S39 PolarHBondContact O-N 3.35Å; S39-D41 VanDerWaalsContact C-N 3.27Å; S39-D41 PolarHBondContact O-N 2.82Å; S39-L42 PolarHBondContact O-N 3.14Å; S39-D43 PolarHBondContact O-N 3.37Å; S39-D43 VanDerWaalsContact O-N 3.14Å
40	N	65.5	Low	70.9	Confident	122 Å²	122	97.7 Å²	97.7	65%	0.652	51%	0.505	S	S	*	.	H	α-helix	trans	-53.5	-38.1	171.9	-77.6	-0.8	0	0	0	113.6	N38 E44	N38-N40 PolarHBondContact O-N 2.68Å; N40-E44 WeakPolarHBondContact O-CA 3.23Å; N40-E44 WeakPolarHBondContact O-CB 3.34Å; N40-E44 PolarHBondContact O-N 3.28Å
41	D	72.6	Confident	71.6	Confident	77 Å²	77	95.4 Å²	95.4	41%	0.412	50%	0.5	S	S	.	.	H	α-helix	trans	-68.5	-39.9	-175	-66.2	-14.5	0	0	0	111.4	N38 S39 L45	N38-D41 HydrophobicContact CB-CB 4.42Å; N38-D41 WeakPolarHBondContact CB-OD2 3.32Å; N38-D41 PolarHBondContact ND2-OD2 2.74Å; N38-D41 PolarHBondContact O-N 2.88Å; S39-D41 VanDerWaalsContact C-N 3.27Å; S39-D41 PolarHBondContact O-N 2.82Å; D41-L45 VanDerWaalsContact O-CB 3.32Å; D41-L45 WeakPolarHBondContact O-CB 3.36Å; D41-L45 PolarHBondContact O-N 2.84Å
42	L	72.8	Confident	72.4	Confident	61 Å²	61	95.1 Å²	95.1	32%	0.319	50%	0.498	S	S	.	.	H	α-helix	trans	-75.3	-42.8	178.6	-82.4	167.4	0	0	0	111.8	L35 S39 E44 L45 Y46	L35-L42 HydrophobicContact CB-CD1 4.12Å; S39-L42 PolarHBondContact O-N 3.14Å; L42-E44 VanDerWaalsContact C-N 3.32Å; L42-L45 PolarHBondContact O-N 3.33Å; L42-Y46 WeakPolarHBondContact O-CB 3.44Å; L42-Y46 PolarHBondContact O-N 3.06Å
43	D	77.1	Confident	73.4	Confident	96 Å²	96	91.3 Å²	91.3	51%	0.513	49%	0.487	S	S	.	.	H	α-helix	trans	-65.2	-37.3	176	-73.4	-26.3	0	0	0	111.4	S39 S47	S39-D43 PolarHBondContact O-N 3.37Å; S39-D43 VanDerWaalsContact O-N 3.14Å; D43-S47 VanDerWaalsContact O-CB 3.23Å; D43-S47 WeakPolarHBondContact O-CB 3.41Å; D43-S47 PolarHBondContact O-N 2.99Å; D43-S47 PolarHBondContact O-OG 2.79Å
44	E	78.1	Confident	74.6	Confident	127 Å²	127	95.3 Å²	95.3	59%	0.593	50%	0.495	S	S	*	.	H	α-helix	trans	-67.7	-42.4	174	-176.2	174.2	-171.4	0	0	111.3	N40 L42 S47 T48	N40-E44 WeakPolarHBondContact O-CA 3.23Å; N40-E44 WeakPolarHBondContact O-CB 3.34Å; N40-E44 PolarHBondContact O-N 3.28Å; L42-E44 VanDerWaalsContact C-N 3.32Å; E44-S47 PolarHBondContact O-N 3.44Å; E44-T48 VanDerWaalsContact O-CB 3.25Å; E44-T48 WeakPolarHBondContact O-CB 3.41Å; E44-T48 PolarHBondContact O-N 3.47Å; E44-T48 PolarHBondContact O-OG1 3.34Å
45	L	78.6	Confident	75.9	Confident	125 Å²	125	92.6 Å²	92.6	65%	0.654	49%	0.488	S	S	*	.	H	α-helix	trans	-62.8	-44.1	175.6	-161.6	102.5	0	0	0	111.3	D41 L42 T48 S49	D41-L45 VanDerWaalsContact O-CB 3.32Å; D41-L45 WeakPolarHBondContact O-CB 3.36Å; D41-L45 PolarHBondContact O-N 2.84Å; L42-L45 PolarHBondContact O-N 3.33Å; L45-T48 PolarHBondContact O-N 2.87Å; L45-S49 WeakPolarHBondContact O-CB 3.25Å; L45-S49 PolarHBondContact O-N 2.91Å
46	Y	79.9	Confident	77.6	Confident	148 Å²	148	96.4 Å²	96.4	58%	0.58	50%	0.497	S	S	*	.	H	α-helix	trans	-62.3	-48.7	175.6	178.1	-104	0	0	0	111.2	L42 T48 S49 L50	L42-Y46 WeakPolarHBondContact O-CB 3.44Å; L42-Y46 PolarHBondContact O-N 3.06Å; Y46-T48 VanDerWaalsContact C-N 3.32Å; Y46-T48 PolarHBondContact O-N 3.1Å; Y46-S49 PolarHBondContact O-N 3.14Å; Y46-S49 VanDerWaalsContact O-N 3.14Å; Y46-S49 PolarHBondContact O-OG 2.93Å; Y46-L50 PolarHBondContact O-N 3.32Å
47	S	80.5	Confident	79.5	Confident	58 Å²	58	95 Å²	95	41%	0.406	49%	0.49	S	S	.	.	H	α-helix	trans	-61.2	-40.6	178.1	-61.1	0	0	0	0	112	D43 E44 L50 N51	D43-S47 VanDerWaalsContact O-CB 3.23Å; D43-S47 WeakPolarHBondContact O-CB 3.41Å; D43-S47 PolarHBondContact O-N 2.99Å; D43-S47 PolarHBondContact O-OG 2.79Å; E44-S47 PolarHBondContact O-N 3.44Å; S47-L50 PolarHBondContact O-N 3.44Å; S47-N51 WeakPolarHBondContact O-CB 3.35Å; S47-N51 VanDerWaalsContact O-CG 3.28Å; S47-N51 PolarHBondContact O-N 3.4Å; S47-N51 PolarHBondContact O-ND2 3.01Å
48	T	83.3	Confident	81.5	Confident	70 Å²	70	92.7 Å²	92.7	43%	0.429	48%	0.477	S	S	.	.	H	α-helix	trans	-62.5	-45	174.4	-61.1	0	0	0	0	110.9	E44 L45 Y46 L50 N51 L52	E44-T48 VanDerWaalsContact O-CB 3.25Å; E44-T48 WeakPolarHBondContact O-CB 3.41Å; E44-T48 PolarHBondContact O-N 3.47Å; E44-T48 PolarHBondContact O-OG1 3.34Å; L45-T48 PolarHBondContact O-N 2.87Å; Y46-T48 VanDerWaalsContact C-N 3.32Å; Y46-T48 PolarHBondContact O-N 3.1Å; T48-L50 VanDerWaalsContact C-N 3.31Å; T48-L50 PolarHBondContact O-N 2.92Å; T48-N51 PolarHBondContact O-N 3.43Å; T48-L52 HydrophobicContact CG2-CD1 4.21Å; T48-L52 WeakPolarHBondContact O-CG 3.47Å; T48-L52 PolarHBondContact O-N 3.42Å
49	S	84.5	Confident	83.4	Confident	62 Å²	62	94.9 Å²	94.9	43%	0.434	48%	0.479	S	S	.	.	H	α-helix	trans	-62.8	-38.4	177.6	78.4	0	0	0	0	112.4	L45 Y46 L52 S53	L45-S49 WeakPolarHBondContact O-CB 3.25Å; L45-S49 PolarHBondContact O-N 2.91Å; Y46-S49 PolarHBondContact O-N 3.14Å; Y46-S49 VanDerWaalsContact O-N 3.14Å; Y46-S49 PolarHBondContact O-OG 2.93Å; S49-L52 PolarHBondContact O-N 2.91Å; S49-S53 PolarHBondContact O-N 3.43Å
50	L	85.4	Confident	85.3	Confident	62 Å²	62	97 Å²	97	33%	0.325	48%	0.484	S	S	.	.	H	α-helix	trans	-65.8	-46.8	176.2	-173.2	67.9	0	0	0	110.9	Y46 S47 T48 L52 S53 Y54	Y46-L50 PolarHBondContact O-N 3.32Å; S47-L50 PolarHBondContact O-N 3.44Å; T48-L50 VanDerWaalsContact C-N 3.31Å; T48-L50 PolarHBondContact O-N 2.92Å; L50-L52 VanDerWaalsContact C-N 3.32Å; L50-L52 PolarHBondContact O-N 2.79Å; L50-S53 WeakPolarHBondContact O-CB 3Å; L50-S53 PolarHBondContact O-N 3.39Å; L50-S53 VanDerWaalsContact O-N 3.1Å; L50-Y54 HydrophobicContact CD1-CE2 4.1Å; L50-Y54 HydrophobicContact CD2-CE2 3.99Å; L50-Y54 HydrophobicContact CG-CD2 4.27Å; L50-Y54 HydrophobicContact CG-CE2 3.6Å; L50-Y54 WeakPolarHBondContact O-CD2 3.44Å; L50-Y54 PolarHBondContact O-N 3.29Å
51	N	90.3	Very high	86.8	Confident	94 Å²	94	94.8 Å²	94.8	50%	0.503	48%	0.475	S	S	.	.	H	α-helix	trans	-59.5	-41.5	175.7	-73.4	-19.7	0	0	0	112.1	S47 T48 S53 Y54 I55	S47-N51 WeakPolarHBondContact O-CB 3.35Å; S47-N51 VanDerWaalsContact O-CG 3.28Å; S47-N51 PolarHBondContact O-N 3.4Å; S47-N51 PolarHBondContact O-ND2 3.01Å; T48-N51 PolarHBondContact O-N 3.43Å; N51-S53 VanDerWaalsContact C-N 3.31Å; N51-S53 PolarHBondContact O-N 2.77Å; N51-Y54 PolarHBondContact O-N 3.05Å; N51-I55 WeakPolarHBondContact O-CG1 3.45Å; N51-I55 PolarHBondContact O-N 2.88Å
52	L	89.4	Confident	88	Confident	107 Å²	107	96.5 Å²	96.5	56%	0.56	48%	0.483	S	S	*	.	H	α-helix	trans	-64.4	-35.8	175.2	-73	172.4	0	0	0	112.2	T48 S49 L50 I55 R56	T48-L52 HydrophobicContact CG2-CD1 4.21Å; T48-L52 WeakPolarHBondContact O-CG 3.47Å; T48-L52 PolarHBondContact O-N 3.42Å; S49-L52 PolarHBondContact O-N 2.91Å; L50-L52 VanDerWaalsContact C-N 3.32Å; L50-L52 PolarHBondContact O-N 2.79Å; L52-I55 PolarHBondContact O-N 3.03Å; L52-R56 PolarHBondContact O-N 2.85Å
53	S	90.1	Very high	89.2	Confident	39 Å²	39	98.5 Å²	98.5	27%	0.273	49%	0.489	S	S	.	.	H	α-helix	trans	-62.8	-45.8	173.4	-167.6	0	0	0	0	111.2	S49 L50 N51 I55 R56 D57	S49-S53 PolarHBondContact O-N 3.43Å; L50-S53 WeakPolarHBondContact O-CB 3Å; L50-S53 PolarHBondContact O-N 3.39Å; L50-S53 VanDerWaalsContact O-N 3.1Å; N51-S53 VanDerWaalsContact C-N 3.31Å; N51-S53 PolarHBondContact O-N 2.77Å; S53-I55 PolarHBondContact O-N 3.37Å; S53-R56 WeakPolarHBondContact O-CB 3.47Å; S53-R56 PolarHBondContact O-N 3.16Å; S53-R56 PolarHBondContact OG-NH2 3.04Å; S53-D57 PolarHBondContact O-N 3.47Å
54	Y	91.1	Very high	90.2	Very high	129 Å²	129	100 Å²	100	51%	0.506	49%	0.493	S	S	.	.	H	α-helix	trans	-61.8	-42.8	177	-66	-45	0	0	0	112.4	L50 N51 R56 D57 D58	L50-Y54 HydrophobicContact CD1-CE2 4.1Å; L50-Y54 HydrophobicContact CD2-CE2 3.99Å; L50-Y54 HydrophobicContact CG-CD2 4.27Å; L50-Y54 HydrophobicContact CG-CE2 3.6Å; L50-Y54 WeakPolarHBondContact O-CD2 3.44Å; L50-Y54 PolarHBondContact O-N 3.29Å; N51-Y54 PolarHBondContact O-N 3.05Å; Y54-R56 VanDerWaalsContact C-N 3.28Å; Y54-R56 PolarHBondContact O-N 2.97Å; Y54-D57 PolarHBondContact O-N 3.46Å; Y54-D57 VanDerWaalsContact O-N 3.16Å; Y54-D58 WeakPolarHBondContact O-CB 3.49Å; Y54-D58 PolarHBondContact O-N 3.28Å
55	I	93.5	Very high	91.2	Very high	108 Å²	108	99.2 Å²	99.2	55%	0.554	49%	0.489	S	S	*	.	H	α-helix	trans	-59.5	-40.3	175.5	-69.1	165.6	0	0	0	111.4	N51 L52 S53 Y59	N51-I55 WeakPolarHBondContact O-CG1 3.45Å; N51-I55 PolarHBondContact O-N 2.88Å; L52-I55 PolarHBondContact O-N 3.03Å; S53-I55 PolarHBondContact O-N 3.37Å; I55-Y59 WeakPolarHBondContact O-CB 3.43Å; I55-Y59 PolarHBondContact O-N 3.04Å
56	R	92.6	Very high	92.1	Very high	150 Å²	150	97.6 Å²	97.6	57%	0.566	48%	0.481	S	S	*	.	H	α-helix	trans	-64.9	-43.3	176.4	-175.7	-163.7	66.6	-162	-7.4	111.4	L52 S53 Y54 Y59 E60	L52-R56 PolarHBondContact O-N 2.85Å; S53-R56 WeakPolarHBondContact O-CB 3.47Å; S53-R56 PolarHBondContact O-N 3.16Å; S53-R56 PolarHBondContact OG-NH2 3.04Å; Y54-R56 VanDerWaalsContact C-N 3.28Å; Y54-R56 PolarHBondContact O-N 2.97Å; R56-Y59 WeakPolarHBondContact O-CB 3.48Å; R56-Y59 PolarHBondContact O-N 3.34Å; R56-E60 PolarHBondContact O-N 3.19Å
57	D	93.4	Very high	93	Very high	69 Å²	69	94.1 Å²	94.1	37%	0.369	48%	0.478	S	S	.	.	H	α-helix	trans	-69.1	-38.3	-178.3	-61	-13.3	0	0	0	110.8	S53 Y54 E60 T61	S53-D57 PolarHBondContact O-N 3.47Å; Y54-D57 PolarHBondContact O-N 3.46Å; Y54-D57 VanDerWaalsContact O-N 3.16Å; D57-E60 PolarHBondContact O-N 2.95Å; D57-T61 PolarHBondContact O-N 2.99Å; D57-T61 PolarHBondContact O-OG1 3.37Å
58	D	96.8	Very high	93.8	Very high	100 Å²	100	94.2 Å²	94.2	54%	0.535	48%	0.476	S	S	.	.	H	α-helix	trans	-61.4	-43	170.5	-75.1	-16.2	0	0	0	111.5	Y54 T61 I62	Y54-D58 WeakPolarHBondContact O-CB 3.49Å; Y54-D58 PolarHBondContact O-N 3.28Å; D58-T61 WeakPolarHBondContact O-CB 3.47Å; D58-T61 PolarHBondContact O-N 3.04Å; D58-I62 WeakPolarHBondContact O-CG1 3.33Å; D58-I62 PolarHBondContact O-N 3.05Å
59	Y	97.9	Very high	94.4	Very high	141 Å²	141	96 Å²	96	55%	0.553	48%	0.482	S	S	*	.	H	α-helix	trans	-59.8	-47.2	177	170.1	-95.6	0	0	0	112.3	I55 R56 T61 I62 K63	I55-Y59 WeakPolarHBondContact O-CB 3.43Å; I55-Y59 PolarHBondContact O-N 3.04Å; R56-Y59 WeakPolarHBondContact O-CB 3.48Å; R56-Y59 PolarHBondContact O-N 3.34Å; Y59-T61 VanDerWaalsContact C-N 3.28Å; Y59-T61 PolarHBondContact O-N 3.4Å; Y59-I62 PolarHBondContact O-N 2.95Å; Y59-K63 HydrophobicContact CE1-CD 4.1Å; Y59-K63 WeakPolarHBondContact O-CB 3.37Å; Y59-K63 PolarHBondContact O-N 3.13Å
60	E	97.6	Very high	94.9	Very high	93 Å²	93	98.2 Å²	98.2	44%	0.435	48%	0.484	S	S	.	.	H	α-helix	trans	-66.4	-33.1	177.6	-70.2	-59.7	150.5	0	0	111.7	R56 D57 K63 H64	R56-E60 PolarHBondContact O-N 3.19Å; D57-E60 PolarHBondContact O-N 2.95Å; E60-K63 PolarHBondContact O-N 3.47Å; E60-K63 IonicContact OE1-NZ 2.95Å; E60-K63 PolarHBondContact OE1-NZ 3.38Å; E60-K63 IonicContact OE2-NZ 3.37Å; E60-K63 PolarHBondContact OE2-NZ 3.49Å; E60-H64 WeakPolarHBondContact O-CB 3.34Å; E60-H64 PolarHBondContact O-N 3Å
61	T	97.9	Very high	95.4	Very high	75 Å²	75	97.7 Å²	97.7	46%	0.46	49%	0.488	S	S	.	.	H	α-helix	trans	-63.7	-50.6	173.7	-58.6	0	0	0	0	111.6	D57 D58 Y59 K63 H64 E65	D57-T61 PolarHBondContact O-N 2.99Å; D57-T61 PolarHBondContact O-OG1 3.37Å; D58-T61 WeakPolarHBondContact O-CB 3.47Å; D58-T61 PolarHBondContact O-N 3.04Å; Y59-T61 VanDerWaalsContact C-N 3.28Å; Y59-T61 PolarHBondContact O-N 3.4Å; T61-K63 VanDerWaalsContact C-N 3.29Å; T61-K63 PolarHBondContact O-N 2.98Å; T61-H64 WeakPolarHBondContact O-CB 3.44Å; T61-H64 PolarHBondContact O-N 3.34Å; T61-H64 VanDerWaalsContact O-N 3.13Å; T61-E65 PolarHBondContact O-N 3.23Å
62	I	98	Very high	95.7	Very high	112 Å²	112	97.8 Å²	97.8	57%	0.574	49%	0.489	S	S	*	.	H	α-helix	trans	-59.2	-42.5	177.9	-69.9	165.9	0	0	0	110.9	D58 Y59 H64 E65 L66	D58-I62 WeakPolarHBondContact O-CG1 3.33Å; D58-I62 PolarHBondContact O-N 3.05Å; Y59-I62 PolarHBondContact O-N 2.95Å; I62-H64 VanDerWaalsContact C-N 3.33Å; I62-H64 PolarHBondContact O-N 3.43Å; I62-E65 PolarHBondContact O-N 2.95Å; I62-L66 WeakPolarHBondContact O-CB 3.49Å; I62-L66 PolarHBondContact O-N 3.37Å
63	K	98.1	Very high	95.8	Very high	103 Å²	103	98.7 Å²	98.7	45%	0.448	49%	0.485	S	S	.	.	H	α-helix	trans	-63.1	-39.6	177.8	179.8	178.8	161	-155	0	111.9	Y59 E60 T61 S67	Y59-K63 HydrophobicContact CE1-CD 4.1Å; Y59-K63 WeakPolarHBondContact O-CB 3.37Å; Y59-K63 PolarHBondContact O-N 3.13Å; E60-K63 PolarHBondContact O-N 3.47Å; E60-K63 IonicContact OE1-NZ 2.95Å; E60-K63 PolarHBondContact OE1-NZ 3.38Å; E60-K63 IonicContact OE2-NZ 3.37Å; E60-K63 PolarHBondContact OE2-NZ 3.49Å; T61-K63 VanDerWaalsContact C-N 3.29Å; T61-K63 PolarHBondContact O-N 2.98Å; K63-S67 PolarHBondContact O-N 3.2Å
64	H	98.3	Very high	95.9	Very high	127 Å²	127	100.4 Å²	100.4	59%	0.588	49%	0.488	S	S	*	.	H	α-helix	trans	-64	-50.2	174.2	178.3	69.5	0	0	0	111.7	E60 T61 I62 L66 S67 V68	E60-H64 WeakPolarHBondContact O-CB 3.34Å; E60-H64 PolarHBondContact O-N 3Å; T61-H64 WeakPolarHBondContact O-CB 3.44Å; T61-H64 PolarHBondContact O-N 3.34Å; T61-H64 VanDerWaalsContact O-N 3.13Å; I62-H64 VanDerWaalsContact C-N 3.33Å; I62-H64 PolarHBondContact O-N 3.43Å; H64-L66 VanDerWaalsContact C-N 3.32Å; H64-L66 PolarHBondContact O-N 3.4Å; H64-S67 WeakPolarHBondContact O-CA 3.34Å; H64-S67 VanDerWaalsContact O-CB 3.27Å; H64-S67 WeakPolarHBondContact O-CB 3.32Å; H64-S67 PolarHBondContact O-N 3.44Å; H64-V68 PolarHBondContact O-N 2.9Å
65	E	98.4	Very high	96	Very high	112 Å²	112	99.6 Å²	99.6	52%	0.523	49%	0.492	S	S	.	.	H	α-helix	trans	-60.5	-40.8	179.4	-70.5	-174.6	174.6	0	0	112.2	T61 I62 S67 V68 I69	T61-E65 PolarHBondContact O-N 3.23Å; I62-E65 PolarHBondContact O-N 2.95Å; E65-S67 VanDerWaalsContact C-N 3.27Å; E65-S67 PolarHBondContact O-N 3.24Å; E65-V68 WeakPolarHBondContact O-CB 3.36Å; E65-V68 PolarHBondContact O-N 3.47Å; E65-V68 VanDerWaalsContact O-N 3.12Å; E65-I69 WeakPolarHBondContact O-CG1 3.27Å; E65-I69 PolarHBondContact O-N 2.88Å
66	L	97.7	Very high	96	Very high	90 Å²	90	96.9 Å²	96.9	47%	0.471	49%	0.485	S	S	.	.	H	α-helix	trans	-59.4	-39	174.4	-178.8	62.6	0	0	0	111.9	I62 H64 I69 K70	I62-L66 WeakPolarHBondContact O-CB 3.49Å; I62-L66 PolarHBondContact O-N 3.37Å; H64-L66 VanDerWaalsContact C-N 3.32Å; H64-L66 PolarHBondContact O-N 3.4Å; L66-I69 PolarHBondContact O-N 3.44Å; L66-K70 HydrophobicContact CG-CD 4.5Å; L66-K70 WeakPolarHBondContact O-CB 3.41Å; L66-K70 VanDerWaalsContact O-CG 3.32Å; L66-K70 WeakPolarHBondContact O-CG 3.5Å; L66-K70 PolarHBondContact O-N 2.9Å
67	S	97.4	Very high	95.9	Very high	75 Å²	75	92.2 Å²	92.2	52%	0.524	47%	0.468	S	S	.	.	H	α-helix	trans	-63.9	-42.4	174.9	-170.5	0	0	0	0	111.7	K63 H64 E65 K70 A71	K63-S67 PolarHBondContact O-N 3.2Å; H64-S67 WeakPolarHBondContact O-CA 3.34Å; H64-S67 VanDerWaalsContact O-CB 3.27Å; H64-S67 WeakPolarHBondContact O-CB 3.32Å; H64-S67 PolarHBondContact O-N 3.44Å; E65-S67 VanDerWaalsContact C-N 3.27Å; E65-S67 PolarHBondContact O-N 3.24Å; S67-K70 PolarHBondContact O-N 3.04Å; S67-A71 PolarHBondContact O-N 3.34Å
68	V	97.9	Very high	95.8	Very high	60 Å²	60	92.7 Å²	92.7	36%	0.364	47%	0.47	S	S	.	.	H	α-helix	trans	-63.9	-44.9	177	174.2	0	0	0	0	111.1	H64 E65 K70 A71 N72	H64-V68 PolarHBondContact O-N 2.9Å; E65-V68 WeakPolarHBondContact O-CB 3.36Å; E65-V68 PolarHBondContact O-N 3.47Å; E65-V68 VanDerWaalsContact O-N 3.12Å; V68-K70 VanDerWaalsContact C-N 3.34Å; V68-K70 PolarHBondContact O-N 3.5Å; V68-A71 PolarHBondContact O-N 3.02Å; V68-N72 WeakPolarHBondContact O-CB 3.37Å; V68-N72 PolarHBondContact O-N 3.36Å
69	I	96.6	Very high	95.7	Very high	107 Å²	107	90.8 Å²	90.8	55%	0.549	47%	0.468	S	S	.	.	H	α-helix	trans	-60.8	-44	177.4	-69.1	166.1	0	0	0	110.8	E65 L66 A71 N72 R73	E65-I69 WeakPolarHBondContact O-CG1 3.27Å; E65-I69 PolarHBondContact O-N 2.88Å; L66-I69 PolarHBondContact O-N 3.44Å; I69-A71 PolarHBondContact O-N 2.92Å; I69-N72 PolarHBondContact O-N 3Å; I69-R73 VanDerWaalsContact O-CB 3.31Å; I69-R73 WeakPolarHBondContact O-CB 3.45Å; I69-R73 PolarHBondContact O-N 3.18Å
70	K	94.9	Very high	95.5	Very high	110 Å²	110	87.7 Å²	87.7	48%	0.478	46%	0.461	S	S	.	.	H	α-helix	trans	-60.2	-43.9	176.3	-76.3	177.2	177.8	-175.4	0	111.9	L66 S67 V68 R73 Q74	L66-K70 HydrophobicContact CG-CD 4.5Å; L66-K70 WeakPolarHBondContact O-CB 3.41Å; L66-K70 VanDerWaalsContact O-CG 3.32Å; L66-K70 WeakPolarHBondContact O-CG 3.5Å; L66-K70 PolarHBondContact O-N 2.9Å; S67-K70 PolarHBondContact O-N 3.04Å; V68-K70 VanDerWaalsContact C-N 3.34Å; V68-K70 PolarHBondContact O-N 3.5Å; K70-R73 PolarHBondContact O-N 3.12Å; K70-Q74 PolarHBondContact O-N 3.41Å
71	A	95.7	Very high	95.2	Very high	51 Å²	51	86.6 Å²	86.6	42%	0.421	46%	0.458	S	S	.	.	H	α-helix	trans	-63.8	-47	176.9	0	0	0	0	0	112	S67 V68 I69 R73 Q74 I75	S67-A71 PolarHBondContact O-N 3.34Å; V68-A71 PolarHBondContact O-N 3.02Å; I69-A71 PolarHBondContact O-N 2.92Å; A71-R73 VanDerWaalsContact C-N 3.31Å; A71-R73 PolarHBondContact O-N 2.9Å; A71-Q74 WeakPolarHBondContact O-CB 3.5Å; A71-Q74 PolarHBondContact O-N 3.39Å; A71-Q74 VanDerWaalsContact O-N 3.14Å; A71-I75 WeakPolarHBondContact O-CG1 3.31Å; A71-I75 PolarHBondContact O-N 2.97Å
72	N	96	Very high	95	Very high	96 Å²	96	87.3 Å²	87.3	51%	0.513	47%	0.472	S	S	.	.	H	α-helix	trans	-62.6	-39	178.1	-73	-14	0	0	0	112.1	V68 I69 Q74 I75 A76	V68-N72 WeakPolarHBondContact O-CB 3.37Å; V68-N72 PolarHBondContact O-N 3.36Å; I69-N72 PolarHBondContact O-N 3Å; N72-Q74 VanDerWaalsContact C-N 3.34Å; N72-I75 PolarHBondContact O-N 3.14Å; N72-A76 WeakPolarHBondContact O-CB 3.45Å; N72-A76 PolarHBondContact O-N 3.4Å
73	R	92.4	Very high	94.8	Very high	126 Å²	126	85.3 Å²	85.3	48%	0.475	47%	0.472	S	S	.	.	H	α-helix	trans	-61.1	-43.4	173.9	-176.2	-177.5	68.8	158.6	2.9	111.4	I69 K70 A71 A76 R77 D90	I69-R73 VanDerWaalsContact O-CB 3.31Å; I69-R73 WeakPolarHBondContact O-CB 3.45Å; I69-R73 PolarHBondContact O-N 3.18Å; K70-R73 PolarHBondContact O-N 3.12Å; A71-R73 VanDerWaalsContact C-N 3.31Å; A71-R73 PolarHBondContact O-N 2.9Å; R73-A76 PolarHBondContact O-N 2.87Å; R73-R77 WeakPolarHBondContact O-CB 3.39Å; R73-R77 PolarHBondContact O-N 3.42Å; R73-D90 VanDerWaalsContact CZ-CG 3.45Å; R73-D90 IonicContact CZ-OD1 2.98Å; R73-D90 IonicContact CZ-OD2 3.22Å; R73-D90 IonicContact NE-OD1 3.82Å; R73-D90 IonicContact NE-OD2 3.82Å; R73-D90 IonicContact NH1-OD1 2.7Å; R73-D90 PolarHBondContact NH1-OD1 3.3Å; R73-D90 IonicContact NH1-OD2 3.76Å; R73-D90 IonicContact NH2-OD1 3.08Å; R73-D90 PolarHBondContact NH2-OD1 3.34Å; R73-D90 VanDerWaalsContact NH2-OD1 3.08Å; R73-D90 IonicContact NH2-OD2 2.64Å; R73-D90 PolarHBondContact NH2-OD2 3.2Å
74	Q	91.1	Very high	94.6	Very high	74 Å²	74	83.6 Å²	83.6	35%	0.346	48%	0.483	S	S	.	.	H	α-helix	trans	-62.1	-46	177.1	-173.7	61.9	47.1	0	0	111.3	K70 A71 N72 A76 R77 D78	K70-Q74 PolarHBondContact O-N 3.41Å; A71-Q74 WeakPolarHBondContact O-CB 3.5Å; A71-Q74 PolarHBondContact O-N 3.39Å; A71-Q74 VanDerWaalsContact O-N 3.14Å; N72-Q74 VanDerWaalsContact C-N 3.34Å; Q74-A76 VanDerWaalsContact C-N 3.32Å; Q74-A76 PolarHBondContact O-N 3.04Å; Q74-R77 WeakPolarHBondContact O-CB 3.5Å; Q74-R77 PolarHBondContact O-N 3.44Å; Q74-D78 PolarHBondContact NE2-OD1 3.03Å; Q74-D78 VanDerWaalsContact O-CG 3.24Å; Q74-D78 PolarHBondContact O-N 3.35Å
75	I	94.2	Very high	94.3	Very high	112 Å²	112	83.9 Å²	83.9	57%	0.574	48%	0.483	S	S	*	.	H	α-helix	trans	-57.9	-45.3	176.5	-66.8	165.8	0	0	0	111.1	A71 N72 D78 A79	A71-I75 WeakPolarHBondContact O-CG1 3.31Å; A71-I75 PolarHBondContact O-N 2.97Å; N72-I75 PolarHBondContact O-N 3.14Å; I75-D78 PolarHBondContact O-N 3.42Å; I75-A79 PolarHBondContact O-N 2.85Å
76	A	92.9	Very high	93.6	Very high	51 Å²	51	87.9 Å²	87.9	42%	0.421	50%	0.501	S	S	.	.	H	α-helix	trans	-63.6	-41.2	178	0	0	0	0	0	112.1	N72 R73 Q74 A79 L80	N72-A76 WeakPolarHBondContact O-CB 3.45Å; N72-A76 PolarHBondContact O-N 3.4Å; R73-A76 PolarHBondContact O-N 2.87Å; Q74-A76 VanDerWaalsContact C-N 3.32Å; Q74-A76 PolarHBondContact O-N 3.04Å; A76-A79 PolarHBondContact O-N 3.48Å; A76-L80 WeakPolarHBondContact O-CG 3.35Å; A76-L80 PolarHBondContact O-N 2.95Å
77	R	90.8	Very high	92.6	Very high	52 Å²	52	85.5 Å²	85.5	20%	0.196	49%	0.492	C	S	.	.	H	α-helix	trans	-61	-47.2	175.3	-178	178.2	-177.4	-92.4	1.8	111.5	R73 Q74 A79 L80 L81 C87 D89	R73-R77 WeakPolarHBondContact O-CB 3.39Å; R73-R77 PolarHBondContact O-N 3.42Å; Q74-R77 WeakPolarHBondContact O-CB 3.5Å; Q74-R77 PolarHBondContact O-N 3.44Å; R77-A79 VanDerWaalsContact C-N 3.3Å; R77-A79 PolarHBondContact O-N 3.38Å; R77-L80 PolarHBondContact O-N 3.4Å; R77-L81 HydrophobicContact CG-CD1 4.08Å; R77-L81 WeakPolarHBondContact O-CG 3.46Å; R77-L81 PolarHBondContact O-N 2.95Å; R77-C87 HydrophobicContact CG-CB 4.11Å; R77-D89 IonicContact CZ-OD1 3.78Å; R77-D89 IonicContact NH2-OD1 2.69Å; R77-D89 PolarHBondContact NH2-OD1 2.99Å
78	D	91.6	Very high	91.6	Very high	79 Å²	79	87.2 Å²	87.2	42%	0.422	50%	0.501	S	S	.	.	H	α-helix	trans	-62.3	-39.9	-179.9	-65.5	-18.4	0	0	0	111.2	Q74 I75 L81 A82	Q74-D78 PolarHBondContact NE2-OD1 3.03Å; Q74-D78 VanDerWaalsContact O-CG 3.24Å; Q74-D78 PolarHBondContact O-N 3.35Å; I75-D78 PolarHBondContact O-N 3.42Å; D78-L81 PolarHBondContact O-N 3.41Å; D78-A82 WeakPolarHBondContact O-CB 3.47Å; D78-A82 PolarHBondContact O-N 3.23Å
79	A	94.1	Very high	90.3	Very high	60 Å²	60	90.8 Å²	90.8	50%	0.496	52%	0.518	S	S	.	.	H	α-helix	trans	-64.6	-42	175.2	0	0	0	0	0	112.7	I75 A76 R77 A82 A83	I75-A79 PolarHBondContact O-N 2.85Å; A76-A79 PolarHBondContact O-N 3.48Å; R77-A79 VanDerWaalsContact C-N 3.3Å; R77-A79 PolarHBondContact O-N 3.38Å; A79-A82 PolarHBondContact O-N 2.64Å; A79-A83 WeakPolarHBondContact O-CB 3.48Å; A79-A83 PolarHBondContact O-N 3.08Å
80	L	93.1	Very high	88.9	Confident	76 Å²	76	89 Å²	89	40%	0.398	51%	0.51	S	S	.	.	H	α-helix	trans	-65.1	-43.2	177	-74.5	170.2	0	0	0	111.9	A76 R77 A83 G84 F85	A76-L80 WeakPolarHBondContact O-CG 3.35Å; A76-L80 PolarHBondContact O-N 2.95Å; R77-L80 PolarHBondContact O-N 3.4Å; L80-A83 CarbonylContact O-C 3.59Å; L80-A83 PolarHBondContact O-N 2.7Å; L80-G84 PolarHBondContact O-N 2.93Å; L80-F85 HydrophobicContact CB-CB 4.35Å; L80-F85 HydrophobicContact CD2-CD2 4.06Å; L80-F85 HydrophobicContact CD2-CG 4.41Å; L80-F85 WeakPolarHBondContact O-CB 3.37Å; L80-F85 PolarHBondContact O-N 3.47Å
81	L	91.6	Very high	87.6	Confident	70 Å²	70	88.6 Å²	88.6	37%	0.366	52%	0.518	S	S	.	.	H	α-helix	trans	-62	-43.1	175.1	-71.7	170.7	0	0	0	111.4	R77 D78 A83 G84 C87	R77-L81 HydrophobicContact CG-CD1 4.08Å; R77-L81 WeakPolarHBondContact O-CG 3.46Å; R77-L81 PolarHBondContact O-N 2.95Å; D78-L81 PolarHBondContact O-N 3.41Å; L81-A83 PolarHBondContact O-N 3.02Å; L81-G84 PolarHBondContact O-N 2.69Å; L81-C87 HydrophobicContact CD2-CB 4.1Å; L81-C87 HydrophobicContact CG-CB 4.3Å
82	A	93.4	Very high	86.2	Confident	91 Å²	91	92.3 Å²	92.3	75%	0.752	54%	0.539	S	S	*	.	H	α-helix	trans	-63.4	-29.5	176.2	0	0	0	0	0	112.9	D78 A79 G84	D78-A82 WeakPolarHBondContact O-CB 3.47Å; D78-A82 PolarHBondContact O-N 3.23Å; A79-A82 PolarHBondContact O-N 2.64Å; A82-G84 VanDerWaalsContact C-N 3.25Å; A82-G84 PolarHBondContact O-N 3.03Å
83	A	95.4	Very high	84.7	Confident	70 Å²	70	97.7 Å²	97.7	58%	0.579	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.2	0.7	173.5	0	0	0	0	0	113.8	A79 L80 L81 F85	A79-A83 WeakPolarHBondContact O-CB 3.48Å; A79-A83 PolarHBondContact O-N 3.08Å; L80-A83 CarbonylContact O-C 3.59Å; L80-A83 PolarHBondContact O-N 2.7Å; L81-A83 PolarHBondContact O-N 3.02Å; A83-F85 HydrophobicContact CB-CD2 3.89Å; A83-F85 HydrophobicContact CB-CE2 4.07Å
84	G	93.8	Very high	84.3	Confident	66 Å²	66	96.3 Å²	96.3	68%	0.68	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	86.5	9.4	176.8	0	0	0	0	0	115	L80 L81 A82	L80-G84 PolarHBondContact O-N 2.93Å; L81-G84 PolarHBondContact O-N 2.69Å; A82-G84 VanDerWaalsContact C-N 3.25Å; A82-G84 PolarHBondContact O-N 3.03Å
85	F	91.3	Very high	83.9	Confident	133 Å²	133	97.4 Å²	97.4	58%	0.583	59%	0.592	S	S	*	*			trans	-78.3	141.8	172.5	-67.5	-85	0	0	0	110.7	L80 A83	L80-F85 HydrophobicContact CB-CB 4.35Å; L80-F85 HydrophobicContact CD2-CD2 4.06Å; L80-F85 HydrophobicContact CD2-CG 4.41Å; L80-F85 WeakPolarHBondContact O-CB 3.37Å; L80-F85 PolarHBondContact O-N 3.47Å; A83-F85 HydrophobicContact CB-CD2 3.89Å; A83-F85 HydrophobicContact CB-CE2 4.07Å
86	Q	83.5	Confident	83.3	Confident	196 Å²	196	96.6 Å²	96.6	92%	0.916	59%	0.593	S	S	*	*			trans	-79.2	122.8	168.3	-73.4	-176.3	-13.4	0	0	109.4
87	C	77.4	Confident	82.8	Confident	40 Å²	40	99.3 Å²	99.3	27%	0.27	60%	0.603	S	S	.	*			trans	-118.8	119	177.2	-143.3	0	0	0	0	108.5	R77 L81	R77-C87 HydrophobicContact CG-CB 4.11Å; L81-C87 HydrophobicContact CD2-CB 4.1Å; L81-C87 HydrophobicContact CG-CB 4.3Å
88	P	75.6	Confident	82.3	Confident	112 Å²	112	102.3 Å²	102.3	73%	0.727	63%	0.629	S	S	*	*	P	Polyproline II helix	trans	-59.4	147	-179.6	22.3	-30.1	0	0	0	110.9
89	D	71.8	Confident	81.7	Confident	134 Å²	134	103.8 Å²	103.8	72%	0.717	64%	0.642	S	S	*	*	P	Polyproline II helix	trans	-62.7	149.9	174.3	-70.2	-40.9	0	0	0	110.4	R77	R77-D89 IonicContact CZ-OD1 3.78Å; R77-D89 IonicContact NH2-OD1 2.69Å; R77-D89 PolarHBondContact NH2-OD1 2.99Å
90	D	66.6	Low	80.8	Confident	69 Å²	69	106.9 Å²	106.9	37%	0.369	65%	0.653	S	S	.	*	P	Polyproline II helix	trans	-59.7	137.9	173.7	-87.1	-44.5	0	0	0	110.1	R73	R73-D90 VanDerWaalsContact CZ-CG 3.45Å; R73-D90 IonicContact CZ-OD1 2.98Å; R73-D90 IonicContact CZ-OD2 3.22Å; R73-D90 IonicContact NE-OD1 3.82Å; R73-D90 IonicContact NE-OD2 3.82Å; R73-D90 IonicContact NH1-OD1 2.7Å; R73-D90 PolarHBondContact NH1-OD1 3.3Å; R73-D90 IonicContact NH1-OD2 3.76Å; R73-D90 IonicContact NH2-OD1 3.08Å; R73-D90 PolarHBondContact NH2-OD1 3.34Å; R73-D90 VanDerWaalsContact NH2-OD1 3.08Å; R73-D90 IonicContact NH2-OD2 2.64Å; R73-D90 PolarHBondContact NH2-OD2 3.2Å
91	P	67.7	Low	79.8	Confident	102 Å²	102	109.3 Å²	109.3	66%	0.662	67%	0.672	S	S	*	*	P	Polyproline II helix	trans	-60.3	142.5	173.8	23.7	-30.3	0	0	0	109.7	T93	P91-T93 PolarHBondContact O-N 3.04Å
92	P	66.1	Low	78.8	Confident	130 Å²	130	112.6 Å²	112.6	84%	0.844	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-58.2	138.1	177	23.4	-31	0	0	0	109.8
93	T	63.5	Low	77.5	Confident	208 Å²	208	114.5 Å²	114.5	100%	1.276	69%	0.693	S	S	*	*			trans	-78.8	0	-178.1	-27.6	0	0	0	0	111.4	P91	P91-T93 PolarHBondContact O-N 3.04Å

Retrieved 93 of 93 residues in 49.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).