A0A5K4F3N6_SCHMA Loading...

Pre-mRNA-splicing factor SYF2

AlphaFold DB , UniProt , Accession A0A5K4F3N6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 74 aa.

						>A0A5K4F3N6_SCHMA|A0A5K4F3N6
MKVKVEERKAYKRENIQKKEIADKNRSDQKVSNWLRAKVLQRKGEEEMKRYENEEQQYLNVVHSREACEQAFKQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.8	Low	87.8	Confident	207 Å²	207	128.7 Å²	128.7	100%	1.02	60%	0.604	S	S	*	*				0	-42	0	-154.7	170.1	-180	0	0	113.4	V3 K4	M1-V3 PolarHBondContact O-N 3.3Å; M1-K4 PolarHBondContact O-N 2.99Å
2	K	78.4	Confident	88.4	Confident	183 Å²	183	130.1 Å²	130.1	80%	0.796	61%	0.606	S	S	*	*	H	α-helix	trans	-54.8	-41.6	179.7	-66.4	-176.7	-177.8	178.8	0	114.7	K4 V5 E6	K2-K4 PolarHBondContact O-N 3.29Å; K2-V5 WeakPolarHBondContact O-CB 3.46Å; K2-V5 PolarHBondContact O-N 3.13Å; K2-E6 PolarHBondContact O-N 2.98Å; K2-E6 VanDerWaalsContact O-N 3.12Å
3	V	81.5	Confident	88.9	Confident	103 Å²	103	132.3 Å²	132.3	62%	0.624	61%	0.606	S	S	*	*	H	α-helix	trans	-55.8	-47.1	179.1	-178.6	0	0	0	0	112	M1 V5 E6 E7	M1-V3 PolarHBondContact O-N 3.3Å; V3-V5 PolarHBondContact O-N 3.3Å; V3-E6 PolarHBondContact O-N 2.92Å; V3-E7 HydrophobicContact CG1-CG 4.42Å; V3-E7 WeakPolarHBondContact O-CG 3.34Å; V3-E7 PolarHBondContact O-N 3.25Å
4	K	88.1	Confident	89.4	Confident	150 Å²	150	129.1 Å²	129.1	65%	0.652	59%	0.592	S	S	*	*	H	α-helix	trans	-61.1	-29.9	177.1	-68.6	-171.7	176.1	-176.5	0	113.5	M1 K2 R8	M1-K4 PolarHBondContact O-N 2.99Å; K2-K4 PolarHBondContact O-N 3.29Å; K4-R8 WeakPolarHBondContact O-CG 3.07Å; K4-R8 PolarHBondContact O-N 3.04Å
5	V	91	Very high	89.7	Confident	69 Å²	69	123.9 Å²	123.9	42%	0.418	57%	0.57	S	S	.	*	H	α-helix	trans	-74.2	-43.3	177.7	176.1	0	0	0	0	110.4	K2 V3 R8 K9	K2-V5 WeakPolarHBondContact O-CB 3.46Å; K2-V5 PolarHBondContact O-N 3.13Å; V3-V5 PolarHBondContact O-N 3.3Å; V5-R8 PolarHBondContact O-N 3.45Å; V5-K9 WeakPolarHBondContact O-CG 3.37Å; V5-K9 PolarHBondContact O-N 3.39Å
6	E	91.5	Very high	90.1	Very high	92 Å²	92	121.1 Å²	121.1	43%	0.43	56%	0.56	S	S	.	*	H	α-helix	trans	-68.1	-38.7	178.3	-67.5	-52.7	129.6	0	0	112.3	K2 V3 R8 K9 A10	K2-E6 PolarHBondContact O-N 2.98Å; K2-E6 VanDerWaalsContact O-N 3.12Å; V3-E6 PolarHBondContact O-N 2.92Å; E6-R8 PolarHBondContact O-N 3.16Å; E6-K9 PolarHBondContact O-N 2.92Å; E6-K9 IonicContact OE1-NZ 2.8Å; E6-K9 PolarHBondContact OE1-NZ 3.49Å; E6-A10 WeakPolarHBondContact O-CB 3.44Å; E6-A10 PolarHBondContact O-N 2.83Å
7	E	92.5	Very high	90.4	Very high	116 Å²	116	120.8 Å²	120.8	54%	0.542	56%	0.559	S	S	.	*	H	α-helix	trans	-57.5	-46.1	171.6	-73	170	170.8	0	0	111.7	V3 K9 A10 Y11	V3-E7 HydrophobicContact CG1-CG 4.42Å; V3-E7 WeakPolarHBondContact O-CG 3.34Å; V3-E7 PolarHBondContact O-N 3.25Å; E7-K9 PolarHBondContact O-N 3.24Å; E7-A10 PolarHBondContact O-N 3.48Å; E7-Y11 WeakPolarHBondContact O-CB 3.42Å; E7-Y11 PolarHBondContact O-N 3.38Å
8	R	93.2	Very high	90.7	Very high	196 Å²	196	120.4 Å²	120.4	74%	0.74	56%	0.555	S	S	*	*	H	α-helix	trans	-63.1	-39.2	176.6	-76.6	179.4	-179.4	-169.6	0.1	112.6	K4 V5 E6 K12	K4-R8 WeakPolarHBondContact O-CG 3.07Å; K4-R8 PolarHBondContact O-N 3.04Å; V5-R8 PolarHBondContact O-N 3.45Å; E6-R8 PolarHBondContact O-N 3.16Å; R8-K12 WeakPolarHBondContact O-CB 3.42Å; R8-K12 PolarHBondContact O-N 2.94Å
9	K	94.2	Very high	90.9	Very high	104 Å²	104	121.7 Å²	121.7	45%	0.452	56%	0.559	S	S	.	*	H	α-helix	trans	-67	-41.7	175.7	-72.4	176.6	-174.5	167.8	0	111.7	V5 E6 E7 K12 R13	V5-K9 WeakPolarHBondContact O-CG 3.37Å; V5-K9 PolarHBondContact O-N 3.39Å; E6-K9 PolarHBondContact O-N 2.92Å; E6-K9 IonicContact OE1-NZ 2.8Å; E6-K9 PolarHBondContact OE1-NZ 3.49Å; E7-K9 PolarHBondContact O-N 3.24Å; K9-K12 PolarHBondContact O-N 2.9Å; K9-R13 WeakPolarHBondContact O-CG 3.32Å; K9-R13 PolarHBondContact O-N 2.92Å
10	A	93.5	Very high	91.1	Very high	46 Å²	46	121.7 Å²	121.7	38%	0.38	56%	0.56	S	S	.	*	H	α-helix	trans	-61.1	-49.9	175.7	0	0	0	0	0	111	E6 E7 K12 R13 E14	E6-A10 WeakPolarHBondContact O-CB 3.44Å; E6-A10 PolarHBondContact O-N 2.83Å; E7-A10 PolarHBondContact O-N 3.48Å; A10-K12 VanDerWaalsContact C-N 3.32Å; A10-K12 PolarHBondContact O-N 3.13Å; A10-R13 PolarHBondContact O-N 3.47Å; A10-R13 VanDerWaalsContact O-N 3.14Å; A10-E14 PolarHBondContact O-N 3.13Å
11	Y	94	Very high	91.2	Very high	150 Å²	150	119.9 Å²	119.9	59%	0.588	55%	0.554	S	S	*	*	H	α-helix	trans	-58.6	-41.2	175.9	-178.6	-106.6	0	0	0	112.8	E7 E14 N15	E7-Y11 WeakPolarHBondContact O-CB 3.42Å; E7-Y11 PolarHBondContact O-N 3.38Å; Y11-E14 PolarHBondContact O-N 3.18Å; Y11-N15 WeakPolarHBondContact CD1-ND2 3.47Å; Y11-N15 WeakPolarHBondContact CE1-ND2 3.41Å; Y11-N15 WeakPolarHBondContact O-CB 3.39Å; Y11-N15 PolarHBondContact O-N 3.36Å; Y11-N15 PolarHBondContact O-ND2 2.95Å; Y11-N15 PolarHBondContact OH-ND2 3.4Å
12	K	95.2	Very high	92.5	Very high	145 Å²	145	112.7 Å²	112.7	63%	0.63	53%	0.527	S	S	*	.	H	α-helix	trans	-63.3	-43.4	175.7	-172.8	176.8	179.5	-178.6	0	111.8	R8 K9 A10 N15 I16	R8-K12 WeakPolarHBondContact O-CB 3.42Å; R8-K12 PolarHBondContact O-N 2.94Å; K9-K12 PolarHBondContact O-N 2.9Å; A10-K12 VanDerWaalsContact C-N 3.32Å; A10-K12 PolarHBondContact O-N 3.13Å; K12-N15 PolarHBondContact O-N 3.39Å; K12-I16 HydrophobicContact CG-CD1 4.08Å; K12-I16 VanDerWaalsContact O-CG1 3.29Å; K12-I16 WeakPolarHBondContact O-CG1 3.34Å; K12-I16 PolarHBondContact O-N 3.45Å
13	R	94.9	Very high	93.3	Very high	159 Å²	159	108.9 Å²	108.9	60%	0.6	52%	0.515	S	S	*	.	H	α-helix	trans	-62.8	-45.9	176.8	-76.5	-175.4	-74.6	-164.3	-1.4	111.7	K9 A10 N15 I16 Q17	K9-R13 WeakPolarHBondContact O-CG 3.32Å; K9-R13 PolarHBondContact O-N 2.92Å; A10-R13 PolarHBondContact O-N 3.47Å; A10-R13 VanDerWaalsContact O-N 3.14Å; R13-N15 VanDerWaalsContact C-N 3.33Å; R13-N15 PolarHBondContact O-N 3Å; R13-I16 PolarHBondContact O-N 3.45Å; R13-Q17 PolarHBondContact O-N 3.05Å
14	E	95.2	Very high	93.9	Very high	88 Å²	88	110.5 Å²	110.5	41%	0.411	51%	0.514	S	S	.	.	H	α-helix	trans	-59.7	-43.4	177.8	-169.9	-169.9	166.9	0	0	111.6	A10 Y11 Q17 K18	A10-E14 PolarHBondContact O-N 3.13Å; Y11-E14 PolarHBondContact O-N 3.18Å; E14-Q17 PolarHBondContact O-N 3.4Å; E14-K18 HydrophobicContact CG-CD 4.47Å; E14-K18 WeakPolarHBondContact O-CB 3.42Å; E14-K18 WeakPolarHBondContact O-CG 3.41Å; E14-K18 PolarHBondContact O-N 3.48Å; E14-K18 WeakPolarHBondContact OE1-CE 3.42Å; E14-K18 IonicContact OE1-NZ 2.67Å; E14-K18 PolarHBondContact OE1-NZ 3.45Å
15	N	95.3	Very high	94.3	Very high	51 Å²	51	108 Å²	108	27%	0.273	51%	0.508	S	S	.	.	H	α-helix	trans	-66.4	-36.9	177.3	-78.6	-31.2	0	0	0	113.5	Y11 K12 R13 K19	Y11-N15 WeakPolarHBondContact CD1-ND2 3.47Å; Y11-N15 WeakPolarHBondContact CE1-ND2 3.41Å; Y11-N15 WeakPolarHBondContact O-CB 3.39Å; Y11-N15 PolarHBondContact O-N 3.36Å; Y11-N15 PolarHBondContact O-ND2 2.95Å; Y11-N15 PolarHBondContact OH-ND2 3.4Å; K12-N15 PolarHBondContact O-N 3.39Å; R13-N15 VanDerWaalsContact C-N 3.33Å; R13-N15 PolarHBondContact O-N 3Å; N15-K19 WeakPolarHBondContact O-CG 3.31Å; N15-K19 PolarHBondContact O-N 2.99Å; N15-K19 VanDerWaalsContact O-N 3.11Å
16	I	94.8	Very high	94.5	Very high	78 Å²	78	112.5 Å²	112.5	40%	0.4	52%	0.517	S	S	.	.	H	α-helix	trans	-64.3	-48.2	174.4	-69.5	165.1	0	0	0	109.4	K12 R13 K18 K19 E20	K12-I16 HydrophobicContact CG-CD1 4.08Å; K12-I16 VanDerWaalsContact O-CG1 3.29Å; K12-I16 WeakPolarHBondContact O-CG1 3.34Å; K12-I16 PolarHBondContact O-N 3.45Å; R13-I16 PolarHBondContact O-N 3.45Å; I16-K18 VanDerWaalsContact C-N 3.34Å; I16-K18 PolarHBondContact O-N 3.12Å; I16-K19 WeakPolarHBondContact O-CB 3.43Å; I16-K19 PolarHBondContact O-N 3.45Å; I16-K19 VanDerWaalsContact O-N 3.09Å; I16-E20 HydrophobicContact CG2-CG 4.41Å; I16-E20 WeakPolarHBondContact O-CG 3.45Å; I16-E20 PolarHBondContact O-N 3.18Å
17	Q	95.7	Very high	94.6	Very high	116 Å²	116	111.1 Å²	111.1	54%	0.542	52%	0.518	S	S	.	.	H	α-helix	trans	-59.9	-42.7	178.5	-171.5	-179.6	11.6	0	0	112.1	R13 E14 K19 E20 I21	R13-Q17 PolarHBondContact O-N 3.05Å; E14-Q17 PolarHBondContact O-N 3.4Å; Q17-K19 VanDerWaalsContact C-N 3.31Å; Q17-K19 PolarHBondContact O-N 2.91Å; Q17-E20 PolarHBondContact O-N 3.27Å; Q17-I21 HydrophobicContact CG-CD1 4.02Å; Q17-I21 VanDerWaalsContact O-CG1 3.26Å; Q17-I21 WeakPolarHBondContact O-CG1 3.29Å; Q17-I21 PolarHBondContact O-N 3.04Å
18	K	95.2	Very high	94.7	Very high	114 Å²	114	109.6 Å²	109.6	50%	0.496	51%	0.514	S	S	.	.	H	α-helix	trans	-59.9	-41.1	174.9	-76.8	177.1	-177.7	169.3	0	112.1	E14 I16 A22	E14-K18 HydrophobicContact CG-CD 4.47Å; E14-K18 WeakPolarHBondContact O-CB 3.42Å; E14-K18 WeakPolarHBondContact O-CG 3.41Å; E14-K18 PolarHBondContact O-N 3.48Å; E14-K18 WeakPolarHBondContact OE1-CE 3.42Å; E14-K18 IonicContact OE1-NZ 2.67Å; E14-K18 PolarHBondContact OE1-NZ 3.45Å; I16-K18 VanDerWaalsContact C-N 3.34Å; I16-K18 PolarHBondContact O-N 3.12Å; K18-A22 WeakPolarHBondContact O-CB 3.41Å; K18-A22 PolarHBondContact O-N 3.43Å
19	K	94.7	Very high	94.9	Very high	145 Å²	145	105.1 Å²	105.1	63%	0.63	50%	0.501	S	S	*	.	H	α-helix	trans	-65.5	-46.2	176	-74.2	179	178.1	-172.5	0	111.7	N15 I16 Q17 I21 A22 D23	N15-K19 WeakPolarHBondContact O-CG 3.31Å; N15-K19 PolarHBondContact O-N 2.99Å; N15-K19 VanDerWaalsContact O-N 3.11Å; I16-K19 WeakPolarHBondContact O-CB 3.43Å; I16-K19 PolarHBondContact O-N 3.45Å; I16-K19 VanDerWaalsContact O-N 3.09Å; Q17-K19 VanDerWaalsContact C-N 3.31Å; Q17-K19 PolarHBondContact O-N 2.91Å; K19-I21 VanDerWaalsContact C-N 3.33Å; K19-I21 PolarHBondContact O-N 2.98Å; K19-A22 PolarHBondContact O-N 3.26Å; K19-D23 WeakPolarHBondContact O-CB 3.43Å; K19-D23 PolarHBondContact O-N 2.96Å
20	E	94.9	Very high	95	Very high	121 Å²	121	106.1 Å²	106.1	57%	0.565	51%	0.505	S	S	*	.	H	α-helix	trans	-59.6	-42.1	177.2	-71.4	173.9	176	0	0	112.3	I16 Q17 D23 K24	I16-E20 HydrophobicContact CG2-CG 4.41Å; I16-E20 WeakPolarHBondContact O-CG 3.45Å; I16-E20 PolarHBondContact O-N 3.18Å; Q17-E20 PolarHBondContact O-N 3.27Å; E20-D23 PolarHBondContact O-N 3.44Å; E20-K24 WeakPolarHBondContact O-CB 3.04Å; E20-K24 PolarHBondContact O-N 3.41Å
21	I	94.6	Very high	95.1	Very high	85 Å²	85	107.4 Å²	107.4	44%	0.436	51%	0.508	S	S	.	.	H	α-helix	trans	-63.6	-45	175.2	-67.7	166.1	0	0	0	110.8	Q17 K19 K24 N25	Q17-I21 HydrophobicContact CG-CD1 4.02Å; Q17-I21 VanDerWaalsContact O-CG1 3.26Å; Q17-I21 WeakPolarHBondContact O-CG1 3.29Å; Q17-I21 PolarHBondContact O-N 3.04Å; K19-I21 VanDerWaalsContact C-N 3.33Å; K19-I21 PolarHBondContact O-N 2.98Å; I21-K24 PolarHBondContact O-N 3.25Å; I21-N25 WeakPolarHBondContact O-CB 3.37Å; I21-N25 VanDerWaalsContact O-CG 3.23Å; I21-N25 PolarHBondContact O-N 3.08Å; I21-N25 PolarHBondContact O-ND2 2.98Å
22	A	94.5	Very high	95.3	Very high	56 Å²	56	102.4 Å²	102.4	46%	0.463	50%	0.495	S	S	.	.	H	α-helix	trans	-63.3	-42.1	178.7	0	0	0	0	0	112	K18 K19 N25 R26	K18-A22 WeakPolarHBondContact O-CB 3.41Å; K18-A22 PolarHBondContact O-N 3.43Å; K19-A22 PolarHBondContact O-N 3.26Å; A22-N25 PolarHBondContact O-N 2.93Å; A22-R26 WeakPolarHBondContact O-CB 3.39Å; A22-R26 PolarHBondContact O-N 3.07Å
23	D	94.6	Very high	95.4	Very high	103 Å²	103	99.2 Å²	99.2	55%	0.551	49%	0.485	S	S	*	.	H	α-helix	trans	-65.8	-42.2	177.4	-74.9	-26.5	0	0	0	111.6	K19 E20 R26 S27	K19-D23 WeakPolarHBondContact O-CB 3.43Å; K19-D23 PolarHBondContact O-N 2.96Å; E20-D23 PolarHBondContact O-N 3.44Å; D23-R26 PolarHBondContact O-N 3.16Å; D23-S27 PolarHBondContact O-N 3.31Å
24	K	95.3	Very high	95.5	Very high	137 Å²	137	99.1 Å²	99.1	60%	0.596	49%	0.485	S	S	*	.	H	α-helix	trans	-61.2	-50	174.2	-172.9	176.9	179.2	-179.4	0	111.6	E20 I21 R26 S27 D28	E20-K24 WeakPolarHBondContact O-CB 3.04Å; E20-K24 PolarHBondContact O-N 3.41Å; I21-K24 PolarHBondContact O-N 3.25Å; K24-R26 VanDerWaalsContact C-N 3.27Å; K24-R26 PolarHBondContact O-N 3.14Å; K24-S27 WeakPolarHBondContact O-CB 3.4Å; K24-S27 PolarHBondContact O-N 3.02Å; K24-D28 PolarHBondContact O-N 2.92Å
25	N	95.2	Very high	95.6	Very high	98 Å²	98	99.2 Å²	99.2	52%	0.524	49%	0.488	S	S	.	.	H	α-helix	trans	-58.6	-39.3	177.5	-73.1	-15.3	0	0	0	112	I21 A22 Q29	I21-N25 WeakPolarHBondContact O-CB 3.37Å; I21-N25 VanDerWaalsContact O-CG 3.23Å; I21-N25 PolarHBondContact O-N 3.08Å; I21-N25 PolarHBondContact O-ND2 2.98Å; A22-N25 PolarHBondContact O-N 2.93Å; N25-Q29 VanDerWaalsContact O-CB 3.31Å; N25-Q29 WeakPolarHBondContact O-CB 3.44Å; N25-Q29 PolarHBondContact O-N 3.29Å
26	R	94.6	Very high	95.7	Very high	162 Å²	162	102.4 Å²	102.4	61%	0.611	50%	0.496	S	S	*	.	H	α-helix	trans	-65	-41.4	175.6	-173.4	-179.3	-176.1	-162.2	2.9	111.8	A22 D23 K24 K30	A22-R26 WeakPolarHBondContact O-CB 3.39Å; A22-R26 PolarHBondContact O-N 3.07Å; D23-R26 PolarHBondContact O-N 3.16Å; K24-R26 VanDerWaalsContact C-N 3.27Å; K24-R26 PolarHBondContact O-N 3.14Å; R26-K30 WeakPolarHBondContact O-CG 3.33Å; R26-K30 PolarHBondContact O-N 3.49Å; R26-K30 VanDerWaalsContact O-N 3.07Å
27	S	94.4	Very high	95.9	Very high	63 Å²	63	101.4 Å²	101.4	44%	0.441	50%	0.499	S	S	.	.	H	α-helix	trans	-63.9	-49.6	176.2	-165.4	0	0	0	0	111.2	D23 K24 Q29 K30 V31	D23-S27 PolarHBondContact O-N 3.31Å; K24-S27 WeakPolarHBondContact O-CB 3.4Å; K24-S27 PolarHBondContact O-N 3.02Å; S27-Q29 VanDerWaalsContact C-N 3.29Å; S27-Q29 PolarHBondContact O-N 3Å; S27-K30 WeakPolarHBondContact O-CB 3.34Å; S27-K30 PolarHBondContact O-N 2.89Å; S27-V31 WeakPolarHBondContact O-CG2 3.2Å; S27-V31 PolarHBondContact O-N 3.45Å
28	D	95.4	Very high	96	Very high	85 Å²	85	99.5 Å²	99.5	46%	0.455	49%	0.489	S	S	.	.	H	α-helix	trans	-60	-41.1	179.9	-68.9	-12.7	0	0	0	110.9	K24 K30 V31 S32	K24-D28 PolarHBondContact O-N 2.92Å; D28-K30 PolarHBondContact O-N 3.01Å; D28-V31 PolarHBondContact O-N 2.87Å; D28-S32 VanDerWaalsContact O-CB 3.25Å; D28-S32 WeakPolarHBondContact O-CB 3.41Å; D28-S32 PolarHBondContact O-N 3.45Å
29	Q	96.4	Very high	96.1	Very high	102 Å²	102	97.9 Å²	97.9	48%	0.477	49%	0.489	S	S	.	.	H	α-helix	trans	-63.8	-40.6	174.5	-172.6	63.4	29	0	0	112.5	N25 S27 S32 N33	N25-Q29 VanDerWaalsContact O-CB 3.31Å; N25-Q29 WeakPolarHBondContact O-CB 3.44Å; N25-Q29 PolarHBondContact O-N 3.29Å; S27-Q29 VanDerWaalsContact C-N 3.29Å; S27-Q29 PolarHBondContact O-N 3Å; Q29-S32 PolarHBondContact O-N 3.18Å; Q29-N33 PolarHBondContact NE2-OD1 2.92Å; Q29-N33 WeakPolarHBondContact O-CB 3.44Å; Q29-N33 VanDerWaalsContact O-CG 3.25Å; Q29-N33 PolarHBondContact O-N 3.41Å
30	K	96.3	Very high	96.2	Very high	124 Å²	124	96.7 Å²	96.7	54%	0.539	49%	0.489	S	S	.	.	H	α-helix	trans	-63.3	-45.9	176.2	-77.9	177.9	178.2	-174.6	0	111.5	R26 S27 D28 N33 W34	R26-K30 WeakPolarHBondContact O-CG 3.33Å; R26-K30 PolarHBondContact O-N 3.49Å; R26-K30 VanDerWaalsContact O-N 3.07Å; S27-K30 WeakPolarHBondContact O-CB 3.34Å; S27-K30 PolarHBondContact O-N 2.89Å; D28-K30 PolarHBondContact O-N 3.01Å; K30-N33 PolarHBondContact O-N 3.26Å; K30-W34 WeakPolarHBondContact O-CB 3.32Å; K30-W34 PolarHBondContact O-N 3.44Å
31	V	96.7	Very high	96.4	Very high	74 Å²	74	95.2 Å²	95.2	45%	0.448	48%	0.482	S	S	.	.	H	α-helix	trans	-62.7	-45.3	177.2	174.8	0	0	0	0	110.3	S27 D28 N33 W34 L35	S27-V31 WeakPolarHBondContact O-CG2 3.2Å; S27-V31 PolarHBondContact O-N 3.45Å; D28-V31 PolarHBondContact O-N 2.87Å; V31-N33 PolarHBondContact O-N 3.5Å; V31-W34 PolarHBondContact O-N 2.95Å; V31-L35 HydrophobicContact CG1-CD1 4.11Å; V31-L35 HydrophobicContact CG1-CG 4.44Å; V31-L35 WeakPolarHBondContact O-CG 3.38Å; V31-L35 PolarHBondContact O-N 3.49Å
32	S	96.8	Very high	96.5	Very high	44 Å²	44	98.9 Å²	98.9	31%	0.308	49%	0.49	S	S	.	.	H	α-helix	trans	-60.1	-44.5	177.2	-166.9	0	0	0	0	112.2	D28 Q29 L35 R36	D28-S32 VanDerWaalsContact O-CB 3.25Å; D28-S32 WeakPolarHBondContact O-CB 3.41Å; D28-S32 PolarHBondContact O-N 3.45Å; Q29-S32 PolarHBondContact O-N 3.18Å; S32-L35 PolarHBondContact O-N 3.07Å; S32-R36 PolarHBondContact O-N 3.36Å; S32-R36 PolarHBondContact OG-NH1 2.95Å; S32-R36 PolarHBondContact OG-NH2 2.88Å
33	N	97.4	Very high	96.7	Very high	79 Å²	79	102.5 Å²	102.5	42%	0.422	50%	0.495	S	S	.	.	H	α-helix	trans	-62.6	-43.6	174.6	-78.1	-14.5	0	0	0	112	Q29 K30 V31 R36 A37	Q29-N33 PolarHBondContact NE2-OD1 2.92Å; Q29-N33 WeakPolarHBondContact O-CB 3.44Å; Q29-N33 VanDerWaalsContact O-CG 3.25Å; Q29-N33 PolarHBondContact O-N 3.41Å; K30-N33 PolarHBondContact O-N 3.26Å; V31-N33 PolarHBondContact O-N 3.5Å; N33-R36 PolarHBondContact O-N 3.44Å; N33-R36 PolarHBondContact OD1-NH2 3.33Å; N33-A37 WeakPolarHBondContact O-CB 3.41Å; N33-A37 PolarHBondContact O-N 3.07Å
34	W	97.6	Very high	96.8	Very high	156 Å²	156	99.1 Å²	99.1	59%	0.591	49%	0.485	S	S	*	.	H	α-helix	trans	-63.3	-43.2	178.6	177.9	81	0	0	0	112	K30 V31 A37 K38	K30-W34 WeakPolarHBondContact O-CB 3.32Å; K30-W34 PolarHBondContact O-N 3.44Å; V31-W34 PolarHBondContact O-N 2.95Å; W34-A37 PolarHBondContact O-N 2.8Å; W34-K38 HydrophobicContact CD2-CG 4.22Å; W34-K38 HydrophobicContact CH2-CG 4.43Å; W34-K38 HydrophobicContact CZ2-CD 4.5Å; W34-K38 HydrophobicContact CZ2-CG 3.94Å; W34-K38 WeakPolarHBondContact O-CB 3.45Å; W34-K38 WeakPolarHBondContact O-CG 3.3Å; W34-K38 PolarHBondContact O-N 3.5Å
35	L	97.7	Very high	96.9	Very high	90 Å²	90	97.7 Å²	97.7	47%	0.471	48%	0.481	S	S	.	.	H	α-helix	trans	-61.6	-45.2	174.9	-72.4	172.9	0	0	0	111.6	V31 S32 A37 K38 V39	V31-L35 HydrophobicContact CG1-CD1 4.11Å; V31-L35 HydrophobicContact CG1-CG 4.44Å; V31-L35 WeakPolarHBondContact O-CG 3.38Å; V31-L35 PolarHBondContact O-N 3.49Å; S32-L35 PolarHBondContact O-N 3.07Å; L35-A37 PolarHBondContact O-N 3.42Å; L35-K38 PolarHBondContact O-N 2.87Å; L35-V39 WeakPolarHBondContact O-CG2 3.48Å; L35-V39 PolarHBondContact O-N 3.03Å
36	R	97.4	Very high	97	Very high	119 Å²	119	99.4 Å²	99.4	45%	0.449	49%	0.485	S	S	.	.	H	α-helix	trans	-57.7	-47.9	174.5	-79.4	-170.6	-76.2	-84.8	-1.7	111.7	S32 N33 K38 V39 L40	S32-R36 PolarHBondContact O-N 3.36Å; S32-R36 PolarHBondContact OG-NH1 2.95Å; S32-R36 PolarHBondContact OG-NH2 2.88Å; N33-R36 PolarHBondContact O-N 3.44Å; N33-R36 PolarHBondContact OD1-NH2 3.33Å; R36-K38 VanDerWaalsContact C-N 3.32Å; R36-K38 PolarHBondContact O-N 3.36Å; R36-V39 PolarHBondContact O-N 3.18Å; R36-L40 WeakPolarHBondContact O-CG 3.37Å; R36-L40 PolarHBondContact O-N 3.45Å
37	A	97.9	Very high	97.2	Very high	57 Å²	57	95.7 Å²	95.7	47%	0.471	48%	0.475	S	S	.	.	H	α-helix	trans	-61	-41.5	178.2	0	0	0	0	0	111.7	N33 W34 L35 L40 Q41	N33-A37 WeakPolarHBondContact O-CB 3.41Å; N33-A37 PolarHBondContact O-N 3.07Å; W34-A37 PolarHBondContact O-N 2.8Å; L35-A37 PolarHBondContact O-N 3.42Å; A37-L40 PolarHBondContact O-N 3.21Å; A37-Q41 WeakPolarHBondContact O-CB 3.4Å; A37-Q41 PolarHBondContact O-N 2.89Å
38	K	98.3	Very high	97.3	Very high	76 Å²	76	98 Å²	98	33%	0.33	48%	0.48	S	S	.	.	H	α-helix	trans	-66.1	-38.9	177.4	-79.1	-65.8	178.5	-165.6	0	113.5	W34 L35 R36 Q41 R42	W34-K38 HydrophobicContact CD2-CG 4.22Å; W34-K38 HydrophobicContact CH2-CG 4.43Å; W34-K38 HydrophobicContact CZ2-CD 4.5Å; W34-K38 HydrophobicContact CZ2-CG 3.94Å; W34-K38 WeakPolarHBondContact O-CB 3.45Å; W34-K38 WeakPolarHBondContact O-CG 3.3Å; W34-K38 PolarHBondContact O-N 3.5Å; L35-K38 PolarHBondContact O-N 2.87Å; R36-K38 VanDerWaalsContact C-N 3.32Å; R36-K38 PolarHBondContact O-N 3.36Å; K38-Q41 PolarHBondContact O-N 3.26Å; K38-R42 WeakPolarHBondContact O-CG 3.38Å; K38-R42 PolarHBondContact O-N 2.89Å; K38-R42 VanDerWaalsContact O-N 3.07Å
39	V	97.9	Very high	97.4	Very high	80 Å²	80	100.2 Å²	100.2	49%	0.485	49%	0.486	S	S	.	.	H	α-helix	trans	-64.3	-44.2	174.5	170.2	0	0	0	0	110.8	L35 R36 R42 K43	L35-V39 WeakPolarHBondContact O-CG2 3.48Å; L35-V39 PolarHBondContact O-N 3.03Å; R36-V39 PolarHBondContact O-N 3.18Å; V39-R42 PolarHBondContact O-N 2.97Å; V39-K43 HydrophobicContact CG1-CD 4.46Å; V39-K43 WeakPolarHBondContact O-CG 3.49Å; V39-K43 PolarHBondContact O-N 3.35Å; V39-K43 VanDerWaalsContact O-N 3.07Å
40	L	97.1	Very high	97.5	Very high	120 Å²	120	100.7 Å²	100.7	63%	0.628	48%	0.483	S	S	*	.	H	α-helix	trans	-65.1	-41.3	177.6	-70.2	171.3	0	0	0	112.1	R36 A37 K43 G44	R36-L40 WeakPolarHBondContact O-CG 3.37Å; R36-L40 PolarHBondContact O-N 3.45Å; A37-L40 PolarHBondContact O-N 3.21Å; L40-K43 PolarHBondContact O-N 3.03Å; L40-G44 PolarHBondContact O-N 3.31Å
41	Q	97.9	Very high	97.5	Very high	89 Å²	89	100.2 Å²	100.2	42%	0.416	48%	0.479	S	S	.	.	H	α-helix	trans	-57	-51	175	-178.8	-178.4	0.8	0	0	111.1	A37 K38 K43 G44 E45	A37-Q41 WeakPolarHBondContact O-CB 3.4Å; A37-Q41 PolarHBondContact O-N 2.89Å; K38-Q41 PolarHBondContact O-N 3.26Å; Q41-K43 VanDerWaalsContact C-N 3.35Å; Q41-K43 PolarHBondContact O-N 3.47Å; Q41-G44 PolarHBondContact O-N 2.92Å; Q41-E45 VanDerWaalsContact CG-OE1 3.3Å; Q41-E45 WeakPolarHBondContact CG-OE1 3.25Å; Q41-E45 PolarHBondContact NE2-OE1 3.33Å; Q41-E45 WeakPolarHBondContact O-CG 3.37Å; Q41-E45 PolarHBondContact O-N 2.9Å
42	R	97.6	Very high	97.5	Very high	163 Å²	163	101.7 Å²	101.7	62%	0.615	48%	0.481	S	S	*	.	H	α-helix	trans	-60.6	-43.1	179.3	-72.4	-179.1	-169.6	-173	2.4	112.5	K38 V39 G44 E45 E46	K38-R42 WeakPolarHBondContact O-CG 3.38Å; K38-R42 PolarHBondContact O-N 2.89Å; K38-R42 VanDerWaalsContact O-N 3.07Å; V39-R42 PolarHBondContact O-N 2.97Å; R42-G44 VanDerWaalsContact C-N 3.31Å; R42-G44 PolarHBondContact O-N 3.44Å; R42-E45 PolarHBondContact O-N 2.8Å; R42-E46 WeakPolarHBondContact O-CB 3.33Å; R42-E46 WeakPolarHBondContact O-CG 3.46Å; R42-E46 PolarHBondContact O-N 3.46Å
43	K	97.4	Very high	97.6	Very high	131 Å²	131	103.7 Å²	103.7	57%	0.57	49%	0.488	S	S	*	.	H	α-helix	trans	-59.9	-42.9	175.9	-76.8	-176.5	172	-170.1	0	111.8	V39 L40 Q41 E46 E47	V39-K43 HydrophobicContact CG1-CD 4.46Å; V39-K43 WeakPolarHBondContact O-CG 3.49Å; V39-K43 PolarHBondContact O-N 3.35Å; V39-K43 VanDerWaalsContact O-N 3.07Å; L40-K43 PolarHBondContact O-N 3.03Å; Q41-K43 VanDerWaalsContact C-N 3.35Å; Q41-K43 PolarHBondContact O-N 3.47Å; K43-E46 PolarHBondContact O-N 3.47Å; K43-E47 WeakPolarHBondContact O-CB 3.48Å; K43-E47 PolarHBondContact O-N 2.88Å
44	G	97.5	Very high	97.5	Very high	33 Å²	33	103.4 Å²	103.4	34%	0.34	48%	0.484	S	S	.	.	H	α-helix	trans	-63.2	-43.5	175.3	0	0	0	0	0	112.6	L40 Q41 R42 E47 M48	L40-G44 PolarHBondContact O-N 3.31Å; Q41-G44 PolarHBondContact O-N 2.92Å; R42-G44 VanDerWaalsContact C-N 3.31Å; R42-G44 PolarHBondContact O-N 3.44Å; G44-E47 PolarHBondContact O-N 3.4Å; G44-M48 WeakPolarHBondContact O-CG 3.34Å; G44-M48 PolarHBondContact O-N 2.69Å
45	E	97.6	Very high	97.5	Very high	107 Å²	107	102.2 Å²	102.2	50%	0.5	49%	0.485	S	S	.	.	H	α-helix	trans	-63.5	-43.2	176.8	-71.7	168.5	-176.1	0	0	112.2	Q41 R42 M48 K49	Q41-E45 VanDerWaalsContact CG-OE1 3.3Å; Q41-E45 WeakPolarHBondContact CG-OE1 3.25Å; Q41-E45 PolarHBondContact NE2-OE1 3.33Å; Q41-E45 WeakPolarHBondContact O-CG 3.37Å; Q41-E45 PolarHBondContact O-N 2.9Å; R42-E45 PolarHBondContact O-N 2.8Å; E45-M48 PolarHBondContact O-N 3.22Å; E45-K49 WeakPolarHBondContact O-CB 3.31Å; E45-K49 PolarHBondContact O-N 3.39Å
46	E	97.6	Very high	97.3	Very high	134 Å²	134	102.5 Å²	102.5	63%	0.626	48%	0.484	S	S	*	.	H	α-helix	trans	-64.3	-40.3	176.7	-74.8	171.3	-174.7	0	0	112.2	R42 K43 K49 R50	R42-E46 WeakPolarHBondContact O-CB 3.33Å; R42-E46 WeakPolarHBondContact O-CG 3.46Å; R42-E46 PolarHBondContact O-N 3.46Å; K43-E46 PolarHBondContact O-N 3.47Å; E46-K49 PolarHBondContact O-N 2.87Å; E46-R50 PolarHBondContact O-N 2.85Å
47	E	97.9	Very high	97.2	Very high	84 Å²	84	103 Å²	103	39%	0.393	49%	0.491	S	S	.	.	H	α-helix	trans	-67.3	-44.1	176.7	173.7	155.9	-130.2	0	0	112.3	K43 G44 K49 R50 Y51	K43-E47 WeakPolarHBondContact O-CB 3.48Å; K43-E47 PolarHBondContact O-N 2.88Å; G44-E47 PolarHBondContact O-N 3.4Å; E47-K49 VanDerWaalsContact C-N 3.33Å; E47-K49 PolarHBondContact O-N 3.49Å; E47-R50 WeakPolarHBondContact O-CB 3.36Å; E47-R50 PolarHBondContact O-N 2.94Å; E47-R50 VanDerWaalsContact O-N 3.14Å; E47-R50 IonicContact OE1-CZ 3.48Å; E47-R50 IonicContact OE1-NH2 2.83Å; E47-R50 PolarHBondContact OE1-NH2 3.07Å; E47-Y51 HydrophobicContact CG-CD2 3.86Å; E47-Y51 HydrophobicContact CG-CE2 3.32Å; E47-Y51 WeakPolarHBondContact O-CD2 3.39Å; E47-Y51 PolarHBondContact O-N 2.95Å; E47-Y51 PolarHBondContact OE1-OH 3.4Å
48	M	97.4	Very high	97	Very high	111 Å²	111	108.5 Å²	108.5	55%	0.547	50%	0.501	S	S	.	.	H	α-helix	trans	-58.9	-45.5	173.9	-73.9	-60.4	-59.8	0	0	111.5	G44 E45 R50 Y51 E52	G44-M48 WeakPolarHBondContact O-CG 3.34Å; G44-M48 PolarHBondContact O-N 2.69Å; E45-M48 PolarHBondContact O-N 3.22Å; M48-R50 VanDerWaalsContact C-N 3.26Å; M48-R50 PolarHBondContact O-N 3.03Å; M48-Y51 PolarHBondContact O-N 3.33Å; M48-Y51 VanDerWaalsContact O-N 3.16Å; M48-E52 WeakPolarHBondContact O-CG 3.4Å; M48-E52 PolarHBondContact O-N 2.94Å
49	K	97.6	Very high	96.9	Very high	132 Å²	132	108.2 Å²	108.2	57%	0.574	50%	0.503	S	S	*	.	H	α-helix	trans	-61.1	-34.9	176.7	-174	175.2	-177.4	178.3	0	112.4	E45 E46 E47 N53	E45-K49 WeakPolarHBondContact O-CB 3.31Å; E45-K49 PolarHBondContact O-N 3.39Å; E46-K49 PolarHBondContact O-N 2.87Å; E47-K49 VanDerWaalsContact C-N 3.33Å; E47-K49 PolarHBondContact O-N 3.49Å; K49-N53 WeakPolarHBondContact O-CB 3.26Å; K49-N53 PolarHBondContact O-N 3.06Å; K49-N53 VanDerWaalsContact O-N 3.08Å; K49-N53 PolarHBondContact O-ND2 3.34Å; K49-N53 VanDerWaalsContact O-ND2 3.12Å
50	R	97.5	Very high	96.7	Very high	112 Å²	112	109 Å²	109	42%	0.423	50%	0.504	S	S	.	.	H	α-helix	trans	-63.6	-49.5	174.2	-175	-176.1	68	-132.7	-3.8	110.7	E46 E47 M48 N53 E54	E46-R50 PolarHBondContact O-N 2.85Å; E47-R50 WeakPolarHBondContact O-CB 3.36Å; E47-R50 PolarHBondContact O-N 2.94Å; E47-R50 VanDerWaalsContact O-N 3.14Å; E47-R50 IonicContact OE1-CZ 3.48Å; E47-R50 IonicContact OE1-NH2 2.83Å; E47-R50 PolarHBondContact OE1-NH2 3.07Å; M48-R50 VanDerWaalsContact C-N 3.26Å; M48-R50 PolarHBondContact O-N 3.03Å; R50-N53 PolarHBondContact O-N 2.95Å; R50-E54 WeakPolarHBondContact CG-OE1 3.39Å; R50-E54 IonicContact NE-OE1 2.87Å; R50-E54 WeakPolarHBondContact O-CG 3.4Å; R50-E54 PolarHBondContact O-N 2.95Å
51	Y	97.1	Very high	96.5	Very high	114 Å²	114	108.1 Å²	108.1	45%	0.447	50%	0.504	S	S	.	.	H	α-helix	trans	-62.4	-42.9	178.8	-69.5	-55.6	0	0	0	112.7	E47 M48 N53 E54 E55	E47-Y51 HydrophobicContact CG-CD2 3.86Å; E47-Y51 HydrophobicContact CG-CE2 3.32Å; E47-Y51 WeakPolarHBondContact O-CD2 3.39Å; E47-Y51 PolarHBondContact O-N 2.95Å; E47-Y51 PolarHBondContact OE1-OH 3.4Å; M48-Y51 PolarHBondContact O-N 3.33Å; M48-Y51 VanDerWaalsContact O-N 3.16Å; Y51-N53 VanDerWaalsContact C-N 3.31Å; Y51-N53 PolarHBondContact O-N 3.29Å; Y51-E54 PolarHBondContact O-N 3.46Å; Y51-E55 WeakPolarHBondContact O-CB 3.48Å; Y51-E55 PolarHBondContact O-N 2.91Å
52	E	97.2	Very high	96.2	Very high	105 Å²	105	107.1 Å²	107.1	49%	0.491	50%	0.504	S	S	.	.	H	α-helix	trans	-59.3	-42.7	175.1	-72.2	171.7	178.4	0	0	111.5	M48 E55 Q56	M48-E52 WeakPolarHBondContact O-CG 3.4Å; M48-E52 PolarHBondContact O-N 2.94Å; E52-E55 PolarHBondContact O-N 3.45Å; E52-Q56 VanDerWaalsContact O-CG 3.29Å; E52-Q56 WeakPolarHBondContact O-CG 3.47Å; E52-Q56 PolarHBondContact O-N 3.42Å
53	N	96.9	Very high	96	Very high	85 Å²	85	103.8 Å²	103.8	46%	0.455	50%	0.495	S	S	.	.	H	α-helix	trans	-65.6	-42	177.1	-72.9	-26.5	0	0	0	112.3	K49 R50 Y51 Q56 Q57	K49-N53 WeakPolarHBondContact O-CB 3.26Å; K49-N53 PolarHBondContact O-N 3.06Å; K49-N53 VanDerWaalsContact O-N 3.08Å; K49-N53 PolarHBondContact O-ND2 3.34Å; K49-N53 VanDerWaalsContact O-ND2 3.12Å; R50-N53 PolarHBondContact O-N 2.95Å; Y51-N53 VanDerWaalsContact C-N 3.31Å; Y51-N53 PolarHBondContact O-N 3.29Å; N53-Q56 PolarHBondContact O-N 2.95Å; N53-Q57 VanDerWaalsContact O-CG 3.31Å; N53-Q57 WeakPolarHBondContact O-CG 3.36Å; N53-Q57 PolarHBondContact O-N 3.17Å
54	E	96.5	Very high	95.8	Very high	74 Å²	74	101 Å²	101	35%	0.346	49%	0.492	S	S	.	.	H	α-helix	trans	-61.8	-46.1	175.9	-73.7	171.7	-166.7	0	0	110.7	R50 Y51 Q56 Q57 Y58	R50-E54 WeakPolarHBondContact CG-OE1 3.39Å; R50-E54 IonicContact NE-OE1 2.87Å; R50-E54 WeakPolarHBondContact O-CG 3.4Å; R50-E54 PolarHBondContact O-N 2.95Å; Y51-E54 PolarHBondContact O-N 3.46Å; E54-Q56 PolarHBondContact O-N 3.32Å; E54-Q57 WeakPolarHBondContact O-CB 3.45Å; E54-Q57 PolarHBondContact O-N 3.4Å; E54-Y58 HydrophobicContact CB-CE2 4.45Å; E54-Y58 WeakPolarHBondContact O-CD2 3.5Å; E54-Y58 PolarHBondContact O-N 2.92Å
55	E	96.3	Very high	95.6	Very high	130 Å²	130	107.5 Å²	107.5	61%	0.607	51%	0.506	S	S	*	.	H	α-helix	trans	-58.5	-45.8	176.4	-175.3	176.8	-148.5	0	0	111.9	Y51 E52 Q57 Y58 L59	Y51-E55 WeakPolarHBondContact O-CB 3.48Å; Y51-E55 PolarHBondContact O-N 2.91Å; E52-E55 PolarHBondContact O-N 3.45Å; E55-Q57 VanDerWaalsContact C-N 3.34Å; E55-Q57 PolarHBondContact O-N 3.47Å; E55-Y58 PolarHBondContact O-N 2.86Å; E55-L59 WeakPolarHBondContact O-CB 3.4Å; E55-L59 PolarHBondContact O-N 2.92Å
56	Q	95.5	Very high	95.4	Very high	97 Å²	97	106.8 Å²	106.8	45%	0.453	50%	0.503	S	S	.	.	H	α-helix	trans	-63.2	-38.8	176.3	-70.9	-59.2	-41.9	0	0	112.4	E52 N53 E54 L59 N60	E52-Q56 VanDerWaalsContact O-CG 3.29Å; E52-Q56 WeakPolarHBondContact O-CG 3.47Å; E52-Q56 PolarHBondContact O-N 3.42Å; N53-Q56 PolarHBondContact O-N 2.95Å; E54-Q56 PolarHBondContact O-N 3.32Å; Q56-L59 PolarHBondContact O-N 3.02Å; Q56-N60 WeakPolarHBondContact O-CB 3.29Å; Q56-N60 PolarHBondContact O-N 3.23Å; Q56-N60 PolarHBondContact O-ND2 2.9Å
57	Q	94.8	Very high	95.1	Very high	129 Å²	129	103.1 Å²	103.1	60%	0.603	50%	0.495	S	S	*	.	H	α-helix	trans	-62.5	-45.4	175.1	-74.7	176.1	5.1	0	0	111.6	N53 E54 E55 N60 V61	N53-Q57 VanDerWaalsContact O-CG 3.31Å; N53-Q57 WeakPolarHBondContact O-CG 3.36Å; N53-Q57 PolarHBondContact O-N 3.17Å; E54-Q57 WeakPolarHBondContact O-CB 3.45Å; E54-Q57 PolarHBondContact O-N 3.4Å; E55-Q57 VanDerWaalsContact C-N 3.34Å; E55-Q57 PolarHBondContact O-N 3.47Å; Q57-N60 PolarHBondContact O-N 3.41Å; Q57-V61 WeakPolarHBondContact O-CG2 3.36Å; Q57-V61 PolarHBondContact O-N 3.38Å; Q57-V61 VanDerWaalsContact O-N 3.13Å
58	Y	94.2	Very high	94.9	Very high	172 Å²	172	102.2 Å²	102.2	68%	0.675	50%	0.497	S	S	*	.	H	α-helix	trans	-60.9	-45.5	175.6	-75.1	-63.7	0	0	0	112	E54 E55 N60 V61 V62	E54-Y58 HydrophobicContact CB-CE2 4.45Å; E54-Y58 WeakPolarHBondContact O-CD2 3.5Å; E54-Y58 PolarHBondContact O-N 2.92Å; E55-Y58 PolarHBondContact O-N 2.86Å; Y58-N60 VanDerWaalsContact C-N 3.31Å; Y58-N60 PolarHBondContact O-N 2.95Å; Y58-V61 PolarHBondContact O-N 3.37Å; Y58-V62 WeakPolarHBondContact O-CG2 3.17Å; Y58-V62 PolarHBondContact O-N 3.06Å
59	L	94.9	Very high	94.7	Very high	71 Å²	71	100.7 Å²	100.7	37%	0.372	49%	0.489	S	S	.	.	H	α-helix	trans	-61.2	-41	179.2	-172.4	64.7	0	0	0	111.8	E55 Q56 V61 V62 H63	E55-L59 WeakPolarHBondContact O-CB 3.4Å; E55-L59 PolarHBondContact O-N 2.92Å; Q56-L59 PolarHBondContact O-N 3.02Å; L59-V61 VanDerWaalsContact C-N 3.34Å; L59-V61 PolarHBondContact O-N 3.11Å; L59-V62 PolarHBondContact O-N 3.44Å; L59-H63 WeakPolarHBondContact CG-CE1 3.42Å; L59-H63 VanDerWaalsContact O-CG 3.32Å; L59-H63 PolarHBondContact O-N 3.02Å; L59-H63 PolarHBondContact O-ND1 3.48Å
60	N	93.9	Very high	94.6	Very high	96 Å²	96	100.3 Å²	100.3	51%	0.513	49%	0.489	S	S	.	.	H	α-helix	trans	-63.1	-38.5	176.1	-72	-30	0	0	0	112.6	Q56 Q57 Y58 S64	Q56-N60 WeakPolarHBondContact O-CB 3.29Å; Q56-N60 PolarHBondContact O-N 3.23Å; Q56-N60 PolarHBondContact O-ND2 2.9Å; Q57-N60 PolarHBondContact O-N 3.41Å; Y58-N60 VanDerWaalsContact C-N 3.31Å; Y58-N60 PolarHBondContact O-N 2.95Å; N60-S64 WeakPolarHBondContact O-CB 3.44Å; N60-S64 PolarHBondContact O-N 2.67Å
61	V	92.5	Very high	94.3	Very high	101 Å²	101	98 Å²	98	61%	0.612	49%	0.494	S	S	*	.	H	α-helix	trans	-65.3	-43	175.3	173.7	0	0	0	0	110.9	Q57 Y58 L59 S64 R65	Q57-V61 WeakPolarHBondContact O-CG2 3.36Å; Q57-V61 PolarHBondContact O-N 3.38Å; Q57-V61 VanDerWaalsContact O-N 3.13Å; Y58-V61 PolarHBondContact O-N 3.37Å; L59-V61 VanDerWaalsContact C-N 3.34Å; L59-V61 PolarHBondContact O-N 3.11Å; V61-S64 PolarHBondContact O-N 3.09Å; V61-R65 WeakPolarHBondContact O-CB 3.38Å; V61-R65 PolarHBondContact O-N 2.99Å
62	V	92.1	Very high	94	Very high	69 Å²	69	101.2 Å²	101.2	42%	0.418	51%	0.51	S	S	.	.	H	α-helix	trans	-62	-50.7	176.9	173.6	0	0	0	0	110.8	Y58 L59 S64 R65 E66	Y58-V62 WeakPolarHBondContact O-CG2 3.17Å; Y58-V62 PolarHBondContact O-N 3.06Å; L59-V62 PolarHBondContact O-N 3.44Å; V62-S64 VanDerWaalsContact C-N 3.33Å; V62-S64 PolarHBondContact O-N 2.8Å; V62-R65 WeakPolarHBondContact O-CB 3.01Å; V62-R65 PolarHBondContact O-N 3.31Å; V62-R65 VanDerWaalsContact O-N 3.13Å; V62-E66 HydrophobicContact CG1-CG 4.46Å; V62-E66 WeakPolarHBondContact O-CG 3.43Å; V62-E66 PolarHBondContact O-N 3.04Å
63	H	92.9	Very high	93.8	Very high	92 Å²	92	104.7 Å²	104.7	43%	0.426	52%	0.524	S	S	.	.	H	α-helix	trans	-61.9	-39.3	178.8	-67.5	159.5	0	0	0	112.7	L59 R65 E66 A67	L59-H63 WeakPolarHBondContact CG-CE1 3.42Å; L59-H63 VanDerWaalsContact O-CG 3.32Å; L59-H63 PolarHBondContact O-N 3.02Å; L59-H63 PolarHBondContact O-ND1 3.48Å; H63-R65 VanDerWaalsContact C-N 3.32Å; H63-R65 PolarHBondContact O-N 3.21Å; H63-E66 IonicContact CD2-OE2 3.24Å; H63-E66 PolarHBondContact O-N 3.35Å; H63-A67 WeakPolarHBondContact O-CB 3.47Å; H63-A67 PolarHBondContact O-N 3.14Å
64	S	93.1	Very high	92.9	Very high	72 Å²	72	111 Å²	111	50%	0.503	55%	0.551	S	S	.	*	H	α-helix	trans	-63.2	-41	175.4	-176.1	0	0	0	0	111.4	N60 V61 V62 A67 C68	N60-S64 WeakPolarHBondContact O-CB 3.44Å; N60-S64 PolarHBondContact O-N 2.67Å; V61-S64 PolarHBondContact O-N 3.09Å; V62-S64 VanDerWaalsContact C-N 3.33Å; V62-S64 PolarHBondContact O-N 2.8Å; S64-A67 PolarHBondContact O-N 2.85Å; S64-C68 PolarHBondContact O-N 2.98Å; S64-C68 PolarHBondContact O-SG 3.03Å
65	R	93	Very high	92.7	Very high	171 Å²	171	112.9 Å²	112.9	65%	0.645	56%	0.561	S	S	*	*	H	α-helix	trans	-63.3	-47.6	176.5	177	-177.4	168.4	-178.8	-2.4	111	V61 V62 H63 A67 C68 E69	V61-R65 WeakPolarHBondContact O-CB 3.38Å; V61-R65 PolarHBondContact O-N 2.99Å; V62-R65 WeakPolarHBondContact O-CB 3.01Å; V62-R65 PolarHBondContact O-N 3.31Å; V62-R65 VanDerWaalsContact O-N 3.13Å; H63-R65 VanDerWaalsContact C-N 3.32Å; H63-R65 PolarHBondContact O-N 3.21Å; R65-A67 VanDerWaalsContact C-N 3.33Å; R65-A67 PolarHBondContact O-N 3.45Å; R65-C68 PolarHBondContact O-N 2.91Å; R65-E69 IonicContact CZ-OE1 3.92Å; R65-E69 IonicContact NE-OE1 3.94Å; R65-E69 PolarHBondContact NE-OE1 3.28Å; R65-E69 IonicContact NH2-OE1 3.85Å; R65-E69 PolarHBondContact NH2-OE1 2.96Å; R65-E69 WeakPolarHBondContact O-CG 3.33Å; R65-E69 PolarHBondContact O-N 3.45Å
66	E	93.4	Very high	92.5	Very high	92 Å²	92	112 Å²	112	43%	0.43	56%	0.559	S	S	.	*	H	α-helix	trans	-60.6	-41.9	177.8	-71.2	176.1	170	0	0	111.9	V62 H63 C68 E69 Q70	V62-E66 HydrophobicContact CG1-CG 4.46Å; V62-E66 WeakPolarHBondContact O-CG 3.43Å; V62-E66 PolarHBondContact O-N 3.04Å; H63-E66 IonicContact CD2-OE2 3.24Å; H63-E66 PolarHBondContact O-N 3.35Å; E66-C68 PolarHBondContact O-N 3.29Å; E66-E69 PolarHBondContact O-N 3.36Å; E66-Q70 VanDerWaalsContact O-CG 3.32Å; E66-Q70 WeakPolarHBondContact O-CG 3.45Å; E66-Q70 PolarHBondContact O-N 3.17Å
67	A	92.6	Very high	92.4	Very high	56 Å²	56	112.8 Å²	112.8	46%	0.463	56%	0.564	S	S	.	*	H	α-helix	trans	-62.1	-42.4	176.1	0	0	0	0	0	112	H63 S64 R65 Q70 A71	H63-A67 WeakPolarHBondContact O-CB 3.47Å; H63-A67 PolarHBondContact O-N 3.14Å; S64-A67 PolarHBondContact O-N 2.85Å; R65-A67 VanDerWaalsContact C-N 3.33Å; R65-A67 PolarHBondContact O-N 3.45Å; A67-Q70 PolarHBondContact O-N 3.4Å; A67-A71 WeakPolarHBondContact O-CB 3.42Å; A67-A71 PolarHBondContact O-N 3.22Å
68	C	93.4	Very high	92.2	Very high	65 Å²	65	111.9 Å²	111.9	44%	0.439	56%	0.562	S	S	.	*	H	α-helix	trans	-62.4	-48.5	173.3	-69.1	0	0	0	0	111.6	S64 R65 E66 Q70 A71 F72	S64-C68 PolarHBondContact O-N 2.98Å; S64-C68 PolarHBondContact O-SG 3.03Å; R65-C68 PolarHBondContact O-N 2.91Å; E66-C68 PolarHBondContact O-N 3.29Å; C68-Q70 VanDerWaalsContact C-N 3.25Å; C68-Q70 PolarHBondContact O-N 3.47Å; C68-A71 PolarHBondContact O-N 3.37Å; C68-A71 VanDerWaalsContact O-N 3.13Å; C68-F72 HydrophobicContact CB-CE2 4.39Å; C68-F72 WeakPolarHBondContact O-CD2 3.39Å; C68-F72 PolarHBondContact O-N 3.12Å
69	E	94	Very high	92.1	Very high	80 Å²	80	108.1 Å²	108.1	37%	0.374	56%	0.555	S	S	.	*	H	α-helix	trans	-60	-34.5	179.2	-73	179.5	-169.3	0	0	112.5	R65 E66 K73	R65-E69 IonicContact CZ-OE1 3.92Å; R65-E69 IonicContact NE-OE1 3.94Å; R65-E69 PolarHBondContact NE-OE1 3.28Å; R65-E69 IonicContact NH2-OE1 3.85Å; R65-E69 PolarHBondContact NH2-OE1 2.96Å; R65-E69 WeakPolarHBondContact O-CG 3.33Å; R65-E69 PolarHBondContact O-N 3.45Å; E66-E69 PolarHBondContact O-N 3.36Å; E69-K73 WeakPolarHBondContact O-CG 3.44Å
70	Q	93.8	Very high	91.9	Very high	124 Å²	124	110.6 Å²	110.6	58%	0.579	57%	0.567	S	S	*	*	H	α-helix	trans	-70.5	-43.4	173.4	-72.2	176.9	12.6	0	0	112.1	E66 A67 C68 F72 K73	E66-Q70 VanDerWaalsContact O-CG 3.32Å; E66-Q70 WeakPolarHBondContact O-CG 3.45Å; E66-Q70 PolarHBondContact O-N 3.17Å; A67-Q70 PolarHBondContact O-N 3.4Å; C68-Q70 VanDerWaalsContact C-N 3.25Å; C68-Q70 PolarHBondContact O-N 3.47Å; Q70-F72 VanDerWaalsContact C-N 3.28Å; Q70-F72 PolarHBondContact O-N 3.34Å; Q70-K73 PolarHBondContact O-N 3.29Å; Q70-K73 VanDerWaalsContact O-N 3.16Å
71	A	92.9	Very high	91.8	Very high	62 Å²	62	111.6 Å²	111.6	51%	0.512	57%	0.571	S	S	.	*	H	α-helix	trans	-62.7	-33.5	177.5	0	0	0	0	0	112.6	A67 C68 K73	A67-A71 WeakPolarHBondContact O-CB 3.42Å; A67-A71 PolarHBondContact O-N 3.22Å; C68-A71 PolarHBondContact O-N 3.37Å; C68-A71 VanDerWaalsContact O-N 3.13Å; A71-K73 VanDerWaalsContact C-N 3.33Å
72	F	90.1	Very high	91.7	Very high	182 Å²	182	112.5 Å²	112.5	80%	0.798	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73	-20	175.8	-78.9	-65.9	0	0	0	114.5	C68 Q70	C68-F72 HydrophobicContact CB-CE2 4.39Å; C68-F72 WeakPolarHBondContact O-CD2 3.39Å; C68-F72 PolarHBondContact O-N 3.12Å; Q70-F72 VanDerWaalsContact C-N 3.28Å; Q70-F72 PolarHBondContact O-N 3.34Å
73	K	92	Very high	91.7	Very high	178 Å²	178	116.1 Å²	116.1	77%	0.774	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.4	-11.1	179.2	-71.8	174.6	-173.4	174.5	0	113.2	E69 Q70 A71	E69-K73 WeakPolarHBondContact O-CG 3.44Å; Q70-K73 PolarHBondContact O-N 3.29Å; Q70-K73 VanDerWaalsContact O-N 3.16Å; A71-K73 VanDerWaalsContact C-N 3.33Å
74	Q	79.2	Confident	91.6	Very high	219 Å²	219	118.3 Å²	118.3	100%	1.023	60%	0.595	S	S	*	*			trans	-88.7	0	174.8	-65.7	179.7	12.6	0	0	110.1

Retrieved 74 of 74 residues in 142.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).