A0A5K4F3N2_SCHMA Loading...

Secreted protein AlphaSync

AlphaFold DB , UniProt , Accession A0A5K4F3N2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 106 aa.

						>A0A5K4F3N2_SCHMA|A0A5K4F3N2
MECLHIQSFIHISIMKLILIFALIISLLLNVTAESQASQKELFTESVKLWKSITELWKRFEHNCRVKIRKYLEEDNLGEKLAAVVSIYVKRLNKRLDMRLSEDRAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.6	Very low	50.8	Low	213 Å²	213	128.7 Å²	128.7	100%	1.049	65%	0.651	S	S	*	*				0	-30	0	-128.8	162.9	-172.1	0	0	112	C3 L4	M1-C3 PolarHBondContact O-N 3.46Å; M1-L4 PolarHBondContact O-N 3.14Å
2	E	47	Very low	51.6	Low	152 Å²	152	125.6 Å²	125.6	71%	0.71	64%	0.636	S	S	*	*	H	α-helix	trans	-58.5	-39.7	-178.1	-56.7	-64.4	87.8	0	0	115.9	L4 H5 I6	E2-L4 VanDerWaalsContact C-N 3.32Å; E2-L4 PolarHBondContact O-N 3.3Å; E2-H5 PolarHBondContact O-N 2.78Å; E2-I6 WeakPolarHBondContact O-CG1 3.17Å; E2-I6 PolarHBondContact O-N 3.36Å
3	C	44.8	Very low	52.3	Low	106 Å²	106	119.5 Å²	119.5	72%	0.716	61%	0.612	S	S	*	*	H	α-helix	trans	-62.7	-32.3	-177.5	-78.8	0	0	0	0	114.4	M1 H5 Q7	M1-C3 PolarHBondContact O-N 3.46Å; C3-H5 VanDerWaalsContact C-N 3.33Å; C3-Q7 PolarHBondContact O-N 2.74Å; C3-Q7 VanDerWaalsContact O-N 3.12Å
4	L	47.7	Very low	53.9	Low	137 Å²	137	116.9 Å²	116.9	72%	0.717	60%	0.599	S	S	*	*	H	α-helix	trans	-69.2	-34	178.7	-93.2	153.9	0	0	0	111.7	M1 E2 S8	M1-L4 PolarHBondContact O-N 3.14Å; E2-L4 VanDerWaalsContact C-N 3.32Å; E2-L4 PolarHBondContact O-N 3.3Å; L4-S8 PolarHBondContact O-N 3.18Å; L4-S8 VanDerWaalsContact O-N 3.13Å
5	H	48	Very low	55.2	Low	150 Å²	150	117.4 Å²	117.4	69%	0.694	60%	0.599	S	S	*	*	H	α-helix	trans	-72.9	-39.8	180	-139.8	-108	0	0	0	111.3	E2 C3 F9	E2-H5 PolarHBondContact O-N 2.78Å; C3-H5 VanDerWaalsContact C-N 3.33Å; H5-F9 WeakPolarHBondContact O-CB 3.07Å; H5-F9 PolarHBondContact O-N 3.48Å
6	I	53.6	Low	56.3	Low	101 Å²	101	118.4 Å²	118.4	52%	0.518	60%	0.598	S	S	.	*	H	α-helix	trans	-65.3	-44.2	176.7	-61.9	165.4	0	0	0	110.4	E2 F9 I10	E2-I6 WeakPolarHBondContact O-CG1 3.17Å; E2-I6 PolarHBondContact O-N 3.36Å; I6-F9 PolarHBondContact O-N 3.05Å; I6-I10 HydrophobicContact CG2-CD1 3.63Å; I6-I10 HydrophobicContact CG2-CG1 4.35Å; I6-I10 WeakPolarHBondContact O-CB 3.31Å; I6-I10 VanDerWaalsContact O-CG1 3.24Å; I6-I10 WeakPolarHBondContact O-CG1 2.94Å; I6-I10 PolarHBondContact O-N 3.06Å
7	Q	51.2	Low	57.2	Low	135 Å²	135	118.2 Å²	118.2	63%	0.631	60%	0.599	S	S	*	*	H	α-helix	trans	-66	-42.1	-179.9	-171.1	164.3	-27.7	0	0	112.4	C3 H11	C3-Q7 PolarHBondContact O-N 2.74Å; C3-Q7 VanDerWaalsContact O-N 3.12Å; Q7-H11 WeakPolarHBondContact O-CB 3.26Å; Q7-H11 PolarHBondContact O-N 3.47Å
8	S	53.3	Low	58.1	Low	70 Å²	70	117.7 Å²	117.7	49%	0.49	60%	0.596	S	S	.	*	H	α-helix	trans	-63.4	-42.8	174	-106.6	0	0	0	0	112.2	L4 I10 H11 I12	L4-S8 PolarHBondContact O-N 3.18Å; L4-S8 VanDerWaalsContact O-N 3.13Å; S8-I10 PolarHBondContact O-N 3.12Å; S8-H11 PolarHBondContact O-N 3.04Å; S8-I12 WeakPolarHBondContact O-CB 3.37Å; S8-I12 WeakPolarHBondContact O-CD1 3.33Å; S8-I12 WeakPolarHBondContact O-CG1 3.49Å; S8-I12 PolarHBondContact O-N 3.1Å
9	F	54.5	Low	58.9	Low	142 Å²	142	116.7 Å²	116.7	62%	0.623	59%	0.592	S	S	*	*	H	α-helix	trans	-65.7	-40.2	-179.8	-168.1	-94.6	0	0	0	112.5	H5 I6 S13	H5-F9 WeakPolarHBondContact O-CB 3.07Å; H5-F9 PolarHBondContact O-N 3.48Å; I6-F9 PolarHBondContact O-N 3.05Å; F9-S13 WeakPolarHBondContact O-CB 3.5Å; F9-S13 PolarHBondContact O-N 3.19Å; F9-S13 PolarHBondContact O-OG 2.77Å
10	I	57.6	Low	59.7	Low	82 Å²	82	115.6 Å²	115.6	42%	0.421	59%	0.587	S	S	.	*	H	α-helix	trans	-64.1	-47	174.2	-69.7	169.6	0	0	0	110.2	I6 S8 I12 S13 I14	I6-I10 HydrophobicContact CG2-CD1 3.63Å; I6-I10 HydrophobicContact CG2-CG1 4.35Å; I6-I10 WeakPolarHBondContact O-CB 3.31Å; I6-I10 VanDerWaalsContact O-CG1 3.24Å; I6-I10 WeakPolarHBondContact O-CG1 2.94Å; I6-I10 PolarHBondContact O-N 3.06Å; S8-I10 PolarHBondContact O-N 3.12Å; I10-I12 PolarHBondContact O-N 3.34Å; I10-S13 PolarHBondContact O-N 3.21Å; I10-I14 HydrophobicContact CG2-CD1 3.57Å; I10-I14 HydrophobicContact CG2-CG1 4.32Å; I10-I14 VanDerWaalsContact O-CG1 3.28Å; I10-I14 WeakPolarHBondContact O-CG1 3.32Å; I10-I14 PolarHBondContact O-N 2.93Å
11	H	54.1	Low	60.3	Low	128 Å²	128	113.8 Å²	113.8	59%	0.593	58%	0.575	S	S	*	*	H	α-helix	trans	-61.7	-45.2	179.3	-121.3	-99.4	0	0	0	112.2	Q7 S8 S13 I14 M15	Q7-H11 WeakPolarHBondContact O-CB 3.26Å; Q7-H11 PolarHBondContact O-N 3.47Å; S8-H11 PolarHBondContact O-N 3.04Å; H11-S13 VanDerWaalsContact C-N 3.3Å; H11-S13 PolarHBondContact O-N 2.68Å; H11-I14 PolarHBondContact O-N 3.06Å; H11-M15 WeakPolarHBondContact O-CB 3.43Å; H11-M15 PolarHBondContact O-N 3.22Å
12	I	61.2	Low	61.5	Low	91 Å²	91	105.9 Å²	105.9	47%	0.467	54%	0.544	S	S	.	.	H	α-helix	trans	-61.5	-41	177.6	-70.5	163.3	0	0	0	110.7	S8 I10 K16	S8-I12 WeakPolarHBondContact O-CB 3.37Å; S8-I12 WeakPolarHBondContact O-CD1 3.33Å; S8-I12 WeakPolarHBondContact O-CG1 3.49Å; S8-I12 PolarHBondContact O-N 3.1Å; I10-I12 PolarHBondContact O-N 3.34Å; I12-K16 HydrophobicContact CG2-CD 4.3Å; I12-K16 WeakPolarHBondContact O-CG 3.45Å; I12-K16 PolarHBondContact O-N 3.12Å
13	S	61	Low	62.8	Low	46 Å²	46	103.9 Å²	103.9	32%	0.322	54%	0.537	S	S	.	.	H	α-helix	trans	-68.7	-41.4	179.1	-62.7	0	0	0	0	112.2	F9 I10 H11 L17	F9-S13 WeakPolarHBondContact O-CB 3.5Å; F9-S13 PolarHBondContact O-N 3.19Å; F9-S13 PolarHBondContact O-OG 2.77Å; I10-S13 PolarHBondContact O-N 3.21Å; H11-S13 VanDerWaalsContact C-N 3.3Å; H11-S13 PolarHBondContact O-N 2.68Å; S13-L17 WeakPolarHBondContact O-CG 3.36Å; S13-L17 PolarHBondContact O-N 3.04Å; S13-L17 VanDerWaalsContact O-N 3.09Å
14	I	74.6	Confident	64.3	Low	84 Å²	84	103 Å²	103	43%	0.431	52%	0.524	S	S	.	.	H	α-helix	trans	-65.1	-44.9	177.1	-68.7	168.8	0	0	0	110.7	I10 H11 K16 L17 I18	I10-I14 HydrophobicContact CG2-CD1 3.57Å; I10-I14 HydrophobicContact CG2-CG1 4.32Å; I10-I14 VanDerWaalsContact O-CG1 3.28Å; I10-I14 WeakPolarHBondContact O-CG1 3.32Å; I10-I14 PolarHBondContact O-N 2.93Å; H11-I14 PolarHBondContact O-N 3.06Å; I14-K16 VanDerWaalsContact C-N 3.31Å; I14-K16 PolarHBondContact O-N 3.16Å; I14-L17 PolarHBondContact O-N 3.32Å; I14-L17 VanDerWaalsContact O-N 3.15Å; I14-I18 HydrophobicContact CG2-CD1 3.65Å; I14-I18 HydrophobicContact CG2-CG1 4.27Å; I14-I18 WeakPolarHBondContact O-CG1 3.48Å; I14-I18 PolarHBondContact O-N 3.46Å
15	M	73.5	Confident	65.6	Low	124 Å²	124	100.6 Å²	100.6	61%	0.611	51%	0.511	S	S	*	.	H	α-helix	trans	-62.6	-39.8	-178.2	-138.4	-179.2	123	0	0	111.9	H11 I18 L19	H11-M15 WeakPolarHBondContact O-CB 3.43Å; H11-M15 PolarHBondContact O-N 3.22Å; M15-I18 PolarHBondContact O-N 3.41Å; M15-L19 WeakPolarHBondContact O-CG 3.5Å; M15-L19 PolarHBondContact O-N 3.4Å
16	K	72.3	Confident	66.8	Low	134 Å²	134	96.5 Å²	96.5	58%	0.583	50%	0.5	S	S	*	.	H	α-helix	trans	-63.5	-44	173.7	-77.2	176	162.1	175.6	0	112.1	I12 I14 L19 I20	I12-K16 HydrophobicContact CG2-CD 4.3Å; I12-K16 WeakPolarHBondContact O-CG 3.45Å; I12-K16 PolarHBondContact O-N 3.12Å; I14-K16 VanDerWaalsContact C-N 3.31Å; I14-K16 PolarHBondContact O-N 3.16Å; K16-L19 PolarHBondContact O-N 3.5Å; K16-I20 VanDerWaalsContact O-CG1 3.28Å; K16-I20 WeakPolarHBondContact O-CG1 3.49Å; K16-I20 PolarHBondContact O-N 2.96Å
17	L	71.1	Confident	67.7	Low	115 Å²	115	97.1 Å²	97.1	60%	0.602	50%	0.503	S	S	*	.	H	α-helix	trans	-63.6	-42.7	178.3	-75.1	172.1	0	0	0	112	S13 I14 L19 I20 F21	S13-L17 WeakPolarHBondContact O-CG 3.36Å; S13-L17 PolarHBondContact O-N 3.04Å; S13-L17 VanDerWaalsContact O-N 3.09Å; I14-L17 PolarHBondContact O-N 3.32Å; I14-L17 VanDerWaalsContact O-N 3.15Å; L17-L19 VanDerWaalsContact C-N 3.34Å; L17-L19 PolarHBondContact O-N 2.93Å; L17-I20 PolarHBondContact O-N 3.5Å; L17-F21 WeakPolarHBondContact O-CB 2.98Å; L17-F21 PolarHBondContact O-N 2.65Å
18	I	73.7	Confident	68.3	Low	108 Å²	108	93.6 Å²	93.6	55%	0.554	49%	0.488	S	S	*	.	H	α-helix	trans	-61.7	-43.6	176.7	-66.8	168.4	0	0	0	110.6	I14 M15 F21 A22	I14-I18 HydrophobicContact CG2-CD1 3.65Å; I14-I18 HydrophobicContact CG2-CG1 4.27Å; I14-I18 WeakPolarHBondContact O-CG1 3.48Å; I14-I18 PolarHBondContact O-N 3.46Å; M15-I18 PolarHBondContact O-N 3.41Å; I18-F21 PolarHBondContact O-N 2.68Å; I18-A22 WeakPolarHBondContact O-CB 3.47Å; I18-A22 PolarHBondContact O-N 2.81Å
19	L	72.6	Confident	69	Low	100 Å²	100	95.8 Å²	95.8	52%	0.524	49%	0.494	S	S	.	.	H	α-helix	trans	-61.9	-44.6	176.7	-82.8	165.6	0	0	0	112.3	M15 K16 L17 F21 A22 L23	M15-L19 WeakPolarHBondContact O-CG 3.5Å; M15-L19 PolarHBondContact O-N 3.4Å; K16-L19 PolarHBondContact O-N 3.5Å; L17-L19 VanDerWaalsContact C-N 3.34Å; L17-L19 PolarHBondContact O-N 2.93Å; L19-F21 VanDerWaalsContact C-N 3.29Å; L19-F21 PolarHBondContact O-N 2.79Å; L19-A22 PolarHBondContact O-N 3.36Å; L19-L23 WeakPolarHBondContact O-CB 3.32Å; L19-L23 VanDerWaalsContact O-CG 3.3Å; L19-L23 WeakPolarHBondContact O-CG 3.15Å; L19-L23 PolarHBondContact O-N 2.99Å
20	I	75.7	Confident	69.5	Low	93 Å²	93	93.9 Å²	93.9	48%	0.477	49%	0.491	S	S	.	.	H	α-helix	trans	-60.2	-44	176	-68.1	163.9	0	0	0	110.1	K16 L17 L23 I24	K16-I20 VanDerWaalsContact O-CG1 3.28Å; K16-I20 WeakPolarHBondContact O-CG1 3.49Å; K16-I20 PolarHBondContact O-N 2.96Å; L17-I20 PolarHBondContact O-N 3.5Å; I20-L23 PolarHBondContact O-N 3.24Å; I20-I24 HydrophobicContact CG2-CD1 3.9Å; I20-I24 VanDerWaalsContact O-CG1 3.31Å; I20-I24 WeakPolarHBondContact O-CG1 3.37Å; I20-I24 PolarHBondContact O-N 3.32Å
21	F	73	Confident	69.7	Low	79 Å²	79	94.2 Å²	94.2	35%	0.346	50%	0.496	S	S	.	.	H	α-helix	trans	-63.8	-43.6	179.2	-140	-85.8	0	0	0	111.9	L17 I18 L19 L23 I24 I25 W57	L17-F21 WeakPolarHBondContact O-CB 2.98Å; L17-F21 PolarHBondContact O-N 2.65Å; I18-F21 PolarHBondContact O-N 2.68Å; L19-F21 VanDerWaalsContact C-N 3.29Å; L19-F21 PolarHBondContact O-N 2.79Å; F21-L23 VanDerWaalsContact C-N 3.34Å; F21-L23 PolarHBondContact O-N 2.88Å; F21-I24 PolarHBondContact O-N 2.91Å; F21-I25 HydrophobicContact CD1-CD1 3.73Å; F21-I25 HydrophobicContact CD1-CG1 4.32Å; F21-I25 HydrophobicContact CE1-CD1 4.03Å; F21-I25 WeakPolarHBondContact O-CG1 3.3Å; F21-I25 PolarHBondContact O-N 3.46Å; F21-W57 HydrophobicContact CE1-CE3 4.43Å; F21-W57 AromaticContact CE1-CZ3 3.65Å; F21-W57 HydrophobicContact CE1-CZ3 3.65Å; F21-W57 AromaticContact CZ-CE3 3.98Å; F21-W57 HydrophobicContact CZ-CE3 3.98Å; F21-W57 AromaticContact CZ-CZ3 3.49Å; F21-W57 HydrophobicContact CZ-CZ3 3.49Å; F21-W57 VanDerWaalsContact CZ-CZ3 3.49Å
22	A	71.9	Confident	69.9	Low	47 Å²	47	91.6 Å²	91.6	39%	0.388	49%	0.489	S	S	.	.	H	α-helix	trans	-63.6	-38.2	176.2	0	0	0	0	0	112.5	I18 L19 I25 S26	I18-A22 WeakPolarHBondContact O-CB 3.47Å; I18-A22 PolarHBondContact O-N 2.81Å; L19-A22 PolarHBondContact O-N 3.36Å; A22-I25 PolarHBondContact O-N 3.44Å; A22-S26 WeakPolarHBondContact O-CB 3.3Å; A22-S26 PolarHBondContact O-N 3.34Å; A22-S26 PolarHBondContact O-OG 3.48Å
23	L	73	Confident	69.6	Low	110 Å²	110	90.2 Å²	90.2	58%	0.576	49%	0.492	S	S	*	.	H	α-helix	trans	-65.3	-43.5	175.7	-75	170	0	0	0	111.7	L19 I20 F21 I25 S26 L27	L19-L23 WeakPolarHBondContact O-CB 3.32Å; L19-L23 VanDerWaalsContact O-CG 3.3Å; L19-L23 WeakPolarHBondContact O-CG 3.15Å; L19-L23 PolarHBondContact O-N 2.99Å; I20-L23 PolarHBondContact O-N 3.24Å; F21-L23 VanDerWaalsContact C-N 3.34Å; F21-L23 PolarHBondContact O-N 2.88Å; L23-I25 VanDerWaalsContact C-N 3.35Å; L23-I25 PolarHBondContact O-N 3Å; L23-S26 PolarHBondContact O-N 3.43Å; L23-L27 WeakPolarHBondContact O-CB 3.43Å; L23-L27 WeakPolarHBondContact O-CG 3.41Å; L23-L27 PolarHBondContact O-N 3.26Å
24	I	76.7	Confident	69.2	Low	86 Å²	86	96.5 Å²	96.5	44%	0.441	52%	0.516	S	S	.	.	H	α-helix	trans	-61.3	-45	177.2	-68.2	165.5	0	0	0	110.6	I20 F21 S26 L27 L28	I20-I24 HydrophobicContact CG2-CD1 3.9Å; I20-I24 VanDerWaalsContact O-CG1 3.31Å; I20-I24 WeakPolarHBondContact O-CG1 3.37Å; I20-I24 PolarHBondContact O-N 3.32Å; F21-I24 PolarHBondContact O-N 2.91Å; I24-S26 VanDerWaalsContact C-N 3.34Å; I24-S26 PolarHBondContact O-N 3.02Å; I24-L27 PolarHBondContact O-N 3.31Å; I24-L28 HydrophobicContact CG2-CD1 4.07Å; I24-L28 WeakPolarHBondContact O-CG 3.31Å; I24-L28 PolarHBondContact O-N 2.87Å
25	I	76	Confident	68	Low	88 Å²	88	94.1 Å²	94.1	45%	0.451	51%	0.507	S	S	.	.	H	α-helix	trans	-62.5	-42.8	177.3	-67.3	168.9	0	0	0	110.8	F21 A22 L23 L27 L28 L29	F21-I25 HydrophobicContact CD1-CD1 3.73Å; F21-I25 HydrophobicContact CD1-CG1 4.32Å; F21-I25 HydrophobicContact CE1-CD1 4.03Å; F21-I25 WeakPolarHBondContact O-CG1 3.3Å; F21-I25 PolarHBondContact O-N 3.46Å; A22-I25 PolarHBondContact O-N 3.44Å; L23-I25 VanDerWaalsContact C-N 3.35Å; L23-I25 PolarHBondContact O-N 3Å; I25-L27 PolarHBondContact O-N 3.48Å; I25-L28 PolarHBondContact O-N 3.07Å; I25-L29 PolarHBondContact O-N 2.74Å
26	S	72.3	Confident	67.1	Low	64 Å²	64	95.9 Å²	95.9	45%	0.448	51%	0.513	S	S	.	.	H	α-helix	trans	-64.5	-40.5	179.3	-57.4	0	0	0	0	112.3	A22 L23 I24 L29 N30	A22-S26 WeakPolarHBondContact O-CB 3.3Å; A22-S26 PolarHBondContact O-N 3.34Å; A22-S26 PolarHBondContact O-OG 3.48Å; L23-S26 PolarHBondContact O-N 3.43Å; I24-S26 VanDerWaalsContact C-N 3.34Å; I24-S26 PolarHBondContact O-N 3.02Å; S26-L29 PolarHBondContact O-N 3.47Å; S26-N30 PolarHBondContact O-N 2.78Å
27	L	72	Confident	66.1	Low	114 Å²	114	94.6 Å²	94.6	60%	0.597	53%	0.527	S	S	*	.	H	α-helix	trans	-62	-45	174.6	-81.9	158.9	0	0	0	111.6	L23 I24 I25 L29 N30 V31	L23-L27 WeakPolarHBondContact O-CB 3.43Å; L23-L27 WeakPolarHBondContact O-CG 3.41Å; L23-L27 PolarHBondContact O-N 3.26Å; I24-L27 PolarHBondContact O-N 3.31Å; I25-L27 PolarHBondContact O-N 3.48Å; L27-L29 VanDerWaalsContact C-N 3.33Å; L27-L29 PolarHBondContact O-N 3.48Å; L27-N30 PolarHBondContact O-N 3.48Å; L27-V31 WeakPolarHBondContact O-CG2 3.49Å; L27-V31 PolarHBondContact O-N 3.48Å; L27-V31 VanDerWaalsContact O-N 3.12Å
28	L	65.1	Low	65.3	Low	60 Å²	60	91.2 Å²	91.2	31%	0.314	51%	0.513	S	S	.	.	H	α-helix	trans	-61.5	-41.6	176.9	-74	166.4	0	0	0	111.7	I24 I25 V31 T32 I53	I24-L28 HydrophobicContact CG2-CD1 4.07Å; I24-L28 WeakPolarHBondContact O-CG 3.31Å; I24-L28 PolarHBondContact O-N 2.87Å; I25-L28 PolarHBondContact O-N 3.07Å; L28-V31 PolarHBondContact O-N 3.22Å; L28-T32 WeakPolarHBondContact O-CG2 3.37Å; L28-T32 PolarHBondContact O-N 3.43Å; L28-T32 PolarHBondContact O-OG1 2.97Å; L28-I53 HydrophobicContact CD1-CD1 3.74Å; L28-I53 HydrophobicContact CD1-CG1 4.41Å; L28-I53 HydrophobicContact CD2-CD1 4.32Å
29	L	66.3	Low	64.5	Low	116 Å²	116	93.4 Å²	93.4	61%	0.607	52%	0.522	S	S	*	.	H	α-helix	trans	-65.2	-44	179.3	-139	97.3	0	0	0	111.9	I25 S26 L27 V31 T32 A33	I25-L29 PolarHBondContact O-N 2.74Å; S26-L29 PolarHBondContact O-N 3.47Å; L27-L29 VanDerWaalsContact C-N 3.33Å; L27-L29 PolarHBondContact O-N 3.48Å; L29-V31 PolarHBondContact O-N 3.04Å; L29-T32 PolarHBondContact O-N 3.19Å; L29-T32 PolarHBondContact O-OG1 3.42Å; L29-A33 PolarHBondContact O-N 3.33Å; L29-A33 VanDerWaalsContact O-N 3.1Å
30	N	65.7	Low	63.8	Low	103 Å²	103	97.5 Å²	97.5	55%	0.551	54%	0.535	S	S	*	.	H	α-helix	trans	-63.4	-41	178.8	-78	-11.1	0	0	0	112.3	S26 L27 T32 A33 E34	S26-N30 PolarHBondContact O-N 2.78Å; L27-N30 PolarHBondContact O-N 3.48Å; N30-T32 VanDerWaalsContact C-N 3.25Å; N30-T32 PolarHBondContact O-N 3.37Å; N30-A33 PolarHBondContact O-N 3.34Å; N30-E34 PolarHBondContact O-N 3.48Å; N30-E34 VanDerWaalsContact O-N 3.14Å
31	V	62.5	Low	63.2	Low	89 Å²	89	99.3 Å²	99.3	54%	0.539	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-35	176.2	170.5	0	0	0	0	111.5	L27 L28 L29 S35	L27-V31 WeakPolarHBondContact O-CG2 3.49Å; L27-V31 PolarHBondContact O-N 3.48Å; L27-V31 VanDerWaalsContact O-N 3.12Å; L28-V31 PolarHBondContact O-N 3.22Å; L29-V31 PolarHBondContact O-N 3.04Å; V31-S35 PolarHBondContact O-OG 2.9Å
32	T	57.9	Low	62.8	Low	72 Å²	72	97.6 Å²	97.6	44%	0.442	54%	0.536	S	S	.	.	H	α-helix	trans	-74.2	-24.5	175.2	59.2	0	0	0	0	113.6	L28 L29 N30	L28-T32 WeakPolarHBondContact O-CG2 3.37Å; L28-T32 PolarHBondContact O-N 3.43Å; L28-T32 PolarHBondContact O-OG1 2.97Å; L29-T32 PolarHBondContact O-N 3.19Å; L29-T32 PolarHBondContact O-OG1 3.42Å; N30-T32 VanDerWaalsContact C-N 3.25Å; N30-T32 PolarHBondContact O-N 3.37Å
33	A	55.5	Low	62.5	Low	63 Å²	63	102.7 Å²	102.7	52%	0.521	55%	0.549	S	S	.	.	H	α-helix	trans	-80.7	-41.8	-178.3	0	0	0	0	0	112.7	L29 N30 S35	L29-A33 PolarHBondContact O-N 3.33Å; L29-A33 VanDerWaalsContact O-N 3.1Å; N30-A33 PolarHBondContact O-N 3.34Å; A33-S35 VanDerWaalsContact C-N 3.26Å; A33-S35 PolarHBondContact O-N 3.06Å
34	E	52	Low	62.2	Low	178 Å²	178	102 Å²	102	83%	0.832	55%	0.55	S	S	*	*	H	α-helix	trans	-71.4	-21.3	-178	-73.6	-175.4	178.1	0	0	113.4	N30 Q36	N30-E34 PolarHBondContact O-N 3.48Å; N30-E34 VanDerWaalsContact O-N 3.14Å; E34-Q36 PolarHBondContact O-N 3.5Å
35	S	49.5	Very low	61.9	Low	34 Å²	34	102.1 Å²	102.1	24%	0.238	55%	0.548	C	S	.	.	T	Hydrogen-bonded Turn	trans	-97.6	16.5	-166.3	58.6	0	0	0	0	115	V31 A33 A37 S38 L42	V31-S35 PolarHBondContact O-OG 2.9Å; A33-S35 VanDerWaalsContact C-N 3.26Å; A33-S35 PolarHBondContact O-N 3.06Å; S35-A37 PolarHBondContact O-N 3.26Å; S35-S38 PolarHBondContact O-N 2.93Å; S35-L42 VanDerWaalsContact C-CD1 3.44Å; S35-L42 WeakPolarHBondContact O-CD1 3.5Å; S35-L42 VanDerWaalsContact OG-CD1 3.31Å; S35-L42 WeakPolarHBondContact OG-CD1 3.28Å; S35-L42 WeakPolarHBondContact OG-CD2 3.44Å
36	Q	54	Low	61.5	Low	161 Å²	161	100 Å²	100	75%	0.752	54%	0.542	S	S	*	.	G	3₁₀ helix	trans	-41	-25.1	176.6	-89.7	-166.3	-1.3	0	0	115.3	E34 S38	E34-Q36 PolarHBondContact O-N 3.5Å; Q36-S38 VanDerWaalsContact C-N 3.3Å; Q36-S38 PolarHBondContact O-N 2.93Å
37	A	51.6	Low	61.6	Low	106 Å²	106	100 Å²	100	88%	0.876	54%	0.539	S	S	*	.	G	3₁₀ helix	trans	-64.5	-20.9	-177.5	0	0	0	0	0	115.7	S35	S35-A37 PolarHBondContact O-N 3.26Å
38	S	54	Low	61.7	Low	44 Å²	44	100.6 Å²	100.6	31%	0.308	54%	0.536	S	S	.	.	G	3₁₀ helix	trans	-131.5	59.4	-176.5	-156.6	0	0	0	0	112.2	S35 Q36 K40 E41 L42	S35-S38 PolarHBondContact O-N 2.93Å; Q36-S38 VanDerWaalsContact C-N 3.3Å; Q36-S38 PolarHBondContact O-N 2.93Å; S38-K40 PolarHBondContact O-N 2.88Å; S38-E41 PolarHBondContact O-N 3.23Å; S38-E41 WeakPolarHBondContact OG-CB 3.43Å; S38-E41 PolarHBondContact OG-OE2 3.49Å; S38-E41 VanDerWaalsContact OG-OE2 3.04Å; S38-L42 VanDerWaalsContact O-CB 3.26Å; S38-L42 WeakPolarHBondContact O-CB 3.45Å; S38-L42 VanDerWaalsContact O-CG 3.32Å; S38-L42 WeakPolarHBondContact O-CG 3.37Å; S38-L42 PolarHBondContact O-N 3.2Å
39	Q	56.9	Low	62.1	Low	155 Å²	155	101.1 Å²	101.1	72%	0.724	54%	0.539	S	S	*	.	H	α-helix	trans	-46.5	-33.7	-176.6	-71.2	-164.9	1.2	0	0	114.8	F43	Q39-F43 WeakPolarHBondContact O-CB 3.18Å; Q39-F43 PolarHBondContact O-N 2.8Å
40	K	58.9	Low	62.4	Low	185 Å²	185	104.1 Å²	104.1	80%	0.804	54%	0.543	S	S	*	.	H	α-helix	trans	-75.7	-49.3	178.4	-71.6	-174.5	178	178.8	0	112.8	S38 L42 F43 T44	S38-K40 PolarHBondContact O-N 2.88Å; K40-L42 VanDerWaalsContact C-N 3.3Å; K40-F43 PolarHBondContact O-N 3.36Å; K40-F43 VanDerWaalsContact O-N 3.16Å; K40-T44 PolarHBondContact O-N 2.94Å; K40-T44 VanDerWaalsContact O-N 3.12Å; K40-T44 PolarHBondContact O-OG1 3.29Å
41	E	63.2	Low	63	Low	131 Å²	131	105.8 Å²	105.8	61%	0.612	55%	0.545	S	S	*	.	H	α-helix	trans	-67.9	-37.4	179.3	-160.8	169.7	-162.3	0	0	110.6	S38 T44 E45	S38-E41 PolarHBondContact O-N 3.23Å; S38-E41 WeakPolarHBondContact OG-CB 3.43Å; S38-E41 PolarHBondContact OG-OE2 3.49Å; S38-E41 VanDerWaalsContact OG-OE2 3.04Å; E41-T44 WeakPolarHBondContact O-CB 3.38Å; E41-T44 PolarHBondContact O-N 3.48Å; E41-E45 WeakPolarHBondContact O-CB 3.37Å; E41-E45 PolarHBondContact O-N 3.18Å
42	L	62.9	Low	63.7	Low	43 Å²	43	104.3 Å²	104.3	23%	0.225	54%	0.538	C	S	.	.	H	α-helix	trans	-61.7	-40	168.5	-74.2	-170.8	0	0	0	113.5	S35 S38 K40 T44 E45 S46	S35-L42 VanDerWaalsContact C-CD1 3.44Å; S35-L42 WeakPolarHBondContact O-CD1 3.5Å; S35-L42 VanDerWaalsContact OG-CD1 3.31Å; S35-L42 WeakPolarHBondContact OG-CD1 3.28Å; S35-L42 WeakPolarHBondContact OG-CD2 3.44Å; S38-L42 VanDerWaalsContact O-CB 3.26Å; S38-L42 WeakPolarHBondContact O-CB 3.45Å; S38-L42 VanDerWaalsContact O-CG 3.32Å; S38-L42 WeakPolarHBondContact O-CG 3.37Å; S38-L42 PolarHBondContact O-N 3.2Å; K40-L42 VanDerWaalsContact C-N 3.3Å; L42-T44 PolarHBondContact O-N 2.76Å; L42-E45 PolarHBondContact O-N 2.86Å; L42-S46 WeakPolarHBondContact O-CA 3.21Å; L42-S46 WeakPolarHBondContact O-CB 3.39Å; L42-S46 PolarHBondContact O-N 3.42Å; L42-S46 PolarHBondContact O-OG 3.19Å
43	F	65.5	Low	64.6	Low	155 Å²	155	103.5 Å²	103.5	68%	0.68	53%	0.531	S	S	*	.	H	α-helix	trans	-63.5	-40.5	177.1	-139.6	-87.7	0	0	0	110	Q39 K40 V47	Q39-F43 WeakPolarHBondContact O-CB 3.18Å; Q39-F43 PolarHBondContact O-N 2.8Å; K40-F43 PolarHBondContact O-N 3.36Å; K40-F43 VanDerWaalsContact O-N 3.16Å; F43-V47 HydrophobicContact CD1-CG2 3.94Å; F43-V47 HydrophobicContact CE1-CG2 4.14Å; F43-V47 VanDerWaalsContact O-CB 3.32Å; F43-V47 WeakPolarHBondContact O-CB 3.44Å; F43-V47 WeakPolarHBondContact O-CG2 3.27Å; F43-V47 PolarHBondContact O-N 3.47Å
44	T	68.7	Low	65.6	Low	96 Å²	96	102.8 Å²	102.8	59%	0.589	52%	0.52	S	S	*	.	H	α-helix	trans	-64.5	-49.1	176.3	-53.8	0	0	0	0	112	K40 E41 L42 V47 K48	K40-T44 PolarHBondContact O-N 2.94Å; K40-T44 VanDerWaalsContact O-N 3.12Å; K40-T44 PolarHBondContact O-OG1 3.29Å; E41-T44 WeakPolarHBondContact O-CB 3.38Å; E41-T44 PolarHBondContact O-N 3.48Å; L42-T44 PolarHBondContact O-N 2.76Å; T44-V47 PolarHBondContact O-N 3.06Å; T44-K48 WeakPolarHBondContact O-CB 3.4Å; T44-K48 PolarHBondContact O-N 3.35Å
45	E	69.5	Low	66.9	Low	87 Å²	87	100.1 Å²	100.1	41%	0.407	51%	0.508	S	S	.	.	H	α-helix	trans	-68.5	-37.7	178.2	-72.1	-58.1	144.6	0	0	111.9	E41 L42 K48 L49	E41-E45 WeakPolarHBondContact O-CB 3.37Å; E41-E45 PolarHBondContact O-N 3.18Å; L42-E45 PolarHBondContact O-N 2.86Å; E45-K48 WeakPolarHBondContact O-CB 3.39Å; E45-K48 PolarHBondContact O-N 2.9Å; E45-L49 WeakPolarHBondContact O-CB 3.21Å; E45-L49 VanDerWaalsContact O-CG 3.3Å; E45-L49 WeakPolarHBondContact O-CG 3.43Å; E45-L49 PolarHBondContact O-N 3.47Å
46	S	67	Low	68.2	Low	44 Å²	44	104.1 Å²	104.1	31%	0.308	53%	0.526	S	S	.	.	H	α-helix	trans	-65.9	-40.5	175.2	-61.2	0	0	0	0	111.6	L42 K48 L49 W50	L42-S46 WeakPolarHBondContact O-CA 3.21Å; L42-S46 WeakPolarHBondContact O-CB 3.39Å; L42-S46 PolarHBondContact O-N 3.42Å; L42-S46 PolarHBondContact O-OG 3.19Å; S46-K48 VanDerWaalsContact C-N 3.3Å; S46-K48 PolarHBondContact O-N 2.68Å; S46-L49 PolarHBondContact O-N 2.9Å; S46-W50 WeakPolarHBondContact O-CB 3.36Å; S46-W50 PolarHBondContact O-N 3.15Å
47	V	74	Confident	69.1	Low	64 Å²	64	102.8 Å²	102.8	39%	0.388	51%	0.514	S	S	.	.	H	α-helix	trans	-64.4	-38.4	174	167.5	0	0	0	0	110.6	F43 T44 W50 K51	F43-V47 HydrophobicContact CD1-CG2 3.94Å; F43-V47 HydrophobicContact CE1-CG2 4.14Å; F43-V47 VanDerWaalsContact O-CB 3.32Å; F43-V47 WeakPolarHBondContact O-CB 3.44Å; F43-V47 WeakPolarHBondContact O-CG2 3.27Å; F43-V47 PolarHBondContact O-N 3.47Å; T44-V47 PolarHBondContact O-N 3.06Å; V47-W50 PolarHBondContact O-N 3.09Å; V47-K51 WeakPolarHBondContact O-CB 3.46Å; V47-K51 WeakPolarHBondContact O-CG 3.26Å; V47-K51 PolarHBondContact O-N 2.95Å
48	K	75.9	Confident	70.3	Confident	126 Å²	126	104.3 Å²	104.3	55%	0.548	50%	0.501	S	S	.	.	H	α-helix	trans	-66.1	-47	175.8	-170.8	-179.6	177.3	-172.7	0	111.4	T44 E45 S46 W50 K51 S52	T44-K48 WeakPolarHBondContact O-CB 3.4Å; T44-K48 PolarHBondContact O-N 3.35Å; E45-K48 WeakPolarHBondContact O-CB 3.39Å; E45-K48 PolarHBondContact O-N 2.9Å; S46-K48 VanDerWaalsContact C-N 3.3Å; S46-K48 PolarHBondContact O-N 2.68Å; K48-W50 PolarHBondContact O-N 3.42Å; K48-K51 PolarHBondContact O-N 3.25Å; K48-S52 PolarHBondContact O-N 3.01Å; K48-S52 PolarHBondContact O-OG 2.79Å
49	L	72.2	Confident	71.3	Confident	71 Å²	71	111.1 Å²	111.1	37%	0.372	52%	0.52	S	S	.	.	H	α-helix	trans	-60.2	-44.7	173.4	-72.3	172.5	0	0	0	111.1	E45 S46 K51 S52 I53	E45-L49 WeakPolarHBondContact O-CB 3.21Å; E45-L49 VanDerWaalsContact O-CG 3.3Å; E45-L49 WeakPolarHBondContact O-CG 3.43Å; E45-L49 PolarHBondContact O-N 3.47Å; S46-L49 PolarHBondContact O-N 2.9Å; L49-K51 VanDerWaalsContact C-N 3.33Å; L49-K51 PolarHBondContact O-N 3.32Å; L49-S52 PolarHBondContact O-N 2.72Å; L49-I53 WeakPolarHBondContact O-CB 3.17Å; L49-I53 WeakPolarHBondContact O-CD1 3.47Å; L49-I53 WeakPolarHBondContact O-CG1 3.34Å; L49-I53 PolarHBondContact O-N 3.31Å
50	W	73.1	Confident	72.1	Confident	180 Å²	180	108.5 Å²	108.5	68%	0.682	51%	0.506	S	S	*	.	H	α-helix	trans	-62.5	-40.5	178.4	-168.7	-105.7	0	0	0	111.7	S46 V47 K48 I53 T54	S46-W50 WeakPolarHBondContact O-CB 3.36Å; S46-W50 PolarHBondContact O-N 3.15Å; V47-W50 PolarHBondContact O-N 3.09Å; K48-W50 PolarHBondContact O-N 3.42Å; W50-I53 PolarHBondContact O-N 3.47Å; W50-T54 VanDerWaalsContact O-CB 3.26Å; W50-T54 WeakPolarHBondContact O-CB 3.35Å; W50-T54 PolarHBondContact O-N 2.87Å; W50-T54 PolarHBondContact O-OG1 3.36Å
51	K	77.6	Confident	72.7	Confident	138 Å²	138	104.5 Å²	104.5	60%	0.6	49%	0.49	S	S	*	.	H	α-helix	trans	-61.4	-48.3	171.9	-79.9	-178.8	179.4	-179.2	0	111.5	V47 K48 L49 I53 T54 E55	V47-K51 WeakPolarHBondContact O-CB 3.46Å; V47-K51 WeakPolarHBondContact O-CG 3.26Å; V47-K51 PolarHBondContact O-N 2.95Å; K48-K51 PolarHBondContact O-N 3.25Å; L49-K51 VanDerWaalsContact C-N 3.33Å; L49-K51 PolarHBondContact O-N 3.32Å; K51-I53 PolarHBondContact O-N 2.99Å; K51-T54 PolarHBondContact O-N 3.2Å; K51-E55 WeakPolarHBondContact O-CG 3.28Å; K51-E55 PolarHBondContact O-N 2.83Å
52	S	77.3	Confident	73.4	Confident	57 Å²	57	104 Å²	104	40%	0.399	49%	0.488	S	S	.	.	H	α-helix	trans	-62	-42.5	177.7	-63.3	0	0	0	0	112.3	K48 L49 T54 E55 L56	K48-S52 PolarHBondContact O-N 3.01Å; K48-S52 PolarHBondContact O-OG 2.79Å; L49-S52 PolarHBondContact O-N 2.72Å; S52-T54 VanDerWaalsContact C-N 3.35Å; S52-E55 PolarHBondContact O-N 3.48Å; S52-L56 WeakPolarHBondContact O-CB 3.39Å; S52-L56 VanDerWaalsContact O-CG 3.27Å; S52-L56 WeakPolarHBondContact O-CG 3.23Å; S52-L56 PolarHBondContact O-N 3.41Å
53	I	77.9	Confident	73.8	Confident	55 Å²	55	106.7 Å²	106.7	28%	0.282	50%	0.502	S	S	.	.	H	α-helix	trans	-62.4	-44.1	174.4	-69	163.2	0	0	0	109.9	L28 L49 W50 K51 E55 L56 W57	L28-I53 HydrophobicContact CD1-CD1 3.74Å; L28-I53 HydrophobicContact CD1-CG1 4.41Å; L28-I53 HydrophobicContact CD2-CD1 4.32Å; L49-I53 WeakPolarHBondContact O-CB 3.17Å; L49-I53 WeakPolarHBondContact O-CD1 3.47Å; L49-I53 WeakPolarHBondContact O-CG1 3.34Å; L49-I53 PolarHBondContact O-N 3.31Å; W50-I53 PolarHBondContact O-N 3.47Å; K51-I53 PolarHBondContact O-N 2.99Å; I53-E55 VanDerWaalsContact C-N 3.35Å; I53-E55 PolarHBondContact O-N 3.11Å; I53-L56 PolarHBondContact O-N 3.01Å; I53-W57 WeakPolarHBondContact O-CB 3.49Å; I53-W57 PolarHBondContact O-N 3.48Å
54	T	75.6	Confident	74	Confident	49 Å²	49	101 Å²	101	30%	0.301	48%	0.481	S	S	.	.	H	α-helix	trans	-64.7	-39.5	178.8	-57.7	0	0	0	0	111.4	W50 K51 S52 W57 K58	W50-T54 VanDerWaalsContact O-CB 3.26Å; W50-T54 WeakPolarHBondContact O-CB 3.35Å; W50-T54 PolarHBondContact O-N 2.87Å; W50-T54 PolarHBondContact O-OG1 3.36Å; K51-T54 PolarHBondContact O-N 3.2Å; S52-T54 VanDerWaalsContact C-N 3.35Å; T54-W57 PolarHBondContact O-N 2.84Å; T54-K58 WeakPolarHBondContact O-CB 3.4Å; T54-K58 WeakPolarHBondContact O-CG 3.48Å; T54-K58 PolarHBondContact O-N 3.14Å
55	E	79.8	Confident	74.1	Confident	122 Å²	122	104.8 Å²	104.8	57%	0.57	49%	0.485	S	S	*	.	H	α-helix	trans	-67	-44.4	175.2	-76.5	-179.8	-175	0	0	112.3	K51 S52 I53 W57 K58 R59	K51-E55 WeakPolarHBondContact O-CG 3.28Å; K51-E55 PolarHBondContact O-N 2.83Å; S52-E55 PolarHBondContact O-N 3.48Å; I53-E55 VanDerWaalsContact C-N 3.35Å; I53-E55 PolarHBondContact O-N 3.11Å; E55-W57 VanDerWaalsContact C-N 3.29Å; E55-W57 PolarHBondContact O-N 3.4Å; E55-K58 PolarHBondContact O-N 3.45Å; E55-R59 WeakPolarHBondContact O-CG 3.33Å; E55-R59 PolarHBondContact O-N 3.22Å
56	L	75.4	Confident	74.3	Confident	118 Å²	118	104.3 Å²	104.3	62%	0.618	49%	0.488	S	S	*	.	H	α-helix	trans	-60.5	-42.6	172.7	-74.5	172.3	0	0	0	110.7	S52 I53 R59 F60	S52-L56 WeakPolarHBondContact O-CB 3.39Å; S52-L56 VanDerWaalsContact O-CG 3.27Å; S52-L56 WeakPolarHBondContact O-CG 3.23Å; S52-L56 PolarHBondContact O-N 3.41Å; I53-L56 PolarHBondContact O-N 3.01Å; L56-R59 PolarHBondContact O-N 2.75Å; L56-F60 VanDerWaalsContact O-CB 3.23Å; L56-F60 WeakPolarHBondContact O-CB 3.34Å; L56-F60 PolarHBondContact O-N 3.25Å
57	W	73.1	Confident	74.6	Confident	132 Å²	132	108.7 Å²	108.7	50%	0.5	50%	0.501	S	S	.	.	H	α-helix	trans	-63.8	-42.4	177.3	-168.4	-95	0	0	0	111.3	F21 I53 T54 E55 R59 F60 E61	F21-W57 HydrophobicContact CE1-CE3 4.43Å; F21-W57 AromaticContact CE1-CZ3 3.65Å; F21-W57 HydrophobicContact CE1-CZ3 3.65Å; F21-W57 AromaticContact CZ-CE3 3.98Å; F21-W57 HydrophobicContact CZ-CE3 3.98Å; F21-W57 AromaticContact CZ-CZ3 3.49Å; F21-W57 HydrophobicContact CZ-CZ3 3.49Å; F21-W57 VanDerWaalsContact CZ-CZ3 3.49Å; I53-W57 WeakPolarHBondContact O-CB 3.49Å; I53-W57 PolarHBondContact O-N 3.48Å; T54-W57 PolarHBondContact O-N 2.84Å; E55-W57 VanDerWaalsContact C-N 3.29Å; E55-W57 PolarHBondContact O-N 3.4Å; W57-R59 PolarHBondContact O-N 3.44Å; W57-F60 CarbonylContact O-C 3.6Å; W57-F60 PolarHBondContact O-N 3.45Å; W57-E61 WeakPolarHBondContact O-CB 3.41Å; W57-E61 PolarHBondContact O-N 3.32Å
58	K	78.1	Confident	74.4	Confident	138 Å²	138	110.1 Å²	110.1	60%	0.6	51%	0.506	S	S	*	.	H	α-helix	trans	-62	-43.5	174.4	-78.5	179.2	179.5	-178.7	0	112.3	T54 E55 H62	T54-K58 WeakPolarHBondContact O-CB 3.4Å; T54-K58 WeakPolarHBondContact O-CG 3.48Å; T54-K58 PolarHBondContact O-N 3.14Å; E55-K58 PolarHBondContact O-N 3.45Å; K58-H62 WeakPolarHBondContact O-CB 3.46Å; K58-H62 PolarHBondContact O-N 3.49Å
59	R	74.7	Confident	73.9	Confident	187 Å²	187	111.9 Å²	111.9	71%	0.706	51%	0.509	S	S	*	.	H	α-helix	trans	-65.5	-41.7	176.2	-72.8	179.7	-177.4	-103.8	2.9	111.3	E55 L56 W57 H62 N63	E55-R59 WeakPolarHBondContact O-CG 3.33Å; E55-R59 PolarHBondContact O-N 3.22Å; L56-R59 PolarHBondContact O-N 2.75Å; W57-R59 PolarHBondContact O-N 3.44Å; R59-H62 PolarHBondContact O-N 3.33Å; R59-N63 WeakPolarHBondContact O-CB 3.42Å; R59-N63 PolarHBondContact O-N 3.45Å
60	F	73.7	Confident	74	Confident	100 Å²	100	114.6 Å²	114.6	44%	0.439	52%	0.518	S	S	.	.	H	α-helix	trans	-65	-48.6	176.5	-177.9	-99.5	0	0	0	111.1	L56 W57 H62 N63 C64	L56-F60 VanDerWaalsContact O-CB 3.23Å; L56-F60 WeakPolarHBondContact O-CB 3.34Å; L56-F60 PolarHBondContact O-N 3.25Å; W57-F60 CarbonylContact O-C 3.6Å; W57-F60 PolarHBondContact O-N 3.45Å; F60-H62 VanDerWaalsContact C-N 3.31Å; F60-H62 PolarHBondContact O-N 2.87Å; F60-N63 PolarHBondContact O-N 3.13Å; F60-C64 WeakPolarHBondContact CE1-SG 3.28Å; F60-C64 WeakPolarHBondContact CZ-SG 3.43Å; F60-C64 WeakPolarHBondContact O-CB 3.19Å; F60-C64 PolarHBondContact O-N 3.33Å; F60-C64 PolarHBondContact O-SG 3.49Å
61	E	72.3	Confident	73.4	Confident	101 Å²	101	112.8 Å²	112.8	47%	0.472	51%	0.512	S	S	.	.	H	α-helix	trans	-56.3	-45.7	175.4	-176.4	-173.1	175.5	0	0	110.7	W57 R65	W57-E61 WeakPolarHBondContact O-CB 3.41Å; W57-E61 PolarHBondContact O-N 3.32Å; E61-R65 WeakPolarHBondContact O-CB 3.48Å; E61-R65 PolarHBondContact O-N 2.95Å
62	H	77.4	Confident	72.8	Confident	120 Å²	120	108.6 Å²	108.6	56%	0.556	50%	0.496	S	S	*	.	H	α-helix	trans	-62.2	-50.4	176.7	-172.6	76.1	0	0	0	111.7	K58 R59 F60 C64 R65 V66	K58-H62 WeakPolarHBondContact O-CB 3.46Å; K58-H62 PolarHBondContact O-N 3.49Å; R59-H62 PolarHBondContact O-N 3.33Å; F60-H62 VanDerWaalsContact C-N 3.31Å; F60-H62 PolarHBondContact O-N 2.87Å; H62-C64 PolarHBondContact O-N 2.97Å; H62-R65 PolarHBondContact O-N 3.44Å; H62-V66 VanDerWaalsContact O-CG2 3.32Å; H62-V66 WeakPolarHBondContact O-CG2 3.4Å; H62-V66 PolarHBondContact O-N 2.72Å
63	N	71	Confident	72.5	Confident	100 Å²	100	111.7 Å²	111.7	54%	0.535	50%	0.504	S	S	.	.	H	α-helix	trans	-63.9	-40.9	179.1	-82	-7.9	0	0	0	112.5	R59 F60 V66 K67	R59-N63 WeakPolarHBondContact O-CB 3.42Å; R59-N63 PolarHBondContact O-N 3.45Å; F60-N63 PolarHBondContact O-N 3.13Å; N63-V66 PolarHBondContact O-N 3.23Å; N63-K67 WeakPolarHBondContact O-CB 3.36Å; N63-K67 WeakPolarHBondContact O-CG 3.49Å; N63-K67 PolarHBondContact O-N 3.39Å
64	C	69.7	Low	72	Confident	36 Å²	36	114.9 Å²	114.9	24%	0.243	52%	0.518	C	S	.	.	H	α-helix	trans	-64.1	-46.6	174.4	-81.3	0	0	0	0	110.5	F60 H62 V66 K67 I68	F60-C64 WeakPolarHBondContact CE1-SG 3.28Å; F60-C64 WeakPolarHBondContact CZ-SG 3.43Å; F60-C64 WeakPolarHBondContact O-CB 3.19Å; F60-C64 PolarHBondContact O-N 3.33Å; F60-C64 PolarHBondContact O-SG 3.49Å; H62-C64 PolarHBondContact O-N 2.97Å; C64-V66 VanDerWaalsContact C-N 3.32Å; C64-V66 PolarHBondContact O-N 2.94Å; C64-K67 PolarHBondContact O-N 2.92Å; C64-I68 HydrophobicContact CB-CD1 4.23Å; C64-I68 WeakPolarHBondContact O-CA 3.41Å; C64-I68 WeakPolarHBondContact O-CB 3.33Å; C64-I68 WeakPolarHBondContact O-CD1 3.15Å; C64-I68 WeakPolarHBondContact O-CG1 3.27Å; C64-I68 PolarHBondContact O-N 3.31Å
65	R	70.5	Confident	71.3	Confident	175 Å²	175	117.5 Å²	117.5	66%	0.66	53%	0.53	S	S	*	.	H	α-helix	trans	-59.5	-43.5	177.3	-179.3	-179	-102.2	-105.6	3.1	111.3	E61 H62 R69	E61-R65 WeakPolarHBondContact O-CB 3.48Å; E61-R65 PolarHBondContact O-N 2.95Å; H62-R65 PolarHBondContact O-N 3.44Å; R65-R69 WeakPolarHBondContact O-CB 3.45Å; R65-R69 PolarHBondContact O-N 2.7Å
66	V	74.1	Confident	70.5	Confident	77 Å²	77	118.1 Å²	118.1	47%	0.467	54%	0.537	S	S	.	.	H	α-helix	trans	-64.9	-47.3	177	172.1	0	0	0	0	111	H62 N63 C64 R69 K70	H62-V66 VanDerWaalsContact O-CG2 3.32Å; H62-V66 WeakPolarHBondContact O-CG2 3.4Å; H62-V66 PolarHBondContact O-N 2.72Å; N63-V66 PolarHBondContact O-N 3.23Å; C64-V66 VanDerWaalsContact C-N 3.32Å; C64-V66 PolarHBondContact O-N 2.94Å; V66-R69 PolarHBondContact O-N 3.5Å; V66-K70 WeakPolarHBondContact O-CB 3.24Å; V66-K70 PolarHBondContact O-N 3.23Å
67	K	73.2	Confident	70	Confident	136 Å²	136	116 Å²	116	59%	0.591	53%	0.526	S	S	*	.	H	α-helix	trans	-63.1	-50.8	177.6	-75.7	-177.4	177.3	-173.2	0	111.7	N63 C64 R69 K70 Y71	N63-K67 WeakPolarHBondContact O-CB 3.36Å; N63-K67 WeakPolarHBondContact O-CG 3.49Å; N63-K67 PolarHBondContact O-N 3.39Å; C64-K67 PolarHBondContact O-N 2.92Å; K67-R69 VanDerWaalsContact C-N 3.29Å; K67-R69 PolarHBondContact O-N 2.82Å; K67-K70 PolarHBondContact O-N 3.11Å; K67-K70 VanDerWaalsContact O-N 3.14Å; K67-Y71 HydrophobicContact CB-CD2 4.34Å; K67-Y71 HydrophobicContact CB-CE2 4.42Å; K67-Y71 WeakPolarHBondContact O-CB 3.09Å; K67-Y71 WeakPolarHBondContact O-CD2 3.37Å; K67-Y71 PolarHBondContact O-N 3.14Å
68	I	68.9	Low	69.5	Low	95 Å²	95	111.3 Å²	111.3	49%	0.487	52%	0.519	S	S	.	.	H	α-helix	trans	-56	-46.2	177.5	-71.3	167.7	0	0	0	109.5	C64 K70 Y71 L72	C64-I68 HydrophobicContact CB-CD1 4.23Å; C64-I68 WeakPolarHBondContact O-CA 3.41Å; C64-I68 WeakPolarHBondContact O-CB 3.33Å; C64-I68 WeakPolarHBondContact O-CD1 3.15Å; C64-I68 WeakPolarHBondContact O-CG1 3.27Å; C64-I68 PolarHBondContact O-N 3.31Å; I68-K70 PolarHBondContact O-N 3.22Å; I68-Y71 PolarHBondContact O-N 3.39Å; I68-L72 HydrophobicContact CG2-CD1 3.62Å; I68-L72 WeakPolarHBondContact O-CB 3.44Å; I68-L72 WeakPolarHBondContact O-CD1 3.13Å; I68-L72 PolarHBondContact O-N 2.88Å
69	R	67.2	Low	69	Low	163 Å²	163	112.8 Å²	112.8	62%	0.615	53%	0.528	S	S	*	.	H	α-helix	trans	-59.4	-48.1	176.6	-171.3	-177	-155.4	157.7	12.8	111.8	R65 V66 K67 Y71 L72 E73	R65-R69 WeakPolarHBondContact O-CB 3.45Å; R65-R69 PolarHBondContact O-N 2.7Å; V66-R69 PolarHBondContact O-N 3.5Å; K67-R69 VanDerWaalsContact C-N 3.29Å; K67-R69 PolarHBondContact O-N 2.82Å; R69-Y71 PolarHBondContact O-N 2.8Å; R69-L72 PolarHBondContact O-N 3.4Å; R69-E73 HydrophobicContact CG-CG 4.46Å; R69-E73 WeakPolarHBondContact CG-OE1 3.5Å; R69-E73 IonicContact NE-OE1 3.28Å; R69-E73 PolarHBondContact NE-OE1 2.99Å; R69-E73 WeakPolarHBondContact O-CB 3.47Å; R69-E73 WeakPolarHBondContact O-CG 3.36Å; R69-E73 PolarHBondContact O-N 2.85Å
70	K	72.7	Confident	68.8	Low	128 Å²	128	110.9 Å²	110.9	56%	0.557	53%	0.525	S	S	*	.	H	α-helix	trans	-61.6	-43.9	178.5	-171.8	175.7	174.8	179.7	0	111.8	V66 K67 I68 E73 E74	V66-K70 WeakPolarHBondContact O-CB 3.24Å; V66-K70 PolarHBondContact O-N 3.23Å; K67-K70 PolarHBondContact O-N 3.11Å; K67-K70 VanDerWaalsContact O-N 3.14Å; I68-K70 PolarHBondContact O-N 3.22Å; K70-E73 PolarHBondContact O-N 3.28Å; K70-E74 WeakPolarHBondContact CE-OE1 3.17Å; K70-E74 IonicContact NZ-OE1 3.94Å; K70-E74 WeakPolarHBondContact O-CB 3.33Å; K70-E74 WeakPolarHBondContact O-CG 3.12Å; K70-E74 PolarHBondContact O-N 3.02Å
71	Y	60.9	Low	68.5	Low	141 Å²	141	110.6 Å²	110.6	55%	0.553	53%	0.527	S	S	*	.	H	α-helix	trans	-63.5	-41.6	174.1	-81.6	-68.7	0	0	0	112.1	K67 I68 R69 E73 D75	K67-Y71 HydrophobicContact CB-CD2 4.34Å; K67-Y71 HydrophobicContact CB-CE2 4.42Å; K67-Y71 WeakPolarHBondContact O-CB 3.09Å; K67-Y71 WeakPolarHBondContact O-CD2 3.37Å; K67-Y71 PolarHBondContact O-N 3.14Å; I68-Y71 PolarHBondContact O-N 3.39Å; R69-Y71 PolarHBondContact O-N 2.8Å; Y71-E73 VanDerWaalsContact C-N 3.35Å; Y71-D75 WeakPolarHBondContact O-CB 3.49Å; Y71-D75 PolarHBondContact O-N 3.2Å
72	L	65.4	Low	68.6	Low	50 Å²	50	108.7 Å²	108.7	26%	0.262	53%	0.529	S	S	.	.	H	α-helix	trans	-67.6	-34.8	177.7	-98.4	74.2	0	0	0	112.7	I68 R69 N76 L77 G78 L81	I68-L72 HydrophobicContact CG2-CD1 3.62Å; I68-L72 WeakPolarHBondContact O-CB 3.44Å; I68-L72 WeakPolarHBondContact O-CD1 3.13Å; I68-L72 PolarHBondContact O-N 2.88Å; R69-L72 PolarHBondContact O-N 3.4Å; L72-N76 CarbonylContact O-C 3.52Å; L72-N76 WeakPolarHBondContact O-CA 3.32Å; L72-N76 PolarHBondContact O-N 3.12Å; L72-L77 HydrophobicContact CG-CB 4.27Å; L72-L77 PolarHBondContact O-N 2.72Å; L72-G78 PolarHBondContact O-N 3.46Å; L72-L81 HydrophobicContact CD2-CD2 3.94Å
73	E	69.7	Low	68.6	Low	123 Å²	123	105.2 Å²	105.2	58%	0.575	52%	0.521	S	S	*	.	H	α-helix	trans	-72.2	-46.5	175.4	-76.6	172.5	-171	0	0	110.8	R69 K70 Y71 D75 N76	R69-E73 HydrophobicContact CG-CG 4.46Å; R69-E73 WeakPolarHBondContact CG-OE1 3.5Å; R69-E73 IonicContact NE-OE1 3.28Å; R69-E73 PolarHBondContact NE-OE1 2.99Å; R69-E73 WeakPolarHBondContact O-CB 3.47Å; R69-E73 WeakPolarHBondContact O-CG 3.36Å; R69-E73 PolarHBondContact O-N 2.85Å; K70-E73 PolarHBondContact O-N 3.28Å; Y71-E73 VanDerWaalsContact C-N 3.35Å; E73-D75 PolarHBondContact O-N 3.28Å; E73-N76 PolarHBondContact O-N 3.25Å
74	E	67.8	Low	68.9	Low	121 Å²	121	104.3 Å²	104.3	57%	0.565	52%	0.519	S	S	*	.	H	α-helix	trans	-60.5	-43.4	177.3	-78.5	176.8	-175.5	0	0	112.1	K70 N76	K70-E74 WeakPolarHBondContact CE-OE1 3.17Å; K70-E74 IonicContact NZ-OE1 3.94Å; K70-E74 WeakPolarHBondContact O-CB 3.33Å; K70-E74 WeakPolarHBondContact O-CG 3.12Å; K70-E74 PolarHBondContact O-N 3.02Å; E74-N76 VanDerWaalsContact C-N 3.31Å; E74-N76 PolarHBondContact O-N 3.18Å
75	D	62.4	Low	69	Low	105 Å²	105	106.5 Å²	106.5	56%	0.561	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.3	1.4	-179.8	-72.2	-31.1	0	0	0	113.7	Y71 E73 L77	Y71-D75 WeakPolarHBondContact O-CB 3.49Å; Y71-D75 PolarHBondContact O-N 3.2Å; E73-D75 PolarHBondContact O-N 3.28Å; D75-L77 HydrophobicContact CB-CB 4.23Å; D75-L77 HydrophobicContact CB-CD1 3.39Å; D75-L77 HydrophobicContact CB-CG 3.58Å; D75-L77 PolarHBondContact O-N 3.28Å
76	N	62.7	Low	69.5	Low	134 Å²	134	100.7 Å²	100.7	72%	0.717	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.7	23.8	-168.9	-76	-60.9	0	0	0	113.6	L72 E73 E74 G78	L72-N76 CarbonylContact O-C 3.52Å; L72-N76 WeakPolarHBondContact O-CA 3.32Å; L72-N76 PolarHBondContact O-N 3.12Å; E73-N76 PolarHBondContact O-N 3.25Å; E74-N76 VanDerWaalsContact C-N 3.31Å; E74-N76 PolarHBondContact O-N 3.18Å; N76-G78 PolarHBondContact O-N 3.4Å
77	L	64.5	Low	69.8	Low	73 Å²	73	101.5 Å²	101.5	38%	0.382	52%	0.517	S	S	.	.	H	α-helix	trans	-73.2	-15.9	-177.5	-79.4	164.9	0	0	0	112.1	L72 D75 E79 K80 L81	L72-L77 HydrophobicContact CG-CB 4.27Å; L72-L77 PolarHBondContact O-N 2.72Å; D75-L77 HydrophobicContact CB-CB 4.23Å; D75-L77 HydrophobicContact CB-CD1 3.39Å; D75-L77 HydrophobicContact CB-CG 3.58Å; D75-L77 PolarHBondContact O-N 3.28Å; L77-E79 VanDerWaalsContact C-N 3.34Å; L77-E79 PolarHBondContact O-N 2.91Å; L77-K80 HydrophobicContact CD2-CD 4.34Å; L77-K80 PolarHBondContact O-N 2.92Å; L77-L81 WeakPolarHBondContact O-CB 3.3Å; L77-L81 PolarHBondContact O-N 3.29Å
78	G	63	Low	69.9	Low	34 Å²	34	102 Å²	102	35%	0.351	52%	0.517	S	S	.	.	H	α-helix	trans	-52.8	-48.4	179	0	0	0	0	0	113	L72 N76 A82	L72-G78 PolarHBondContact O-N 3.46Å; N76-G78 PolarHBondContact O-N 3.4Å; G78-A82 VanDerWaalsContact O-CB 3.32Å; G78-A82 WeakPolarHBondContact O-CB 3.12Å; G78-A82 PolarHBondContact O-N 3.48Å
79	E	68	Low	70.5	Confident	170 Å²	170	100.7 Å²	100.7	79%	0.794	51%	0.513	S	S	*	.	H	α-helix	trans	-66.9	-41.5	178.4	-67.1	-168.4	164.6	0	0	112	L77 A82 A83	L77-E79 VanDerWaalsContact C-N 3.34Å; L77-E79 PolarHBondContact O-N 2.91Å; E79-A82 PolarHBondContact O-N 2.83Å; E79-A83 WeakPolarHBondContact O-CB 3.48Å; E79-A83 PolarHBondContact O-N 3.43Å
80	K	69.4	Low	71.4	Confident	146 Å²	146	100.3 Å²	100.3	64%	0.635	52%	0.516	S	S	*	.	H	α-helix	trans	-66.9	-41	179.9	-166.5	174	-177.2	179.3	0	111.6	L77 A83 V84	L77-K80 HydrophobicContact CD2-CD 4.34Å; L77-K80 PolarHBondContact O-N 2.92Å; K80-A83 WeakPolarHBondContact O-CB 3.27Å; K80-A83 PolarHBondContact O-N 2.87Å; K80-V84 VanDerWaalsContact O-CG2 3.3Å; K80-V84 WeakPolarHBondContact O-CG2 3.34Å; K80-V84 PolarHBondContact O-N 2.83Å
81	L	68.5	Low	71.8	Confident	95 Å²	95	102.4 Å²	102.4	50%	0.497	52%	0.52	S	S	.	.	H	α-helix	trans	-67.6	-41.9	176.6	-163	74.2	0	0	0	110.7	L72 L77 A83 V84 V85	L72-L81 HydrophobicContact CD2-CD2 3.94Å; L77-L81 WeakPolarHBondContact O-CB 3.3Å; L77-L81 PolarHBondContact O-N 3.29Å; L81-A83 VanDerWaalsContact C-N 3.31Å; L81-A83 PolarHBondContact O-N 2.76Å; L81-V84 PolarHBondContact O-N 3.47Å; L81-V85 WeakPolarHBondContact O-CB 3.34Å; L81-V85 VanDerWaalsContact O-CG2 3.31Å; L81-V85 WeakPolarHBondContact O-CG2 3.44Å; L81-V85 PolarHBondContact O-N 3.19Å
82	A	74.1	Confident	72.7	Confident	61 Å²	61	98.6 Å²	98.6	50%	0.504	51%	0.509	S	S	.	.	H	α-helix	trans	-59.3	-42.2	173.2	0	0	0	0	0	111.6	G78 E79 V85 S86	G78-A82 VanDerWaalsContact O-CB 3.32Å; G78-A82 WeakPolarHBondContact O-CB 3.12Å; G78-A82 PolarHBondContact O-N 3.48Å; E79-A82 PolarHBondContact O-N 2.83Å; A82-V85 PolarHBondContact O-N 2.91Å; A82-S86 WeakPolarHBondContact O-CB 3.31Å; A82-S86 PolarHBondContact O-N 3.45Å
83	A	76.7	Confident	73.6	Confident	46 Å²	46	100.3 Å²	100.3	38%	0.38	52%	0.519	S	S	.	.	H	α-helix	trans	-61.4	-47.2	174.4	0	0	0	0	0	111.6	E79 K80 L81 S86 I87	E79-A83 WeakPolarHBondContact O-CB 3.48Å; E79-A83 PolarHBondContact O-N 3.43Å; K80-A83 WeakPolarHBondContact O-CB 3.27Å; K80-A83 PolarHBondContact O-N 2.87Å; L81-A83 VanDerWaalsContact C-N 3.31Å; L81-A83 PolarHBondContact O-N 2.76Å; A83-S86 PolarHBondContact O-N 3.4Å; A83-S86 PolarHBondContact O-OG 3.22Å; A83-I87 VanDerWaalsContact O-CG1 3.32Å; A83-I87 WeakPolarHBondContact O-CG1 3.38Å; A83-I87 PolarHBondContact O-N 2.93Å
84	V	76.8	Confident	74.4	Confident	82 Å²	82	101.3 Å²	101.3	50%	0.497	52%	0.521	S	S	.	.	H	α-helix	trans	-61.4	-45.9	177.5	171.7	0	0	0	0	111.6	K80 L81 S86 I87 Y88	K80-V84 VanDerWaalsContact O-CG2 3.3Å; K80-V84 WeakPolarHBondContact O-CG2 3.34Å; K80-V84 PolarHBondContact O-N 2.83Å; L81-V84 PolarHBondContact O-N 3.47Å; V84-S86 VanDerWaalsContact C-N 3.32Å; V84-S86 PolarHBondContact O-N 3.25Å; V84-I87 PolarHBondContact O-N 3.46Å; V84-Y88 WeakPolarHBondContact O-CB 3.38Å; V84-Y88 PolarHBondContact O-N 3.36Å
85	V	73.4	Confident	75	Confident	81 Å²	81	101.9 Å²	101.9	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-61.6	-42.4	176.4	172.2	0	0	0	0	110.4	L81 A82 I87 Y88 V89	L81-V85 WeakPolarHBondContact O-CB 3.34Å; L81-V85 VanDerWaalsContact O-CG2 3.31Å; L81-V85 WeakPolarHBondContact O-CG2 3.44Å; L81-V85 PolarHBondContact O-N 3.19Å; A82-V85 PolarHBondContact O-N 2.91Å; V85-I87 VanDerWaalsContact C-N 3.32Å; V85-I87 PolarHBondContact O-N 3.25Å; V85-Y88 PolarHBondContact O-N 3Å; V85-V89 HydrophobicContact CG1-CG2 4.18Å; V85-V89 WeakPolarHBondContact O-CB 3.49Å; V85-V89 WeakPolarHBondContact O-CG2 3.42Å; V85-V89 PolarHBondContact O-N 3.49Å
86	S	79.2	Confident	75.9	Confident	53 Å²	53	101.6 Å²	101.6	37%	0.371	52%	0.516	S	S	.	.	H	α-helix	trans	-61.2	-40.4	177.2	85	0	0	0	0	112.3	A82 A83 V84 K90	A82-S86 WeakPolarHBondContact O-CB 3.31Å; A82-S86 PolarHBondContact O-N 3.45Å; A83-S86 PolarHBondContact O-N 3.4Å; A83-S86 PolarHBondContact O-OG 3.22Å; V84-S86 VanDerWaalsContact C-N 3.32Å; V84-S86 PolarHBondContact O-N 3.25Å; S86-K90 WeakPolarHBondContact O-CB 3.4Å; S86-K90 VanDerWaalsContact O-CG 3.27Å; S86-K90 WeakPolarHBondContact O-CG 3.5Å; S86-K90 PolarHBondContact O-N 2.99Å
87	I	81.8	Confident	76.8	Confident	94 Å²	94	100.1 Å²	100.1	48%	0.482	51%	0.508	S	S	.	.	H	α-helix	trans	-67.1	-42	176.8	-67.8	164.2	0	0	0	109.8	A83 V84 V85 K90 R91	A83-I87 VanDerWaalsContact O-CG1 3.32Å; A83-I87 WeakPolarHBondContact O-CG1 3.38Å; A83-I87 PolarHBondContact O-N 2.93Å; V84-I87 PolarHBondContact O-N 3.46Å; V85-I87 VanDerWaalsContact C-N 3.32Å; V85-I87 PolarHBondContact O-N 3.25Å; I87-K90 PolarHBondContact O-N 2.93Å; I87-R91 WeakPolarHBondContact O-CB 3.33Å; I87-R91 PolarHBondContact O-N 3.46Å
88	Y	75.4	Confident	77.5	Confident	147 Å²	147	101.1 Å²	101.1	58%	0.576	51%	0.512	S	S	*	.	H	α-helix	trans	-64.7	-46.8	179.1	-166	-105	0	0	0	111.8	V84 V85 R91 L92	V84-Y88 WeakPolarHBondContact O-CB 3.38Å; V84-Y88 PolarHBondContact O-N 3.36Å; V85-Y88 PolarHBondContact O-N 3Å; Y88-R91 PolarHBondContact O-N 2.98Å; Y88-L92 HydrophobicContact CD1-CD1 3.69Å; Y88-L92 HydrophobicContact CD1-CG 4.24Å; Y88-L92 HydrophobicContact CE1-CD1 3.35Å; Y88-L92 HydrophobicContact CE1-CG 3.99Å; Y88-L92 WeakPolarHBondContact O-CG 3.37Å; Y88-L92 PolarHBondContact O-N 3.4Å
89	V	80.9	Confident	78.2	Confident	68 Å²	68	107 Å²	107	41%	0.412	52%	0.524	S	S	.	.	H	α-helix	trans	-61.9	-45.1	175.4	172	0	0	0	0	110.9	V85 R91 L92 N93	V85-V89 HydrophobicContact CG1-CG2 4.18Å; V85-V89 WeakPolarHBondContact O-CB 3.49Å; V85-V89 WeakPolarHBondContact O-CG2 3.42Å; V85-V89 PolarHBondContact O-N 3.49Å; V89-R91 VanDerWaalsContact C-N 3.3Å; V89-R91 PolarHBondContact O-N 2.82Å; V89-L92 PolarHBondContact O-N 3.14Å; V89-N93 WeakPolarHBondContact O-CB 3.46Å; V89-N93 PolarHBondContact O-N 2.97Å
90	K	85.6	Confident	78.5	Confident	154 Å²	154	104 Å²	104	67%	0.67	51%	0.512	S	S	*	.	H	α-helix	trans	-58.1	-42.3	174.7	-79.5	178.4	179.7	-178.9	0	112	S86 I87 K94	S86-K90 WeakPolarHBondContact O-CB 3.4Å; S86-K90 VanDerWaalsContact O-CG 3.27Å; S86-K90 WeakPolarHBondContact O-CG 3.5Å; S86-K90 PolarHBondContact O-N 2.99Å; I87-K90 PolarHBondContact O-N 2.93Å; K90-K94 WeakPolarHBondContact O-CB 3.15Å; K90-K94 PolarHBondContact O-N 3.35Å
91	R	81.8	Confident	78.6	Confident	172 Å²	172	100.5 Å²	100.5	65%	0.649	51%	0.507	S	S	*	.	H	α-helix	trans	-69	-38.5	178.7	-169.3	-179.1	-69.9	-170.2	-2.3	111.8	I87 Y88 V89 R95	I87-R91 WeakPolarHBondContact O-CB 3.33Å; I87-R91 PolarHBondContact O-N 3.46Å; Y88-R91 PolarHBondContact O-N 2.98Å; V89-R91 VanDerWaalsContact C-N 3.3Å; V89-R91 PolarHBondContact O-N 2.82Å; R91-R95 WeakPolarHBondContact O-CG 3.37Å; R91-R95 PolarHBondContact O-N 2.87Å; R91-R95 VanDerWaalsContact O-N 3.11Å
92	L	80.6	Confident	78.7	Confident	62 Å²	62	101.9 Å²	101.9	33%	0.325	51%	0.51	S	S	.	.	H	α-helix	trans	-67.1	-46.3	175.2	-78.4	179.2	0	0	0	112	Y88 V89 K94 R95 L96	Y88-L92 HydrophobicContact CD1-CD1 3.69Å; Y88-L92 HydrophobicContact CD1-CG 4.24Å; Y88-L92 HydrophobicContact CE1-CD1 3.35Å; Y88-L92 HydrophobicContact CE1-CG 3.99Å; Y88-L92 WeakPolarHBondContact O-CG 3.37Å; Y88-L92 PolarHBondContact O-N 3.4Å; V89-L92 PolarHBondContact O-N 3.14Å; L92-K94 VanDerWaalsContact C-N 3.29Å; L92-K94 PolarHBondContact O-N 3.38Å; L92-R95 WeakPolarHBondContact O-CA 3.32Å; L92-R95 WeakPolarHBondContact O-CB 3.49Å; L92-R95 PolarHBondContact O-N 2.96Å; L92-L96 PolarHBondContact O-N 2.78Å
93	N	83.5	Confident	78.3	Confident	86 Å²	86	104.8 Å²	104.8	46%	0.46	52%	0.518	S	S	.	.	H	α-helix	trans	-57.8	-44.2	174.9	-77.2	-4.9	0	0	0	110.7	V89 R95 L96 D97	V89-N93 WeakPolarHBondContact O-CB 3.46Å; V89-N93 PolarHBondContact O-N 2.97Å; N93-R95 VanDerWaalsContact C-N 3.28Å; N93-R95 PolarHBondContact O-N 2.97Å; N93-L96 PolarHBondContact O-N 2.85Å; N93-L96 VanDerWaalsContact O-N 3.11Å; N93-D97 WeakPolarHBondContact O-CB 3.4Å; N93-D97 PolarHBondContact O-N 3.48Å
94	K	85.6	Confident	77.5	Confident	143 Å²	143	113.1 Å²	113.1	62%	0.622	54%	0.539	S	S	*	.	H	α-helix	trans	-58.3	-38.6	174.4	-171.8	174.6	-178.1	177.5	0	112.8	K90 L92 M98	K90-K94 WeakPolarHBondContact O-CB 3.15Å; K90-K94 PolarHBondContact O-N 3.35Å; L92-K94 VanDerWaalsContact C-N 3.29Å; L92-K94 PolarHBondContact O-N 3.38Å; K94-M98 VanDerWaalsContact O-CG 3.27Å; K94-M98 WeakPolarHBondContact O-CG 3.32Å; K94-M98 PolarHBondContact O-N 3.43Å; K94-M98 VanDerWaalsContact O-N 3.14Å
95	R	81.6	Confident	76.7	Confident	134 Å²	134	113.4 Å²	113.4	51%	0.506	55%	0.55	S	S	.	*	H	α-helix	trans	-70.6	-36.9	176.1	-70.5	177.4	76	-168.2	5.2	112.5	R91 L92 N93 M98 R99	R91-R95 WeakPolarHBondContact O-CG 3.37Å; R91-R95 PolarHBondContact O-N 2.87Å; R91-R95 VanDerWaalsContact O-N 3.11Å; L92-R95 WeakPolarHBondContact O-CA 3.32Å; L92-R95 WeakPolarHBondContact O-CB 3.49Å; L92-R95 PolarHBondContact O-N 2.96Å; N93-R95 VanDerWaalsContact C-N 3.28Å; N93-R95 PolarHBondContact O-N 2.97Å; R95-M98 HydrophobicContact CB-CE 4.47Å; R95-M98 HydrophobicContact CG-CE 4.13Å; R95-R99 WeakPolarHBondContact O-CG 3.32Å; R95-R99 PolarHBondContact O-N 3.22Å
96	L	80	Confident	75.5	Confident	98 Å²	98	120.4 Å²	120.4	51%	0.513	58%	0.577	S	S	.	*	H	α-helix	trans	-67.8	-45.2	175.7	-98.5	155	0	0	0	111.4	L92 N93 M98 R99 L100	L92-L96 PolarHBondContact O-N 2.78Å; N93-L96 PolarHBondContact O-N 2.85Å; N93-L96 VanDerWaalsContact O-N 3.11Å; L96-M98 VanDerWaalsContact C-N 3.34Å; L96-M98 PolarHBondContact O-N 3.19Å; L96-R99 PolarHBondContact O-N 2.88Å; L96-L100 WeakPolarHBondContact O-CB 2.99Å; L96-L100 WeakPolarHBondContact O-CG 3.47Å; L96-L100 PolarHBondContact O-N 2.73Å
97	D	82.7	Confident	75.3	Confident	104 Å²	104	123.8 Å²	123.8	56%	0.556	59%	0.588	S	S	*	*	H	α-helix	trans	-61.6	-41.5	177.3	-72.4	-19.9	0	0	0	111.5	N93 L100 S101	N93-D97 WeakPolarHBondContact O-CB 3.4Å; N93-D97 PolarHBondContact O-N 3.48Å; D97-L100 PolarHBondContact O-N 3.46Å; D97-S101 WeakPolarHBondContact O-CB 3.42Å; D97-S101 PolarHBondContact O-N 2.78Å; D97-S101 PolarHBondContact O-OG 2.95Å
98	M	79.3	Confident	75	Confident	93 Å²	93	125.3 Å²	125.3	46%	0.458	59%	0.593	S	S	.	*	H	α-helix	trans	-59.8	-48.2	174.4	-73.8	-176.1	-53.3	0	0	111.4	K94 R95 L96 L100 S101 E102	K94-M98 VanDerWaalsContact O-CG 3.27Å; K94-M98 WeakPolarHBondContact O-CG 3.32Å; K94-M98 PolarHBondContact O-N 3.43Å; K94-M98 VanDerWaalsContact O-N 3.14Å; R95-M98 HydrophobicContact CB-CE 4.47Å; R95-M98 HydrophobicContact CG-CE 4.13Å; L96-M98 VanDerWaalsContact C-N 3.34Å; L96-M98 PolarHBondContact O-N 3.19Å; M98-L100 PolarHBondContact O-N 3.32Å; M98-S101 PolarHBondContact O-N 3.38Å; M98-S101 PolarHBondContact O-OG 2.93Å; M98-E102 WeakPolarHBondContact O-CG 3.35Å; M98-E102 PolarHBondContact O-N 3.35Å
99	R	76.7	Confident	75	Confident	158 Å²	158	124.1 Å²	124.1	60%	0.596	59%	0.594	S	S	*	*	H	α-helix	trans	-65	-39	178.5	-70.8	-174	-177	-72.6	5.6	112.9	R95 L96 S101 E102 D103	R95-R99 WeakPolarHBondContact O-CG 3.32Å; R95-R99 PolarHBondContact O-N 3.22Å; L96-R99 PolarHBondContact O-N 2.88Å; R99-S101 VanDerWaalsContact C-N 3.32Å; R99-E102 PolarHBondContact O-N 2.86Å; R99-D103 PolarHBondContact O-N 3.37Å; R99-D103 VanDerWaalsContact O-N 3.14Å
100	L	74.8	Confident	74.6	Confident	106 Å²	106	127.4 Å²	127.4	56%	0.555	61%	0.605	S	S	*	*	H	α-helix	trans	-69.7	-29.9	176.5	-78.4	168.1	0	0	0	112.5	L96 D97 M98 R104	L96-L100 WeakPolarHBondContact O-CB 2.99Å; L96-L100 WeakPolarHBondContact O-CG 3.47Å; L96-L100 PolarHBondContact O-N 2.73Å; D97-L100 PolarHBondContact O-N 3.46Å; M98-L100 PolarHBondContact O-N 3.32Å; L100-R104 PolarHBondContact O-N 3.28Å
101	S	72.2	Confident	73.9	Confident	74 Å²	74	125.8 Å²	125.8	52%	0.517	60%	0.601	S	S	.	*	H	α-helix	trans	-75.3	-33.9	174.7	67.3	0	0	0	0	112.9	D97 M98 R99 R104 A105	D97-S101 WeakPolarHBondContact O-CB 3.42Å; D97-S101 PolarHBondContact O-N 2.78Å; D97-S101 PolarHBondContact O-OG 2.95Å; M98-S101 PolarHBondContact O-N 3.38Å; M98-S101 PolarHBondContact O-OG 2.93Å; R99-S101 VanDerWaalsContact C-N 3.32Å; S101-R104 PolarHBondContact O-N 3.46Å; S101-A105 PolarHBondContact O-N 3.22Å
102	E	69.4	Low	73.4	Confident	123 Å²	123	122.7 Å²	122.7	58%	0.575	60%	0.598	S	S	*	*	H	α-helix	trans	-63.1	-46.2	172.2	-74.2	169.2	174.1	0	0	110.5	M98 R99 R104 A105	M98-E102 WeakPolarHBondContact O-CG 3.35Å; M98-E102 PolarHBondContact O-N 3.35Å; R99-E102 PolarHBondContact O-N 2.86Å; E102-R104 PolarHBondContact O-N 3.23Å; E102-A105 PolarHBondContact O-N 3.43Å
103	D	66.1	Low	72.9	Confident	123 Å²	123	127 Å²	127	66%	0.658	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.1	-18.5	-179.1	-152.4	51.7	0	0	0	113.8	R99	R99-D103 PolarHBondContact O-N 3.37Å; R99-D103 VanDerWaalsContact O-N 3.14Å
104	R	60.6	Low	72.1	Confident	220 Å²	220	130.2 Å²	130.2	83%	0.83	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.5	-9.9	175.9	-159	-173.3	-74.4	-175	-3.7	113	L100 S101 E102	L100-R104 PolarHBondContact O-N 3.28Å; S101-R104 PolarHBondContact O-N 3.46Å; E102-R104 PolarHBondContact O-N 3.23Å
105	A	59	Low	71	Confident	89 Å²	89	129.1 Å²	129.1	74%	0.736	63%	0.63	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.4	-11.9	178.9	0	0	0	0	0	112.8	S101 E102	S101-A105 PolarHBondContact O-N 3.22Å; E102-A105 PolarHBondContact O-N 3.43Å
106	E	49.5	Very low	70	Confident	227 Å²	227	128.6 Å²	128.6	100%	1.061	64%	0.641	S	S	*	*			trans	-83.1	0	163.3	-71.8	-172.1	158	0	0	111.5

Retrieved 106 of 106 residues in 84.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).