A0A5K4F414_SCHMA Loading...

60S ribosomal protein L21

AlphaFold DB , UniProt , Accession A0A5K4F414, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 126 aa.

						>A0A5K4F414_SCHMA|A0A5K4F414
MTNTKGYRRGTRYLFSRKFRHHGPLPSSVYMRVYRRGDIVDIKGDGGVQKGMPHKSYHGRTGRVYNVTPHAVGIIVNKRVGNRIIPKRINVRIEHVKPSKFREDFLRRVKENDVKRRDAKEMCSSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.9	Low	83.9	Confident	245 Å²	245	116.5 Å²	116.5	100%	1.207	61%	0.613	S	S	*	*				0	106.5	0	-168.7	-176.6	-95.7	0	0	108.9
2	T	82.6	Confident	84.3	Confident	139 Å²	139	124.3 Å²	124.3	85%	0.853	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-82.9	125.2	-176	-54.3	0	0	0	0	110.6
3	N	78	Confident	84.8	Confident	91 Å²	91	129.3 Å²	129.3	49%	0.487	64%	0.637	S	S	.	*	P	Polyproline II helix	trans	-73.9	129.3	177.8	-158.3	-49.4	0	0	0	110.8	K5 R9	N3-K5 PolarHBondContact O-N 2.99Å; N3-R9 PolarHBondContact ND2-NH2 3.4Å; N3-R9 PolarHBondContact OD1-NE 3.15Å; N3-R9 PolarHBondContact OD1-NH2 3.16Å
4	T	83.4	Confident	85.3	Confident	106 Å²	106	125.2 Å²	125.2	65%	0.65	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-66.9	126.9	179.6	47.7	0	0	0	0	111.3	G6 R9	T4-G6 VanDerWaalsContact C-N 3.33Å; T4-G6 PolarHBondContact O-N 3.11Å; T4-R9 WeakPolarHBondContact O-CD 3.43Å; T4-R9 WeakPolarHBondContact O-CG 3.39Å
5	K	82.7	Confident	85.6	Confident	207 Å²	207	117.9 Å²	117.9	90%	0.9	58%	0.582	S	S	*	*			trans	-94.3	31	-178.4	-65.1	179.3	179.8	174.8	0	113.4	N3	N3-K5 PolarHBondContact O-N 2.99Å
6	G	87.6	Confident	85.9	Confident	43 Å²	43	114.8 Å²	114.8	44%	0.443	58%	0.575	S	S	.	*			trans	-76.4	159.6	-175.4	0	0	0	0	0	114.9	T4 R8 R9	T4-G6 VanDerWaalsContact C-N 3.33Å; T4-G6 PolarHBondContact O-N 3.11Å; G6-R8 PolarHBondContact O-N 3.11Å; G6-R9 WeakPolarHBondContact O-CB 3.44Å; G6-R9 PolarHBondContact O-N 3.01Å
7	Y	86.3	Confident	86.1	Confident	134 Å²	134	111.1 Å²	111.1	53%	0.525	55%	0.553	S	S	.	*	T	Hydrogen-bonded Turn	trans	-56.4	-33.9	179.7	-173.3	-98.2	0	0	0	113.9	H54	Y7-H54 AromaticContact CD2-CD2 3.73Å; Y7-H54 HydrophobicContact CE1-CB 4.42Å; Y7-H54 HydrophobicContact CE2-CB 3.86Å; Y7-H54 AromaticContact CE2-CD2 3.53Å; Y7-H54 AromaticContact CE2-CG 3.99Å; Y7-H54 AromaticContact CZ-CD2 3.92Å; Y7-H54 WeakPolarHBondContact OH-CA 3.45Å; Y7-H54 WeakPolarHBondContact OH-CB 3.14Å; Y7-H54 PolarHBondContact OH-N 3.28Å
8	R	87	Confident	86.4	Confident	124 Å²	124	113.2 Å²	113.2	47%	0.468	56%	0.558	S	S	.	*	T	Hydrogen-bonded Turn	trans	-98	15.6	178.8	-65.9	-172.3	167.5	111.3	-1.6	113.6	G6 G10 T11 Q49 M52	G6-R8 PolarHBondContact O-N 3.11Å; R8-G10 PolarHBondContact O-N 2.85Å; R8-T11 PolarHBondContact O-N 3.37Å; R8-T11 PolarHBondContact O-OG1 3.43Å; R8-Q49 PolarHBondContact NH2-O 3.04Å; R8-M52 PolarHBondContact NE-SD 2.64Å; R8-M52 VanDerWaalsContact NE-SD 3.45Å; R8-M52 PolarHBondContact NH2-SD 2.79Å
9	R	90.2	Very high	86.7	Confident	110 Å²	110	115.7 Å²	115.7	42%	0.415	57%	0.566	S	S	.	*	T	Hydrogen-bonded Turn	trans	-62.6	127.7	177.2	-177.9	-150.9	179.9	-149.4	-7.8	110.4	N3 T4 G6 T11 K55	N3-R9 PolarHBondContact ND2-NH2 3.4Å; N3-R9 PolarHBondContact OD1-NE 3.15Å; N3-R9 PolarHBondContact OD1-NH2 3.16Å; T4-R9 WeakPolarHBondContact O-CD 3.43Å; T4-R9 WeakPolarHBondContact O-CG 3.39Å; G6-R9 WeakPolarHBondContact O-CB 3.44Å; G6-R9 PolarHBondContact O-N 3.01Å; R9-T11 VanDerWaalsContact C-N 3.34Å; R9-K55 PolarHBondContact O-NZ 3.06Å
10	G	89.3	Confident	86.9	Confident	69 Å²	69	120.2 Å²	120.2	71%	0.711	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	75.4	20.9	175.9	0	0	0	0	0	113.7	R8	R8-G10 PolarHBondContact O-N 2.85Å
11	T	90.4	Very high	86.9	Confident	14 Å²	14	120.3 Å²	120.3	9%	0.086	58%	0.576	C	S	.	*			trans	-108.5	13.2	-179.6	70.2	0	0	0	0	113.8	R8 R9 Y13 L14 F15 K55	R8-T11 PolarHBondContact O-N 3.37Å; R8-T11 PolarHBondContact O-OG1 3.43Å; R9-T11 VanDerWaalsContact C-N 3.34Å; T11-Y13 VanDerWaalsContact C-N 3.31Å; T11-Y13 PolarHBondContact O-N 2.94Å; T11-L14 HydrophobicContact CG2-CD2 4.25Å; T11-L14 PolarHBondContact O-N 3.48Å; T11-F15 VanDerWaalsContact CB-CD2 3.45Å; T11-F15 VanDerWaalsContact CB-CE2 3.45Å; T11-F15 HydrophobicContact CG2-CD2 4.13Å; T11-F15 HydrophobicContact CG2-CE2 3.58Å; T11-F15 HydrophobicContact CG2-CZ 4.27Å; T11-F15 PolarHBondContact O-N 3.05Å; T11-K55 HydrophobicContact CG2-CB 3.74Å; T11-K55 HydrophobicContact CG2-CD 4.05Å; T11-K55 HydrophobicContact CG2-CG 4.42Å
12	R	88.3	Confident	87.9	Confident	210 Å²	210	115.6 Å²	115.6	79%	0.792	55%	0.551	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.7	-47.1	-179	-176.9	-178.6	-71.9	-124.9	1.8	112
13	Y	91	Very high	88.2	Confident	189 Å²	189	111.2 Å²	111.2	74%	0.741	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.2	-16.2	178.8	-54.9	-65.4	0	0	0	113.7	T11 S16	T11-Y13 VanDerWaalsContact C-N 3.31Å; T11-Y13 PolarHBondContact O-N 2.94Å; Y13-S16 PolarHBondContact O-OG 3.1Å
14	L	91.2	Very high	88.7	Confident	72 Å²	72	112.9 Å²	112.9	38%	0.377	55%	0.548	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.2	-40.9	-176.4	-174.3	69.9	0	0	0	112.2	T11 K55 H58	T11-L14 HydrophobicContact CG2-CD2 4.25Å; T11-L14 PolarHBondContact O-N 3.48Å; L14-K55 HydrophobicContact CD2-CB 3.58Å; L14-H58 HydrophobicContact CD2-CB 4.16Å
15	F	90.4	Very high	89	Confident	16 Å²	16	109 Å²	109	7%	0.07	52%	0.524	C	S	.	.	S	Bend	trans	-101.4	7.8	178.5	-55.9	-50.6	0	0	0	112.4	T11 G46 M52 P53 H58	T11-F15 VanDerWaalsContact CB-CD2 3.45Å; T11-F15 VanDerWaalsContact CB-CE2 3.45Å; T11-F15 HydrophobicContact CG2-CD2 4.13Å; T11-F15 HydrophobicContact CG2-CE2 3.58Å; T11-F15 HydrophobicContact CG2-CZ 4.27Å; T11-F15 PolarHBondContact O-N 3.05Å; F15-G46 VanDerWaalsContact O-CA 3.32Å; F15-G46 WeakPolarHBondContact O-CA 3.4Å; F15-G46 PolarHBondContact O-N 3.07Å; F15-G46 VanDerWaalsContact O-N 3.16Å; F15-M52 HydrophobicContact CD2-SD 4.42Å; F15-P53 HydrophobicContact CE1-CG 4.42Å; F15-P53 VanDerWaalsContact CZ-O 3.29Å; F15-P53 WeakPolarHBondContact CZ-O 3.47Å; F15-H58 AromaticContact CD1-CE1 3.82Å; F15-H58 AromaticContact CD1-ND1 3.44Å; F15-H58 WeakPolarHBondContact CD1-ND1 3.37Å; F15-H58 HydrophobicContact CE1-CB 3.93Å; F15-H58 AromaticContact CE1-CG 3.77Å; F15-H58 AromaticContact CE1-ND1 3.26Å; F15-H58 VanDerWaalsContact CE1-ND1 3.26Å; F15-H58 WeakPolarHBondContact CE1-ND1 3.36Å
16	S	90.6	Very high	89.4	Confident	68 Å²	68	102.8 Å²	102.8	48%	0.476	51%	0.505	S	S	.	.	P	Polyproline II helix	trans	-67.1	142.7	178	63.8	0	0	0	0	109.8	Y13	Y13-S16 PolarHBondContact O-OG 3.1Å
17	R	89.7	Confident	89.7	Confident	52 Å²	52	104.6 Å²	104.6	20%	0.196	51%	0.511	C	S	.	.	P	Polyproline II helix	trans	-74.2	151.5	172.4	-74.7	179	149.1	-154.4	20.4	109.8	H21 G23 D45	R17-H21 WeakPolarHBondContact CD-O 3.4Å; R17-H21 PolarHBondContact NH1-O 3.03Å; R17-G23 VanDerWaalsContact CZ-O 3.25Å; R17-G23 PolarHBondContact NH1-O 3Å; R17-G23 PolarHBondContact NH2-O 3.19Å; R17-D45 IonicContact CZ-OD1 3.29Å; R17-D45 VanDerWaalsContact CZ-OD1 3.29Å; R17-D45 IonicContact CZ-OD2 3.47Å; R17-D45 VanDerWaalsContact NE-CG 3.3Å; R17-D45 IonicContact NE-OD1 2.97Å; R17-D45 PolarHBondContact NE-OD1 3Å; R17-D45 IonicContact NE-OD2 2.85Å; R17-D45 PolarHBondContact NE-OD2 3.42Å; R17-D45 IonicContact NH2-OD1 2.78Å; R17-D45 PolarHBondContact NH2-OD1 3.42Å; R17-D45 IonicContact NH2-OD2 3.42Å; R17-D45 PolarHBondContact NH2-OD2 3.43Å
18	K	91.3	Very high	89.9	Confident	149 Å²	149	101.9 Å²	101.9	65%	0.648	51%	0.511	S	S	*	.	P	Polyproline II helix	trans	-63.7	153.6	173.6	-69.7	-173.9	174.8	-169.1	0	110	R20 H21	K18-R20 PolarHBondContact O-N 3.36Å; K18-H21 HydrophobicContact CB-CB 4.42Å; K18-H21 WeakPolarHBondContact O-CB 3.5Å; K18-H21 PolarHBondContact O-N 3.06Å
19	F	91.1	Very high	90.2	Very high	160 Å²	160	97.4 Å²	97.4	70%	0.702	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.1	136.3	175.9	-178.1	-119.3	0	0	0	111.3	H21	F19-H21 PolarHBondContact O-CD2 3.04Å; F19-H21 PolarHBondContact O-N 3.47Å; F19-H21 VanDerWaalsContact O-N 3.11Å
20	R	90.3	Very high	90.3	Very high	205 Å²	205	97.1 Å²	97.1	77%	0.774	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.7	7.6	-177.1	-61.6	176.1	179.2	173.3	1.4	116.2	K18	K18-R20 PolarHBondContact O-N 3.36Å
21	H	88.8	Confident	90.5	Very high	123 Å²	123	100.6 Å²	100.6	57%	0.569	50%	0.496	S	S	*	.			trans	-101.3	35.8	172.3	-66.7	-81.2	0	0	0	112.1	R17 K18 F19	R17-H21 WeakPolarHBondContact CD-O 3.4Å; R17-H21 PolarHBondContact NH1-O 3.03Å; K18-H21 HydrophobicContact CB-CB 4.42Å; K18-H21 WeakPolarHBondContact O-CB 3.5Å; K18-H21 PolarHBondContact O-N 3.06Å; F19-H21 PolarHBondContact O-CD2 3.04Å; F19-H21 PolarHBondContact O-N 3.47Å; F19-H21 VanDerWaalsContact O-N 3.11Å
22	H	85.8	Confident	90.6	Very high	147 Å²	147	105.9 Å²	105.9	68%	0.681	52%	0.515	S	S	*	.			trans	-75.9	158.7	173.4	-56.9	-73.4	0	0	0	110.6
23	G	88.5	Confident	90.8	Very high	46 Å²	46	101.1 Å²	101.1	47%	0.474	51%	0.509	S	S	.	.	S	Bend	trans	108.9	-169.9	176.6	0	0	0	0	0	115.1	R17	R17-G23 VanDerWaalsContact CZ-O 3.25Å; R17-G23 PolarHBondContact NH1-O 3Å; R17-G23 PolarHBondContact NH2-O 3.19Å
24	P	88.8	Confident	91	Very high	126 Å²	126	93 Å²	93	82%	0.818	48%	0.477	S	S	*	.	S	Bend	trans	-65.2	156.4	179.6	27.1	-33.7	0	0	0	112
25	L	90	Very high	91.1	Very high	25 Å²	25	98.1 Å²	98.1	13%	0.131	49%	0.491	C	S	.	.	P	Polyproline II helix	trans	-68.3	146.6	169.7	-75	168.9	0	0	0	110.1	Y30 D45 V48 E94	L25-Y30 HydrophobicContact CB-CE2 4.02Å; L25-D45 HydrophobicContact CD2-CB 4.44Å; L25-V48 HydrophobicContact CD1-CG2 4.22Å; L25-E94 HydrophobicContact CD1-CB 3.46Å; L25-E94 VanDerWaalsContact CD1-CB 3.46Å; L25-E94 HydrophobicContact CD1-CG 3.64Å
26	P	91.8	Very high	91.4	Very high	77 Å²	77	105.9 Å²	105.9	50%	0.5	52%	0.52	S	S	.	.	P	Polyproline II helix	trans	-64.4	147	176.8	26.6	-31.9	0	0	0	110.6	S28 V29	P26-S28 PolarHBondContact O-N 3.5Å; P26-V29 HydrophobicContact CG-CG2 4.04Å; P26-V29 PolarHBondContact O-N 3.32Å
27	S	92.4	Very high	91.5	Very high	81 Å²	81	105 Å²	105	57%	0.566	52%	0.522	S	S	*	.	H	α-helix	trans	-56.1	-26.3	-178.4	-44.2	0	0	0	0	113.2	V29 Y30 M31	S27-V29 PolarHBondContact O-N 3.22Å; S27-Y30 PolarHBondContact O-N 2.96Å; S27-Y30 VanDerWaalsContact O-N 3.1Å; S27-M31 WeakPolarHBondContact O-CG 3.49Å; S27-M31 PolarHBondContact O-N 3.4Å
28	S	92.2	Very high	91.7	Very high	76 Å²	76	105.4 Å²	105.4	53%	0.531	53%	0.528	S	S	.	.	H	α-helix	trans	-60.3	-24.4	176.1	60.4	0	0	0	0	114.2	P26 R32	P26-S28 PolarHBondContact O-N 3.5Å; S28-R32 WeakPolarHBondContact O-CB 3.3Å
29	V	92.3	Very high	91.8	Very high	30 Å²	30	101.2 Å²	101.2	18%	0.182	51%	0.512	C	S	.	.	H	α-helix	trans	-72.2	-41.2	175	178.4	0	0	0	0	110.5	P26 S27	P26-V29 HydrophobicContact CG-CG2 4.04Å; P26-V29 PolarHBondContact O-N 3.32Å; S27-V29 PolarHBondContact O-N 3.22Å
30	Y	92.4	Very high	92	Very high	105 Å²	105	93.7 Å²	93.7	41%	0.412	48%	0.479	S	S	.	.	H	α-helix	trans	-76.3	-36	-177.5	-60	-72.5	0	0	0	112.9	L25 S27 R32 I93 E94	L25-Y30 HydrophobicContact CB-CE2 4.02Å; S27-Y30 PolarHBondContact O-N 2.96Å; S27-Y30 VanDerWaalsContact O-N 3.1Å; Y30-R32 PolarHBondContact O-N 3.18Å; Y30-I93 HydrophobicContact CD1-CD1 3.84Å; Y30-E94 HydrophobicContact CE1-CG 3.67Å
31	M	93.6	Very high	92.2	Very high	141 Å²	141	86.2 Å²	86.2	70%	0.695	46%	0.455	S	S	*	.	S	Bend	trans	-79.6	-5.2	-179.9	-64.4	-174.9	-69.2	0	0	113.5	S27 V33	S27-M31 WeakPolarHBondContact O-CG 3.49Å; S27-M31 PolarHBondContact O-N 3.4Å; M31-V33 PolarHBondContact O-N 3Å
32	R	91.9	Very high	92.5	Very high	125 Å²	125	80.4 Å²	80.4	47%	0.472	43%	0.428	S	S	.	.			trans	-75.3	121	-175.4	-167.4	152.5	-170	132.6	2.5	110.9	S28 Y30 Y34 P98	S28-R32 WeakPolarHBondContact O-CB 3.3Å; Y30-R32 PolarHBondContact O-N 3.18Å; R32-Y34 HydrophobicContact CB-CE2 4.33Å; R32-Y34 HydrophobicContact CG-CE2 4.36Å; R32-P98 VanDerWaalsContact NH2-CB 3.33Å
33	V	93.2	Very high	92.9	Very high	110 Å²	110	77.9 Å²	77.9	67%	0.667	42%	0.415	S	S	*	.			trans	-79.7	123.3	174.9	-173.8	0	0	0	0	109.4	M31 R35	M31-V33 PolarHBondContact O-N 3Å; V33-R35 HydrophobicContact CG1-CG 4.48Å
34	Y	94.2	Very high	93.1	Very high	20 Å²	20	76 Å²	76	8%	0.078	40%	0.396	C	S	.	.			trans	-105.5	137.7	169.7	-67.6	-75.7	0	0	0	109.5	R32 V40 V72 I93 V96	R32-Y34 HydrophobicContact CB-CE2 4.33Å; R32-Y34 HydrophobicContact CG-CE2 4.36Å; Y34-V40 HydrophobicContact CD1-CG1 3.77Å; Y34-V40 HydrophobicContact CE1-CG1 3.71Å; Y34-V72 HydrophobicContact CD2-CG2 3.93Å; Y34-V72 HydrophobicContact CG-CG2 4.18Å; Y34-I93 HydrophobicContact CD2-CG2 4.49Å; Y34-V96 HydrophobicContact CE1-CG1 3.91Å; Y34-V96 HydrophobicContact CE2-CG1 4.41Å; Y34-V96 PolarHBondContact OH-O 3.13Å; Y34-V96 VanDerWaalsContact OH-O 3.05Å
35	R	94.6	Very high	93.2	Very high	179 Å²	179	71.2 Å²	71.2	68%	0.675	36%	0.363	S	S	*	.			trans	-115.7	158.5	176.7	-60.4	-177.2	-177.3	-162.8	0.3	110.4	V33 G37 D38 V64	V33-R35 HydrophobicContact CG1-CG 4.48Å; R35-G37 PolarHBondContact O-N 2.89Å; R35-D38 PolarHBondContact N-OD2 3.25Å; R35-D38 WeakPolarHBondContact O-CB 3.39Å; R35-D38 PolarHBondContact O-N 2.98Å; R35-V64 WeakPolarHBondContact O-CB 3.27Å; R35-V64 WeakPolarHBondContact O-CG1 3.46Å
36	R	95.7	Very high	93.2	Very high	178 Å²	178	71.5 Å²	71.5	67%	0.672	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.1	134.6	172.1	-66.3	178.3	64.8	123.8	-1.4	109.1	Y65	R36-Y65 PolarHBondContact NE-O 3.42Å; R36-Y65 VanDerWaalsContact NE-O 3.15Å; R36-Y65 PolarHBondContact NH1-O 3.45Å; R36-Y65 VanDerWaalsContact NH1-O 3.1Å; R36-Y65 PolarHBondContact NH2-O 3.41Å; R36-Y65 VanDerWaalsContact NH2-O 3.13Å
37	G	93.2	Very high	93	Very high	51 Å²	51	69.8 Å²	69.8	53%	0.526	37%	0.368	S	S	.	.	T	Hydrogen-bonded Turn	trans	95	-15.7	-176.8	0	0	0	0	0	114.7	R35 V64	R35-G37 PolarHBondContact O-N 2.89Å; G37-V64 PolarHBondContact N-O 3.45Å
38	D	93.2	Very high	93	Very high	60 Å²	60	67.1 Å²	67.1	32%	0.321	35%	0.349	S	S	.	.			trans	-61.1	144.3	177	-70.1	-11.6	0	0	0	111.4	R35 V40 R63 V64	R35-D38 PolarHBondContact N-OD2 3.25Å; R35-D38 WeakPolarHBondContact O-CB 3.39Å; R35-D38 PolarHBondContact O-N 2.98Å; D38-V40 HydrophobicContact CB-CG1 4.46Å; D38-R63 WeakPolarHBondContact O-CA 3.39Å; D38-V64 HydrophobicContact CB-CG2 4.2Å; D38-V64 PolarHBondContact O-N 3.48Å
39	I	94.2	Very high	92.9	Very high	61 Å²	61	69.2 Å²	69.2	31%	0.313	35%	0.35	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	119.1	175	-52.9	-179.2	0	0	0	108.7	T61 R63 S99	I39-T61 HydrophobicContact CG2-CG2 3.35Å; I39-R63 HydrophobicContact CG1-CG 4.4Å; I39-S99 WeakPolarHBondContact CB-OG 3.4Å; I39-S99 WeakPolarHBondContact CG2-OG 3.21Å; I39-S99 WeakPolarHBondContact O-CB 3.36Å; I39-S99 PolarHBondContact O-N 3.21Å; I39-S99 PolarHBondContact O-OG 3.11Å
40	V	95.2	Very high	92.9	Very high	1 Å²	1	75 Å²	75	1%	0.006	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	147.2	-174.7	-63.1	0	0	0	0	111.7	Y34 D38 T61 G62 V64 I74 V96 K97	Y34-V40 HydrophobicContact CD1-CG1 3.77Å; Y34-V40 HydrophobicContact CE1-CG1 3.71Å; D38-V40 HydrophobicContact CB-CG1 4.46Å; V40-T61 CarbonylContact O-C 3.55Å; V40-T61 WeakPolarHBondContact O-CA 3.42Å; V40-G62 PolarHBondContact N-O 3.13Å; V40-G62 PolarHBondContact O-N 2.91Å; V40-V64 HydrophobicContact CB-CG2 4.39Å; V40-V64 HydrophobicContact CG1-CG2 3.74Å; V40-V64 HydrophobicContact CG2-CG2 3.7Å; V40-I74 HydrophobicContact CG2-CD1 3.59Å; V40-I74 HydrophobicContact CG2-CG1 3.74Å; V40-I74 HydrophobicContact CG2-CG2 4.04Å; V40-V96 HydrophobicContact CB-CG1 3.61Å; V40-V96 HydrophobicContact CG1-CG1 3.86Å; V40-V96 HydrophobicContact CG2-CG1 3.9Å; V40-K97 CarbonylContact C-O 3.58Å; V40-K97 VanDerWaalsContact CA-O 3.27Å; V40-K97 WeakPolarHBondContact CA-O 3.38Å; V40-K97 WeakPolarHBondContact CB-O 3.48Å
41	D	94.7	Very high	92.9	Very high	48 Å²	48	71.7 Å²	71.7	26%	0.257	37%	0.371	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	134.3	173.1	-63.1	-37.3	0	0	0	110.3	T61 K97 S99	D41-T61 VanDerWaalsContact OD1-CB 3.3Å; D41-T61 WeakPolarHBondContact OD1-CB 3.33Å; D41-T61 VanDerWaalsContact OD1-CG2 3.28Å; D41-T61 WeakPolarHBondContact OD1-CG2 3.42Å; D41-T61 PolarHBondContact OD1-OG1 3.2Å; D41-K97 HydrophobicContact CB-CB 4.42Å; D41-K97 PolarHBondContact N-O 3.1Å; D41-K97 PolarHBondContact O-N 3.39Å; D41-S99 WeakPolarHBondContact OD2-CA 3.35Å; D41-S99 WeakPolarHBondContact OD2-CB 3.49Å
42	I	95.2	Very high	92.9	Very high	1 Å²	1	66 Å²	66	1%	0.005	34%	0.343	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	110.5	178.7	-63	148.1	0	0	0	108.4	P53 Y57 G59 R60 I74 V76 I89	I42-P53 HydrophobicContact CG2-CB 3.45Å; I42-P53 VanDerWaalsContact CG2-CB 3.45Å; I42-P53 HydrophobicContact CG2-CG 3.63Å; I42-Y57 WeakPolarHBondContact CB-O 3.38Å; I42-G59 PolarHBondContact O-N 2.91Å; I42-R60 PolarHBondContact N-O 3.03Å; I42-I74 HydrophobicContact CD1-CD1 4.26Å; I42-I74 HydrophobicContact CD1-CG2 4.13Å; I42-I74 HydrophobicContact CG1-CD1 3.68Å; I42-V76 HydrophobicContact CD1-CG2 3.26Å; I42-I89 HydrophobicContact CD1-CD1 3.41Å; I42-I89 VanDerWaalsContact CD1-CD1 3.41Å; I42-I89 HydrophobicContact CD1-CG1 4.49Å; I42-I89 HydrophobicContact CG1-CD1 4.16Å
43	K	93.9	Very high	93	Very high	94 Å²	94	60.2 Å²	60.2	41%	0.409	32%	0.322	S	S	.	.			trans	-134.2	98.9	177.4	-171.6	167.8	-171.1	166.7	0	110.1	H95 K97	K43-H95 CarbonylContact C-O 3.59Å; K43-H95 PolarHBondContact N-O 3.03Å; K43-H95 CarbonylContact O-C 3.44Å; K43-H95 VanDerWaalsContact O-CA 3.28Å; K43-H95 WeakPolarHBondContact O-CA 3.4Å; K43-K97 HydrophobicContact CB-CD 4.22Å; K43-K97 HydrophobicContact CB-CG 4.45Å; K43-K97 HydrophobicContact CD-CD 4.24Å
44	G	92.5	Very high	93	Very high	7 Å²	7	57 Å²	57	7%	0.072	30%	0.299	C	S	.	.			trans	-56.9	135.1	173.9	0	0	0	0	0	112	H58	G44-H58 PolarHBondContact N-CE1 2.95Å; G44-H58 PolarHBondContact N-ND1 3.34Å; G44-H58 VanDerWaalsContact N-ND1 3.2Å
45	D	91	Very high	92.9	Very high	26 Å²	26	59.6 Å²	59.6	14%	0.139	31%	0.311	C	S	.	.			trans	-110	124.9	177.3	-175.3	-94.5	0	0	0	108.9	R17 L25 G47 V48 M52 H95	R17-D45 IonicContact CZ-OD1 3.29Å; R17-D45 VanDerWaalsContact CZ-OD1 3.29Å; R17-D45 IonicContact CZ-OD2 3.47Å; R17-D45 VanDerWaalsContact NE-CG 3.3Å; R17-D45 IonicContact NE-OD1 2.97Å; R17-D45 PolarHBondContact NE-OD1 3Å; R17-D45 IonicContact NE-OD2 2.85Å; R17-D45 PolarHBondContact NE-OD2 3.42Å; R17-D45 IonicContact NH2-OD1 2.78Å; R17-D45 PolarHBondContact NH2-OD1 3.42Å; R17-D45 IonicContact NH2-OD2 3.42Å; R17-D45 PolarHBondContact NH2-OD2 3.43Å; L25-D45 HydrophobicContact CD2-CB 4.44Å; D45-G47 PolarHBondContact O-N 3.24Å; D45-G47 WeakPolarHBondContact OD1-CA 3.41Å; D45-G47 PolarHBondContact OD1-N 3.39Å; D45-V48 PolarHBondContact O-N 3.46Å; D45-M52 VanDerWaalsContact O-CE 3.31Å; D45-M52 WeakPolarHBondContact O-CE 3.33Å; D45-H95 PolarHBondContact N-ND1 2.8Å; D45-H95 PolarHBondContact O-CE1 3.01Å
46	G	89.6	Confident	92.8	Very high	30 Å²	30	53.2 Å²	53.2	31%	0.309	29%	0.294	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65	-16	-177.8	0	0	0	0	0	115.1	F15 V48	F15-G46 VanDerWaalsContact O-CA 3.32Å; F15-G46 WeakPolarHBondContact O-CA 3.4Å; F15-G46 PolarHBondContact O-N 3.07Å; F15-G46 VanDerWaalsContact O-N 3.16Å; G46-V48 VanDerWaalsContact C-N 3.33Å
47	G	89	Confident	92.7	Very high	41 Å²	41	46.4 Å²	46.4	42%	0.423	27%	0.268	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.2	-23.9	-179.8	0	0	0	0	0	113.7	D45	D45-G47 PolarHBondContact O-N 3.24Å; D45-G47 WeakPolarHBondContact OD1-CA 3.41Å; D45-G47 PolarHBondContact OD1-N 3.39Å
48	V	90.7	Very high	92.7	Very high	26 Å²	26	45.7 Å²	45.7	16%	0.158	25%	0.251	C	S	.	.			trans	-122.3	115.1	-178.1	175.8	0	0	0	0	108.6	L25 D45 G46 M52 E94 H95	L25-V48 HydrophobicContact CD1-CG2 4.22Å; D45-V48 PolarHBondContact O-N 3.46Å; G46-V48 VanDerWaalsContact C-N 3.33Å; V48-M52 WeakPolarHBondContact O-CE 3.43Å; V48-E94 HydrophobicContact CB-CB 4.28Å; V48-E94 HydrophobicContact CB-CG 4.44Å; V48-E94 HydrophobicContact CG1-CB 4.35Å; V48-E94 HydrophobicContact CG1-CG 4.29Å; V48-E94 HydrophobicContact CG2-CB 4.22Å; V48-E94 HydrophobicContact CG2-CG 4.01Å; V48-H95 PolarHBondContact O-CE1 2.9Å; V48-H95 PolarHBondContact O-NE2 3.43Å; V48-H95 VanDerWaalsContact O-NE2 3.14Å
49	Q	90.4	Very high	92.7	Very high	119 Å²	119	45.6 Å²	45.6	56%	0.556	26%	0.264	S	S	*	.			trans	-85.8	-24.2	-176.5	-52.5	79.7	22	0	0	112.7	R8	R8-Q49 PolarHBondContact NH2-O 3.04Å
50	K	92.4	Very high	92.7	Very high	151 Å²	151	49.6 Å²	49.6	66%	0.657	28%	0.275	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.1	135.1	-177.6	-69.5	-176.7	-178.8	-179.6	0	110.3	M52 R92 H95	K50-M52 PolarHBondContact O-N 3.44Å; K50-R92 WeakPolarHBondContact O-CD 3.45Å; K50-H95 PolarHBondContact O-NE2 3.31Å
51	G	92.5	Very high	92.7	Very high	37 Å²	37	53 Å²	53	38%	0.381	30%	0.296	S	S	.	.	T	Hydrogen-bonded Turn	trans	68.7	17.4	176.4	0	0	0	0	0	115.3	H95	G51-H95 PolarHBondContact O-CD2 2.83Å
52	M	93.7	Very high	92.7	Very high	21 Å²	21	51.1 Å²	51.1	10%	0.103	29%	0.288	C	S	.	.	P	Polyproline II helix	trans	-55.8	137.8	175.9	-85.3	-171.8	164.4	0	0	111.7	R8 F15 D45 V48 K50	R8-M52 PolarHBondContact NE-SD 2.64Å; R8-M52 VanDerWaalsContact NE-SD 3.45Å; R8-M52 PolarHBondContact NH2-SD 2.79Å; F15-M52 HydrophobicContact CD2-SD 4.42Å; D45-M52 VanDerWaalsContact O-CE 3.31Å; D45-M52 WeakPolarHBondContact O-CE 3.33Å; V48-M52 WeakPolarHBondContact O-CE 3.43Å; K50-M52 PolarHBondContact O-N 3.44Å
53	P	94.8	Very high	92.7	Very high	4 Å²	4	59 Å²	59	3%	0.026	32%	0.318	C	S	.	.	P	Polyproline II helix	trans	-71	150.8	173.2	30.3	-34.7	0	0	0	111.2	F15 I42 V91	F15-P53 HydrophobicContact CE1-CG 4.42Å; F15-P53 VanDerWaalsContact CZ-O 3.29Å; F15-P53 WeakPolarHBondContact CZ-O 3.47Å; I42-P53 HydrophobicContact CG2-CB 3.45Å; I42-P53 VanDerWaalsContact CG2-CB 3.45Å; I42-P53 HydrophobicContact CG2-CG 3.63Å; P53-V91 HydrophobicContact CB-CG2 4.11Å
54	H	93.2	Very high	92.8	Very high	42 Å²	42	54.8 Å²	54.8	19%	0.194	30%	0.3	C	S	.	.	P	Polyproline II helix	trans	-63.6	146.4	168.8	-176.3	-112.8	0	0	0	110.1	Y7 S56 Y57 H58	Y7-H54 AromaticContact CD2-CD2 3.73Å; Y7-H54 HydrophobicContact CE1-CB 4.42Å; Y7-H54 HydrophobicContact CE2-CB 3.86Å; Y7-H54 AromaticContact CE2-CD2 3.53Å; Y7-H54 AromaticContact CE2-CG 3.99Å; Y7-H54 AromaticContact CZ-CD2 3.92Å; Y7-H54 WeakPolarHBondContact OH-CA 3.45Å; Y7-H54 WeakPolarHBondContact OH-CB 3.14Å; Y7-H54 PolarHBondContact OH-N 3.28Å; H54-S56 PolarHBondContact CE1-OG 2.94Å; H54-S56 WeakPolarHBondContact ND1-CB 3.32Å; H54-S56 PolarHBondContact ND1-N 3.28Å; H54-S56 PolarHBondContact ND1-OG 3.35Å; H54-S56 PolarHBondContact O-N 3.46Å; H54-Y57 HydrophobicContact CB-CD2 3.75Å; H54-Y57 HydrophobicContact CB-CE2 4.09Å; H54-Y57 PolarHBondContact O-N 3.05Å; H54-H58 PolarHBondContact O-N 3.1Å
55	K	92	Very high	93	Very high	74 Å²	74	56.8 Å²	56.8	32%	0.322	31%	0.306	S	S	.	.	G	3₁₀ helix	trans	-52	-33.2	-179.4	64.6	180	176.2	-176.1	0	114.5	R9 T11 L14 Y57 H58	R9-K55 PolarHBondContact O-NZ 3.06Å; T11-K55 HydrophobicContact CG2-CB 3.74Å; T11-K55 HydrophobicContact CG2-CD 4.05Å; T11-K55 HydrophobicContact CG2-CG 4.42Å; L14-K55 HydrophobicContact CD2-CB 3.58Å; K55-Y57 PolarHBondContact O-N 3.15Å; K55-H58 PolarHBondContact O-N 3.15Å
56	S	92.2	Very high	93.2	Very high	46 Å²	46	58.2 Å²	58.2	32%	0.322	31%	0.313	S	S	.	.	G	3₁₀ helix	trans	-65.1	-24.5	177.5	-54.7	0	0	0	0	114.1	H54	H54-S56 PolarHBondContact CE1-OG 2.94Å; H54-S56 WeakPolarHBondContact ND1-CB 3.32Å; H54-S56 PolarHBondContact ND1-N 3.28Å; H54-S56 PolarHBondContact ND1-OG 3.35Å; H54-S56 PolarHBondContact O-N 3.46Å
57	Y	94.2	Very high	93.4	Very high	34 Å²	34	59.7 Å²	59.7	13%	0.133	32%	0.316	C	S	.	.	G	3₁₀ helix	trans	-99.2	-10.4	-179.7	-54.8	-61.8	0	0	0	112.3	I42 H54 K55 G59 R60 V76 K78 K87 I89	I42-Y57 WeakPolarHBondContact CB-O 3.38Å; H54-Y57 HydrophobicContact CB-CD2 3.75Å; H54-Y57 HydrophobicContact CB-CE2 4.09Å; H54-Y57 PolarHBondContact O-N 3.05Å; K55-Y57 PolarHBondContact O-N 3.15Å; Y57-G59 PolarHBondContact O-N 3.35Å; Y57-R60 WeakPolarHBondContact O-CB 3.49Å; Y57-R60 PolarHBondContact O-N 3.37Å; Y57-R60 VanDerWaalsContact O-N 3.13Å; Y57-V76 HydrophobicContact CD1-CB 4.31Å; Y57-V76 HydrophobicContact CD1-CG1 4.17Å; Y57-K78 HydrophobicContact CE1-CB 4.28Å; Y57-K78 HydrophobicContact CE1-CD 3.69Å; Y57-K78 HydrophobicContact CE1-CG 4.46Å; Y57-K87 HydrophobicContact CE1-CB 4.01Å; Y57-K87 HydrophobicContact CE1-CG 4.4Å; Y57-I89 HydrophobicContact CD1-CG2 4.44Å; Y57-I89 HydrophobicContact CD2-CD1 4.41Å; Y57-I89 HydrophobicContact CD2-CG2 3.85Å; Y57-I89 HydrophobicContact CE1-CG2 4.26Å; Y57-I89 HydrophobicContact CE2-CG2 3.66Å; Y57-I89 HydrophobicContact CG-CD1 4.17Å; Y57-I89 HydrophobicContact CG-CG2 4.26Å
58	H	93.2	Very high	93.7	Very high	36 Å²	36	60.4 Å²	60.4	17%	0.167	31%	0.313	C	S	.	.	T	Hydrogen-bonded Turn	trans	-63.1	133.2	174.9	-171.1	90.7	0	0	0	110.4	L14 F15 G44 H54 K55 R60	L14-H58 HydrophobicContact CD2-CB 4.16Å; F15-H58 AromaticContact CD1-CE1 3.82Å; F15-H58 AromaticContact CD1-ND1 3.44Å; F15-H58 WeakPolarHBondContact CD1-ND1 3.37Å; F15-H58 HydrophobicContact CE1-CB 3.93Å; F15-H58 AromaticContact CE1-CG 3.77Å; F15-H58 AromaticContact CE1-ND1 3.26Å; F15-H58 VanDerWaalsContact CE1-ND1 3.26Å; F15-H58 WeakPolarHBondContact CE1-ND1 3.36Å; G44-H58 PolarHBondContact N-CE1 2.95Å; G44-H58 PolarHBondContact N-ND1 3.34Å; G44-H58 VanDerWaalsContact N-ND1 3.2Å; H54-H58 PolarHBondContact O-N 3.1Å; K55-H58 PolarHBondContact O-N 3.15Å; H58-R60 PolarHBondContact O-N 2.93Å
59	G	92.7	Very high	93.7	Very high	58 Å²	58	65 Å²	65	60%	0.598	34%	0.343	S	S	*	.	T	Hydrogen-bonded Turn	trans	73.8	9.1	-176.7	0	0	0	0	0	114.1	I42 Y57	I42-G59 PolarHBondContact O-N 2.91Å; Y57-G59 PolarHBondContact O-N 3.35Å
60	R	93.6	Very high	93.8	Very high	145 Å²	145	65.4 Å²	65.4	55%	0.547	34%	0.344	S	S	.	.			trans	-92.8	144.2	174.1	-59.1	-62	-178.9	171.2	-4.9	110.7	I42 Y57 H58 V76	I42-R60 PolarHBondContact N-O 3.03Å; Y57-R60 WeakPolarHBondContact O-CB 3.49Å; Y57-R60 PolarHBondContact O-N 3.37Å; Y57-R60 VanDerWaalsContact O-N 3.13Å; H58-R60 PolarHBondContact O-N 2.93Å; R60-V76 HydrophobicContact CB-CG1 3.64Å; R60-V76 HydrophobicContact CG-CG1 4.19Å
61	T	94.9	Very high	93.9	Very high	73 Å²	73	59 Å²	59	45%	0.448	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.4	143	171.2	-47.8	0	0	0	0	109.4	I39 V40 D41	I39-T61 HydrophobicContact CG2-CG2 3.35Å; V40-T61 CarbonylContact O-C 3.55Å; V40-T61 WeakPolarHBondContact O-CA 3.42Å; D41-T61 VanDerWaalsContact OD1-CB 3.3Å; D41-T61 WeakPolarHBondContact OD1-CB 3.33Å; D41-T61 VanDerWaalsContact OD1-CG2 3.28Å; D41-T61 WeakPolarHBondContact OD1-CG2 3.42Å; D41-T61 PolarHBondContact OD1-OG1 3.2Å
62	G	94.6	Very high	94.1	Very high	8 Å²	8	57.2 Å²	57.2	8%	0.082	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.7	173.5	176.4	0	0	0	0	0	112	V40 I75	V40-G62 PolarHBondContact N-O 3.13Å; V40-G62 PolarHBondContact O-N 2.91Å; G62-I75 WeakPolarHBondContact CA-O 3.46Å
63	R	95.3	Very high	94.2	Very high	167 Å²	167	56.2 Å²	56.2	63%	0.63	30%	0.297	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.9	136.8	176.1	-72.3	-176.2	176.5	174.6	-1.1	110.5	D38 I39 Y65 I74 I75	D38-R63 WeakPolarHBondContact O-CA 3.39Å; I39-R63 HydrophobicContact CG1-CG 4.4Å; R63-Y65 PolarHBondContact O-N 3.04Å; R63-I74 CarbonylContact O-C 3.39Å; R63-I74 WeakPolarHBondContact O-CA 3.42Å; R63-I75 PolarHBondContact N-O 3.36Å; R63-I75 VanDerWaalsContact N-O 3.1Å; R63-I75 PolarHBondContact O-N 2.86Å
64	V	96.4	Very high	94.3	Very high	5 Å²	5	56 Å²	56	3%	0.03	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.7	120.6	174.7	178	0	0	0	0	109.5	R35 G37 D38 V40 V67 V72 G73	R35-V64 WeakPolarHBondContact O-CB 3.27Å; R35-V64 WeakPolarHBondContact O-CG1 3.46Å; G37-V64 PolarHBondContact N-O 3.45Å; D38-V64 HydrophobicContact CB-CG2 4.2Å; D38-V64 PolarHBondContact O-N 3.48Å; V40-V64 HydrophobicContact CB-CG2 4.39Å; V40-V64 HydrophobicContact CG1-CG2 3.74Å; V40-V64 HydrophobicContact CG2-CG2 3.7Å; V64-V67 HydrophobicContact CG1-CG2 3.71Å; V64-V72 HydrophobicContact CB-CG1 4.05Å; V64-V72 HydrophobicContact CG1-CG1 3.46Å; V64-V72 VanDerWaalsContact CG1-CG1 3.46Å; V64-V72 HydrophobicContact CG2-CG1 3.49Å; V64-V72 VanDerWaalsContact CG2-CG1 3.49Å; V64-G73 CarbonylContact C-O 3.47Å; V64-G73 WeakPolarHBondContact CA-O 3.5Å
65	Y	96.3	Very high	94.5	Very high	50 Å²	50	56.6 Å²	56.6	20%	0.196	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.2	-28.3	175.5	81.7	-92.1	0	0	0	112.5	R36 R63 G73 I75 R88 N90	R36-Y65 PolarHBondContact NE-O 3.42Å; R36-Y65 VanDerWaalsContact NE-O 3.15Å; R36-Y65 PolarHBondContact NH1-O 3.45Å; R36-Y65 VanDerWaalsContact NH1-O 3.1Å; R36-Y65 PolarHBondContact NH2-O 3.41Å; R36-Y65 VanDerWaalsContact NH2-O 3.13Å; R63-Y65 PolarHBondContact O-N 3.04Å; Y65-G73 WeakPolarHBondContact CD1-O 3.46Å; Y65-G73 PolarHBondContact N-O 2.9Å; Y65-I75 HydrophobicContact CD1-CG1 3.88Å; Y65-I75 HydrophobicContact CG-CD1 4.28Å; Y65-I75 HydrophobicContact CG-CG1 4.12Å; Y65-R88 HydrophobicContact CD1-CG 4.46Å; Y65-R88 HydrophobicContact CE1-CB 4.05Å; Y65-R88 HydrophobicContact CE1-CG 4.28Å; Y65-N90 PolarHBondContact OH-OD1 2.78Å
66	N	94.8	Very high	94.6	Very high	56 Å²	56	53.1 Å²	53.1	30%	0.299	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.8	149.2	-179.6	-171.6	33.6	0	0	0	109.9	G73	N66-G73 PolarHBondContact N-O 3.37Å; N66-G73 WeakPolarHBondContact O-CA 3.28Å; N66-G73 PolarHBondContact O-N 2.93Å
67	V	95.5	Very high	94.7	Very high	60 Å²	60	56.1 Å²	56.1	36%	0.364	30%	0.297	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	126.5	175.7	-177.5	0	0	0	0	107	V64	V64-V67 HydrophobicContact CG1-CG2 3.71Å
68	T	93.9	Very high	94.7	Very high	57 Å²	57	57.4 Å²	57.4	35%	0.35	30%	0.303	S	S	.	.			trans	-117.2	168.4	177.5	76.1	0	0	0	0	109.3	H70 A71	T68-H70 PolarHBondContact O-N 2.88Å; T68-A71 PolarHBondContact N-O 2.86Å; T68-A71 PolarHBondContact O-N 2.6Å; T68-A71 WeakPolarHBondContact OG1-CA 3.3Å; T68-A71 WeakPolarHBondContact OG1-CB 3.17Å; T68-A71 PolarHBondContact OG1-N 3.33Å; T68-A71 VanDerWaalsContact OG1-N 3.15Å; T68-A71 PolarHBondContact OG1-O 2.82Å
69	P	92.1	Very high	94.7	Very high	122 Å²	122	64.9 Å²	64.9	79%	0.792	33%	0.33	S	S	*	.	S	Bend	trans	-55	-28.3	-175	-29.5	36.5	0	0	0	115.4
70	H	91.3	Very high	94.7	Very high	127 Å²	127	65.5 Å²	65.5	59%	0.588	32%	0.321	S	S	*	.	S	Bend	trans	-127.3	-6.1	-177.4	-58.3	-49.6	0	0	0	114.2	T68 R92 I93	T68-H70 PolarHBondContact O-N 2.88Å; H70-R92 WeakPolarHBondContact O-CA 3.45Å; H70-I93 PolarHBondContact O-N 2.7Å
71	A	94.7	Very high	94.6	Very high	16 Å²	16	61.2 Å²	61.2	13%	0.132	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.4	161.4	-171.6	0	0	0	0	0	112.8	T68 V91 R92	T68-A71 PolarHBondContact N-O 2.86Å; T68-A71 PolarHBondContact O-N 2.6Å; T68-A71 WeakPolarHBondContact OG1-CA 3.3Å; T68-A71 WeakPolarHBondContact OG1-CB 3.17Å; T68-A71 PolarHBondContact OG1-N 3.33Å; T68-A71 VanDerWaalsContact OG1-N 3.15Å; T68-A71 PolarHBondContact OG1-O 2.82Å; A71-V91 CarbonylContact C-O 3.51Å; A71-V91 WeakPolarHBondContact CA-O 3.42Å; A71-V91 WeakPolarHBondContact CB-O 3.27Å; A71-R92 HydrophobicContact CB-CG 4.31Å
72	V	95.9	Very high	94.6	Very high	1 Å²	1	65.3 Å²	65.3	1%	0.006	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	126.5	178.3	-173.8	0	0	0	0	107.9	Y34 V64 I74 V91 I93 V96	Y34-V72 HydrophobicContact CD2-CG2 3.93Å; Y34-V72 HydrophobicContact CG-CG2 4.18Å; V64-V72 HydrophobicContact CB-CG1 4.05Å; V64-V72 HydrophobicContact CG1-CG1 3.46Å; V64-V72 VanDerWaalsContact CG1-CG1 3.46Å; V64-V72 HydrophobicContact CG2-CG1 3.49Å; V64-V72 VanDerWaalsContact CG2-CG1 3.49Å; V72-I74 HydrophobicContact CG1-CG1 4Å; V72-V91 PolarHBondContact N-O 3.4Å; V72-V91 PolarHBondContact O-N 2.83Å; V72-I93 HydrophobicContact CG2-CG2 4.03Å; V72-V96 HydrophobicContact CB-CG2 4.35Å
73	G	96.6	Very high	94.6	Very high	0 Å²	0	74.3 Å²	74.3	0%	0	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.4	122	169.7	0	0	0	0	0	109.7	V64 Y65 N66 I89 N90	V64-G73 CarbonylContact C-O 3.47Å; V64-G73 WeakPolarHBondContact CA-O 3.5Å; Y65-G73 WeakPolarHBondContact CD1-O 3.46Å; Y65-G73 PolarHBondContact N-O 2.9Å; N66-G73 PolarHBondContact N-O 3.37Å; N66-G73 WeakPolarHBondContact O-CA 3.28Å; N66-G73 PolarHBondContact O-N 2.93Å; G73-I89 CarbonylContact C-O 3.6Å; G73-I89 VanDerWaalsContact CA-O 3.31Å; G73-I89 WeakPolarHBondContact CA-O 3.31Å; G73-N90 WeakPolarHBondContact CA-OD1 3.47Å
74	I	96.9	Very high	94.6	Very high	0 Å²	0	72.2 Å²	72.2	0%	0	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	134.4	-176.3	-54.5	165	0	0	0	109.9	V40 I42 R63 V72 V76 I89 V96	V40-I74 HydrophobicContact CG2-CD1 3.59Å; V40-I74 HydrophobicContact CG2-CG1 3.74Å; V40-I74 HydrophobicContact CG2-CG2 4.04Å; I42-I74 HydrophobicContact CD1-CD1 4.26Å; I42-I74 HydrophobicContact CD1-CG2 4.13Å; I42-I74 HydrophobicContact CG1-CD1 3.68Å; R63-I74 CarbonylContact O-C 3.39Å; R63-I74 WeakPolarHBondContact O-CA 3.42Å; V72-I74 HydrophobicContact CG1-CG1 4Å; I74-V76 HydrophobicContact CG2-CG2 3.89Å; I74-I89 HydrophobicContact CB-CG1 4.05Å; I74-I89 PolarHBondContact N-O 2.81Å; I74-I89 WeakPolarHBondContact O-CG1 3.12Å; I74-I89 PolarHBondContact O-N 3.1Å; I74-V96 HydrophobicContact CD1-CG1 4.25Å; I74-V96 HydrophobicContact CD1-CG2 3.82Å
75	I	96.5	Very high	94.5	Very high	53 Å²	53	74.9 Å²	74.9	27%	0.272	39%	0.386	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	118.9	168.1	-64.7	164.7	0	0	0	108.1	G62 R63 Y65 P86 K87 R88	G62-I75 WeakPolarHBondContact CA-O 3.46Å; R63-I75 PolarHBondContact N-O 3.36Å; R63-I75 VanDerWaalsContact N-O 3.1Å; R63-I75 PolarHBondContact O-N 2.86Å; Y65-I75 HydrophobicContact CD1-CG1 3.88Å; Y65-I75 HydrophobicContact CG-CD1 4.28Å; Y65-I75 HydrophobicContact CG-CG1 4.12Å; I75-P86 HydrophobicContact CG2-CB 3.9Å; I75-K87 WeakPolarHBondContact CA-O 3.49Å; I75-R88 HydrophobicContact CG1-CG 3.97Å
76	V	95.7	Very high	94.4	Very high	2 Å²	2	76.5 Å²	76.5	1%	0.012	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	130.6	177.9	-175.3	0	0	0	0	109.5	I42 Y57 R60 I74 K78 K87 I89	I42-V76 HydrophobicContact CD1-CG2 3.26Å; Y57-V76 HydrophobicContact CD1-CB 4.31Å; Y57-V76 HydrophobicContact CD1-CG1 4.17Å; R60-V76 HydrophobicContact CB-CG1 3.64Å; R60-V76 HydrophobicContact CG-CG1 4.19Å; I74-V76 HydrophobicContact CG2-CG2 3.89Å; V76-K78 PolarHBondContact O-N 2.82Å; V76-K87 PolarHBondContact N-O 3.05Å; V76-K87 PolarHBondContact O-N 3.28Å; V76-I89 HydrophobicContact CG2-CD1 3.94Å; V76-I89 HydrophobicContact CG2-CG1 4.25Å
77	N	93.4	Very high	94.5	Very high	109 Å²	109	77.4 Å²	77.4	58%	0.583	41%	0.405	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-77	115.9	171.8	-69.6	-20	0	0	0	109.5	I84	N77-I84 HydrophobicContact CB-CG2 3.92Å
78	K	93.7	Very high	94.5	Very high	61 Å²	61	83.5 Å²	83.5	27%	0.265	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.8	129.9	178	-175.8	-179	179.7	-176.7	0	109.7	Y57 V76 V80 I85 K87	Y57-K78 HydrophobicContact CE1-CB 4.28Å; Y57-K78 HydrophobicContact CE1-CD 3.69Å; Y57-K78 HydrophobicContact CE1-CG 4.46Å; V76-K78 PolarHBondContact O-N 2.82Å; K78-V80 HydrophobicContact CD-CG2 4.42Å; K78-V80 HydrophobicContact CG-CG2 4.32Å; K78-I85 PolarHBondContact N-O 3.3Å; K78-I85 PolarHBondContact O-N 3.3Å; K78-K87 HydrophobicContact CB-CG 4.07Å; K78-K87 HydrophobicContact CD-CG 4.5Å
79	R	93.3	Very high	94.5	Very high	193 Å²	193	81.8 Å²	81.8	73%	0.728	41%	0.409	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.1	125.7	169.4	-170.8	174.1	177.6	169	0.1	109.7	G81	R79-G81 WeakPolarHBondContact CG-O 3.5Å; R79-G81 PolarHBondContact NE-O 2.9Å
80	V	93	Very high	94.6	Very high	70 Å²	70	81 Å²	81	42%	0.424	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	104.4	175.3	-177.1	0	0	0	0	107.1	K78 N82 R83 I85	K78-V80 HydrophobicContact CD-CG2 4.42Å; K78-V80 HydrophobicContact CG-CG2 4.32Å; V80-N82 PolarHBondContact O-N 3.05Å; V80-R83 PolarHBondContact N-O 3.26Å; V80-R83 PolarHBondContact O-N 2.92Å; V80-I85 HydrophobicContact CB-CD1 4.03Å; V80-I85 HydrophobicContact CG2-CD1 4.26Å
81	G	92.3	Very high	94.8	Very high	55 Å²	55	75 Å²	75	57%	0.567	37%	0.371	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.7	-121.6	-169.7	0	0	0	0	0	111.5	R79	R79-G81 WeakPolarHBondContact CG-O 3.5Å; R79-G81 PolarHBondContact NE-O 2.9Å
82	N	93.7	Very high	94.8	Very high	159 Å²	159	77.4 Å²	77.4	85%	0.85	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.4	-1	-174.5	-62.9	1.9	0	0	0	113.7	V80	V80-N82 PolarHBondContact O-N 3.05Å
83	R	95	Very high	94.8	Very high	198 Å²	198	79 Å²	79	75%	0.747	38%	0.384	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.6	152.5	-175.3	-59.6	-177.2	-173.8	166.4	1.9	112.1	V80	V80-R83 PolarHBondContact N-O 3.26Å; V80-R83 PolarHBondContact O-N 2.92Å
84	I	94.7	Very high	94.7	Very high	123 Å²	123	79.6 Å²	79.6	63%	0.631	39%	0.387	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.7	121.9	171.9	-59.4	176	0	0	0	107.6	N77	N77-I84 HydrophobicContact CB-CG2 3.92Å
85	I	94.4	Very high	94.6	Very high	60 Å²	60	79.6 Å²	79.6	31%	0.308	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	129.2	-178.2	-59.4	176.3	0	0	0	108.9	K78 V80 K87	K78-I85 PolarHBondContact N-O 3.3Å; K78-I85 PolarHBondContact O-N 3.3Å; V80-I85 HydrophobicContact CB-CD1 4.03Å; V80-I85 HydrophobicContact CG2-CD1 4.26Å; I85-K87 HydrophobicContact CG2-CD 4.09Å; I85-K87 PolarHBondContact O-N 3.32Å
86	P	95.3	Very high	94.5	Very high	84 Å²	84	77.2 Å²	77.2	55%	0.545	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.4	118.3	170.1	28.4	-32.4	0	0	0	109.1	I75	I75-P86 HydrophobicContact CG2-CB 3.9Å
87	K	95.8	Very high	94.4	Very high	76 Å²	76	82.1 Å²	82.1	33%	0.33	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	125.2	176.4	-65.7	-61.9	-176.4	-176	0	109.5	Y57 I75 V76 K78 I85	Y57-K87 HydrophobicContact CE1-CB 4.01Å; Y57-K87 HydrophobicContact CE1-CG 4.4Å; I75-K87 WeakPolarHBondContact CA-O 3.49Å; V76-K87 PolarHBondContact N-O 3.05Å; V76-K87 PolarHBondContact O-N 3.28Å; K78-K87 HydrophobicContact CB-CG 4.07Å; K78-K87 HydrophobicContact CD-CG 4.5Å; I85-K87 HydrophobicContact CG2-CD 4.09Å; I85-K87 PolarHBondContact O-N 3.32Å
88	R	95.5	Very high	94.4	Very high	188 Å²	188	79 Å²	79	71%	0.709	38%	0.382	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.6	126	171.8	-66.8	178	-177.6	179.2	0.9	108.6	Y65 I75	Y65-R88 HydrophobicContact CD1-CG 4.46Å; Y65-R88 HydrophobicContact CE1-CB 4.05Å; Y65-R88 HydrophobicContact CE1-CG 4.28Å; I75-R88 HydrophobicContact CG1-CG 3.97Å
89	I	94.6	Very high	94.2	Very high	20 Å²	20	76.6 Å²	76.6	10%	0.103	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	148.4	176.2	64.6	170	0	0	0	109.5	I42 Y57 G73 I74 V76 V91	I42-I89 HydrophobicContact CD1-CD1 3.41Å; I42-I89 VanDerWaalsContact CD1-CD1 3.41Å; I42-I89 HydrophobicContact CD1-CG1 4.49Å; I42-I89 HydrophobicContact CG1-CD1 4.16Å; Y57-I89 HydrophobicContact CD1-CG2 4.44Å; Y57-I89 HydrophobicContact CD2-CD1 4.41Å; Y57-I89 HydrophobicContact CD2-CG2 3.85Å; Y57-I89 HydrophobicContact CE1-CG2 4.26Å; Y57-I89 HydrophobicContact CE2-CG2 3.66Å; Y57-I89 HydrophobicContact CG-CD1 4.17Å; Y57-I89 HydrophobicContact CG-CG2 4.26Å; G73-I89 CarbonylContact C-O 3.6Å; G73-I89 VanDerWaalsContact CA-O 3.31Å; G73-I89 WeakPolarHBondContact CA-O 3.31Å; I74-I89 HydrophobicContact CB-CG1 4.05Å; I74-I89 PolarHBondContact N-O 2.81Å; I74-I89 WeakPolarHBondContact O-CG1 3.12Å; I74-I89 PolarHBondContact O-N 3.1Å; V76-I89 HydrophobicContact CG2-CD1 3.94Å; V76-I89 HydrophobicContact CG2-CG1 4.25Å; I89-V91 HydrophobicContact CB-CG2 4.43Å; I89-V91 HydrophobicContact CD1-CG2 3.6Å; I89-V91 HydrophobicContact CG1-CG2 3.99Å
90	N	94.4	Very high	93.9	Very high	106 Å²	106	75 Å²	75	57%	0.567	37%	0.372	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-111.7	121.1	172.3	-64.9	-30.3	0	0	0	107.8	Y65 G73	Y65-N90 PolarHBondContact OH-OD1 2.78Å; G73-N90 WeakPolarHBondContact CA-OD1 3.47Å
91	V	95.4	Very high	93.5	Very high	2 Å²	2	78.6 Å²	78.6	1%	0.012	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	136.2	-174.1	178.4	0	0	0	0	107.8	P53 A71 V72 I89 H95 V96	P53-V91 HydrophobicContact CB-CG2 4.11Å; A71-V91 CarbonylContact C-O 3.51Å; A71-V91 WeakPolarHBondContact CA-O 3.42Å; A71-V91 WeakPolarHBondContact CB-O 3.27Å; V72-V91 PolarHBondContact N-O 3.4Å; V72-V91 PolarHBondContact O-N 2.83Å; I89-V91 HydrophobicContact CB-CG2 4.43Å; I89-V91 HydrophobicContact CD1-CG2 3.6Å; I89-V91 HydrophobicContact CG1-CG2 3.99Å; V91-H95 HydrophobicContact CG1-CB 3.44Å; V91-H95 VanDerWaalsContact CG1-CB 3.44Å; V91-V96 HydrophobicContact CB-CG2 4.21Å; V91-V96 HydrophobicContact CG1-CG2 3.92Å
92	R	95.6	Very high	93.1	Very high	65 Å²	65	82.6 Å²	82.6	25%	0.245	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.5	154.7	178	-69.6	-177.5	71.7	-180	5.6	111.9	K50 H70 A71 E94 H95	K50-R92 WeakPolarHBondContact O-CD 3.45Å; H70-R92 WeakPolarHBondContact O-CA 3.45Å; A71-R92 HydrophobicContact CB-CG 4.31Å; R92-E94 WeakPolarHBondContact CB-OE2 3.49Å; R92-E94 IonicContact CZ-OE1 3.19Å; R92-E94 IonicContact CZ-OE2 3.92Å; R92-E94 IonicContact NE-OE1 3.5Å; R92-E94 IonicContact NE-OE2 3.43Å; R92-E94 PolarHBondContact NE-OE2 2.73Å; R92-E94 IonicContact NH1-OE1 3.78Å; R92-E94 IonicContact NH2-OE1 2.96Å; R92-E94 PolarHBondContact NH2-OE1 3.15Å; R92-E94 PolarHBondContact O-N 3.45Å; R92-E94 VanDerWaalsContact O-N 3.08Å; R92-H95 PolarHBondContact O-N 2.82Å
93	I	94.4	Very high	92.9	Very high	34 Å²	34	81 Å²	81	17%	0.174	37%	0.367	C	S	.	.	G	3₁₀ helix	trans	-53.5	-30.9	-175.4	54.1	170.8	0	0	0	113.6	Y30 Y34 H70 V72 H95 V96	Y30-I93 HydrophobicContact CD1-CD1 3.84Å; Y34-I93 HydrophobicContact CD2-CG2 4.49Å; H70-I93 PolarHBondContact O-N 2.7Å; V72-I93 HydrophobicContact CG2-CG2 4.03Å; I93-H95 PolarHBondContact O-N 3.05Å; I93-H95 VanDerWaalsContact O-N 3.16Å; I93-V96 PolarHBondContact O-N 3.02Å
94	E	94.3	Very high	92.7	Very high	13 Å²	13	73.4 Å²	73.4	6%	0.061	34%	0.341	C	S	.	.	G	3₁₀ helix	trans	-62.7	-21.8	178.9	-62.3	97.5	146.3	0	0	113.2	L25 Y30 V48 R92	L25-E94 HydrophobicContact CD1-CB 3.46Å; L25-E94 VanDerWaalsContact CD1-CB 3.46Å; L25-E94 HydrophobicContact CD1-CG 3.64Å; Y30-E94 HydrophobicContact CE1-CG 3.67Å; V48-E94 HydrophobicContact CB-CB 4.28Å; V48-E94 HydrophobicContact CB-CG 4.44Å; V48-E94 HydrophobicContact CG1-CB 4.35Å; V48-E94 HydrophobicContact CG1-CG 4.29Å; V48-E94 HydrophobicContact CG2-CB 4.22Å; V48-E94 HydrophobicContact CG2-CG 4.01Å; R92-E94 WeakPolarHBondContact CB-OE2 3.49Å; R92-E94 IonicContact CZ-OE1 3.19Å; R92-E94 IonicContact CZ-OE2 3.92Å; R92-E94 IonicContact NE-OE1 3.5Å; R92-E94 IonicContact NE-OE2 3.43Å; R92-E94 PolarHBondContact NE-OE2 2.73Å; R92-E94 IonicContact NH1-OE1 3.78Å; R92-E94 IonicContact NH2-OE1 2.96Å; R92-E94 PolarHBondContact NH2-OE1 3.15Å; R92-E94 PolarHBondContact O-N 3.45Å; R92-E94 VanDerWaalsContact O-N 3.08Å
95	H	95	Very high	92.6	Very high	0 Å²	0	72.1 Å²	72.1	0%	0	33%	0.331	C	S	.	.	G	3₁₀ helix	trans	-111.3	11	-176.4	-56.2	-37.2	0	0	0	113.2	K43 D45 V48 K50 G51 V91 R92 I93	K43-H95 CarbonylContact C-O 3.59Å; K43-H95 PolarHBondContact N-O 3.03Å; K43-H95 CarbonylContact O-C 3.44Å; K43-H95 VanDerWaalsContact O-CA 3.28Å; K43-H95 WeakPolarHBondContact O-CA 3.4Å; D45-H95 PolarHBondContact N-ND1 2.8Å; D45-H95 PolarHBondContact O-CE1 3.01Å; V48-H95 PolarHBondContact O-CE1 2.9Å; V48-H95 PolarHBondContact O-NE2 3.43Å; V48-H95 VanDerWaalsContact O-NE2 3.14Å; K50-H95 PolarHBondContact O-NE2 3.31Å; G51-H95 PolarHBondContact O-CD2 2.83Å; V91-H95 HydrophobicContact CG1-CB 3.44Å; V91-H95 VanDerWaalsContact CG1-CB 3.44Å; R92-H95 PolarHBondContact O-N 2.82Å; I93-H95 PolarHBondContact O-N 3.05Å; I93-H95 VanDerWaalsContact O-N 3.16Å
96	V	95.1	Very high	92.4	Very high	4 Å²	4	73.4 Å²	73.4	2%	0.024	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	136.3	-179.7	-177.6	0	0	0	0	108.6	Y34 V40 V72 I74 V91 I93	Y34-V96 HydrophobicContact CE1-CG1 3.91Å; Y34-V96 HydrophobicContact CE2-CG1 4.41Å; Y34-V96 PolarHBondContact OH-O 3.13Å; Y34-V96 VanDerWaalsContact OH-O 3.05Å; V40-V96 HydrophobicContact CB-CG1 3.61Å; V40-V96 HydrophobicContact CG1-CG1 3.86Å; V40-V96 HydrophobicContact CG2-CG1 3.9Å; V72-V96 HydrophobicContact CB-CG2 4.35Å; I74-V96 HydrophobicContact CD1-CG1 4.25Å; I74-V96 HydrophobicContact CD1-CG2 3.82Å; V91-V96 HydrophobicContact CB-CG2 4.21Å; V91-V96 HydrophobicContact CG1-CG2 3.92Å; I93-V96 PolarHBondContact O-N 3.02Å
97	K	93.6	Very high	92.4	Very high	105 Å²	105	75.8 Å²	75.8	46%	0.457	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.5	141.1	173.8	-63.3	-168.2	177.7	-159.6	0	109.8	V40 D41 K43 S99	V40-K97 CarbonylContact C-O 3.58Å; V40-K97 VanDerWaalsContact CA-O 3.27Å; V40-K97 WeakPolarHBondContact CA-O 3.38Å; V40-K97 WeakPolarHBondContact CB-O 3.48Å; D41-K97 HydrophobicContact CB-CB 4.42Å; D41-K97 PolarHBondContact N-O 3.1Å; D41-K97 PolarHBondContact O-N 3.39Å; K43-K97 HydrophobicContact CB-CD 4.22Å; K43-K97 HydrophobicContact CB-CG 4.45Å; K43-K97 HydrophobicContact CD-CD 4.24Å; K97-S99 PolarHBondContact O-N 3.03Å
98	P	92.7	Very high	92.4	Very high	42 Å²	42	78.6 Å²	78.6	27%	0.273	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.3	134.2	167.3	32.8	-42.4	0	0	0	109.7	R32	R32-P98 VanDerWaalsContact NH2-CB 3.33Å
99	S	89.7	Confident	92.4	Very high	12 Å²	12	72.2 Å²	72.2	8%	0.084	33%	0.327	C	S	.	.			trans	-76.9	133.6	174.7	72.5	0	0	0	0	110.4	I39 D41 K97 F101	I39-S99 WeakPolarHBondContact CB-OG 3.4Å; I39-S99 WeakPolarHBondContact CG2-OG 3.21Å; I39-S99 WeakPolarHBondContact O-CB 3.36Å; I39-S99 PolarHBondContact O-N 3.21Å; I39-S99 PolarHBondContact O-OG 3.11Å; D41-S99 WeakPolarHBondContact OD2-CA 3.35Å; D41-S99 WeakPolarHBondContact OD2-CB 3.49Å; K97-S99 PolarHBondContact O-N 3.03Å; S99-F101 VanDerWaalsContact C-N 3.35Å
100	K	86.9	Confident	92.4	Very high	159 Å²	159	78.8 Å²	78.8	69%	0.691	36%	0.355	S	S	*	.	S	Bend	trans	-88	-4.8	174.4	-66.7	-173.7	176.2	-172.1	0	113.3	R102 E103 D104	K100-R102 VanDerWaalsContact C-N 3.3Å; K100-R102 PolarHBondContact O-N 2.99Å; K100-E103 PolarHBondContact O-N 3.16Å; K100-D104 PolarHBondContact O-N 3.08Å
101	F	86	Confident	92.5	Very high	146 Å²	146	78.1 Å²	78.1	64%	0.64	35%	0.348	S	S	*	.	H	α-helix	trans	-61.8	-38.2	-174.5	179.3	-103.1	0	0	0	112.5	S99 F105	S99-F101 VanDerWaalsContact C-N 3.35Å; F101-F105 WeakPolarHBondContact O-CB 3.05Å; F101-F105 PolarHBondContact O-N 2.87Å
102	R	84.2	Confident	92.6	Very high	138 Å²	138	82.1 Å²	82.1	52%	0.521	37%	0.369	S	S	.	.	H	α-helix	trans	-65.2	-42.6	178.9	-177.3	59.4	175.2	-179.9	1.3	111.9	K100 F105 L106	K100-R102 VanDerWaalsContact C-N 3.3Å; K100-R102 PolarHBondContact O-N 2.99Å; R102-F105 PolarHBondContact O-N 3.35Å; R102-L106 HydrophobicContact CG-CD1 4.39Å; R102-L106 WeakPolarHBondContact O-CG 3.28Å; R102-L106 PolarHBondContact O-N 3.2Å; R102-L106 VanDerWaalsContact O-N 3.07Å
103	E	88.5	Confident	92.6	Very high	127 Å²	127	83 Å²	83	59%	0.593	38%	0.379	S	S	*	.	H	α-helix	trans	-65.9	-45.3	178.3	-65.6	172.3	-178.1	0	0	111.3	K100 F105 L106 R107	K100-E103 PolarHBondContact O-N 3.16Å; E103-F105 VanDerWaalsContact C-N 3.32Å; E103-F105 PolarHBondContact O-N 2.97Å; E103-L106 PolarHBondContact O-N 3.43Å; E103-R107 PolarHBondContact O-N 3.29Å
104	D	90.8	Very high	92.6	Very high	37 Å²	37	85 Å²	85	20%	0.198	39%	0.393	C	S	.	.	H	α-helix	trans	-60.3	-42.1	175.9	-179.2	65.4	0	0	0	111.9	K100 R107 R108	K100-D104 PolarHBondContact O-N 3.08Å; D104-R107 PolarHBondContact O-N 2.78Å; D104-R107 IonicContact OD1-CZ 3.87Å; D104-R107 IonicContact OD1-NE 2.64Å; D104-R107 IonicContact OD1-NH2 3.65Å; D104-R107 PolarHBondContact OD1-NH2 3.29Å; D104-R108 WeakPolarHBondContact O-CG 3.32Å; D104-R108 PolarHBondContact O-N 3.03Å; D104-R108 IonicContact OD1-NE 3.35Å; D104-R108 IonicContact OD1-NH2 3.15Å; D104-R108 IonicContact OD2-CZ 3.99Å; D104-R108 IonicContact OD2-NE 3.94Å; D104-R108 PolarHBondContact OD2-NE 3.09Å; D104-R108 IonicContact OD2-NH1 3.37Å; D104-R108 PolarHBondContact OD2-NH1 3.2Å; D104-R108 IonicContact OD2-NH2 3.02Å; D104-R108 PolarHBondContact OD2-NH2 3.21Å; D104-R108 VanDerWaalsContact OD2-NH2 3.15Å
105	F	91.6	Very high	92.7	Very high	96 Å²	96	90.8 Å²	90.8	42%	0.421	42%	0.417	S	S	.	.	H	α-helix	trans	-60.6	-48.4	175.8	177.9	-98	0	0	0	112.1	F101 R102 E103 R107 R108 V109	F101-F105 WeakPolarHBondContact O-CB 3.05Å; F101-F105 PolarHBondContact O-N 2.87Å; R102-F105 PolarHBondContact O-N 3.35Å; E103-F105 VanDerWaalsContact C-N 3.32Å; E103-F105 PolarHBondContact O-N 2.97Å; F105-R107 VanDerWaalsContact C-N 3.31Å; F105-R107 PolarHBondContact O-N 3.06Å; F105-R108 PolarHBondContact O-N 3.37Å; F105-V109 HydrophobicContact CD1-CG2 4.27Å; F105-V109 HydrophobicContact CE1-CG2 3.8Å; F105-V109 HydrophobicContact CE2-CG2 4.25Å; F105-V109 HydrophobicContact CZ-CG2 3.8Å; F105-V109 WeakPolarHBondContact O-CG2 3.34Å; F105-V109 PolarHBondContact O-N 2.96Å
106	L	92.1	Very high	92.7	Very high	88 Å²	88	99.4 Å²	99.4	46%	0.461	45%	0.45	S	S	.	.	H	α-helix	trans	-63.1	-38.6	179.7	-69.7	173.3	0	0	0	112.1	R102 E103 V109 K110	R102-L106 HydrophobicContact CG-CD1 4.39Å; R102-L106 WeakPolarHBondContact O-CG 3.28Å; R102-L106 PolarHBondContact O-N 3.2Å; R102-L106 VanDerWaalsContact O-N 3.07Å; E103-L106 PolarHBondContact O-N 3.43Å; L106-V109 PolarHBondContact O-N 3.32Å; L106-K110 PolarHBondContact O-N 2.91Å; L106-K110 VanDerWaalsContact O-N 3.11Å
107	R	94.7	Very high	92.7	Very high	134 Å²	134	107.7 Å²	107.7	51%	0.506	48%	0.481	S	S	.	.	H	α-helix	trans	-60.3	-47.7	174.2	177.2	176.2	58.4	-133.6	-0.9	111.4	E103 D104 F105 V109 K110 E111	E103-R107 PolarHBondContact O-N 3.29Å; D104-R107 PolarHBondContact O-N 2.78Å; D104-R107 IonicContact OD1-CZ 3.87Å; D104-R107 IonicContact OD1-NE 2.64Å; D104-R107 IonicContact OD1-NH2 3.65Å; D104-R107 PolarHBondContact OD1-NH2 3.29Å; F105-R107 VanDerWaalsContact C-N 3.31Å; F105-R107 PolarHBondContact O-N 3.06Å; R107-V109 VanDerWaalsContact C-N 3.34Å; R107-V109 PolarHBondContact O-N 2.87Å; R107-K110 PolarHBondContact O-N 2.78Å; R107-E111 HydrophobicContact CG-CG 4.49Å; R107-E111 WeakPolarHBondContact CG-OE1 3.35Å; R107-E111 WeakPolarHBondContact O-CG 3.26Å; R107-E111 PolarHBondContact O-N 3.34Å
108	R	94.8	Very high	92.7	Very high	135 Å²	135	106.8 Å²	106.8	51%	0.509	48%	0.481	S	S	.	.	H	α-helix	trans	-61.7	-39.9	178.5	-73.3	178.3	180	165	5.6	113	D104 F105 E111 N112	D104-R108 WeakPolarHBondContact O-CG 3.32Å; D104-R108 PolarHBondContact O-N 3.03Å; D104-R108 IonicContact OD1-NE 3.35Å; D104-R108 IonicContact OD1-NH2 3.15Å; D104-R108 IonicContact OD2-CZ 3.99Å; D104-R108 IonicContact OD2-NE 3.94Å; D104-R108 PolarHBondContact OD2-NE 3.09Å; D104-R108 IonicContact OD2-NH1 3.37Å; D104-R108 PolarHBondContact OD2-NH1 3.2Å; D104-R108 IonicContact OD2-NH2 3.02Å; D104-R108 PolarHBondContact OD2-NH2 3.21Å; D104-R108 VanDerWaalsContact OD2-NH2 3.15Å; F105-R108 PolarHBondContact O-N 3.37Å; R108-E111 PolarHBondContact O-N 3.14Å; R108-N112 WeakPolarHBondContact O-CB 3.44Å; R108-N112 PolarHBondContact O-N 3.27Å; R108-N112 PolarHBondContact O-ND2 3.07Å
109	V	95.9	Very high	92.8	Very high	53 Å²	53	107.4 Å²	107.4	32%	0.321	49%	0.49	S	S	.	.	H	α-helix	trans	-60.6	-48.7	175.9	172.4	0	0	0	0	110.2	F105 L106 R107 E111 N112 D113	F105-V109 HydrophobicContact CD1-CG2 4.27Å; F105-V109 HydrophobicContact CE1-CG2 3.8Å; F105-V109 HydrophobicContact CE2-CG2 4.25Å; F105-V109 HydrophobicContact CZ-CG2 3.8Å; F105-V109 WeakPolarHBondContact O-CG2 3.34Å; F105-V109 PolarHBondContact O-N 2.96Å; L106-V109 PolarHBondContact O-N 3.32Å; R107-V109 VanDerWaalsContact C-N 3.34Å; R107-V109 PolarHBondContact O-N 2.87Å; V109-E111 PolarHBondContact O-N 3.02Å; V109-N112 PolarHBondContact O-N 3.42Å; V109-D113 PolarHBondContact O-N 2.85Å
110	K	95.9	Very high	93	Very high	159 Å²	159	114.6 Å²	114.6	69%	0.691	52%	0.52	S	S	*	.	H	α-helix	trans	-59.3	-45.3	178	-174.6	178.4	179.2	-178.9	0	112.5	L106 R107 N112 D113 V114	L106-K110 PolarHBondContact O-N 2.91Å; L106-K110 VanDerWaalsContact O-N 3.11Å; R107-K110 PolarHBondContact O-N 2.78Å; K110-N112 VanDerWaalsContact C-N 3.33Å; K110-N112 PolarHBondContact O-N 2.97Å; K110-D113 PolarHBondContact O-N 3.32Å; K110-V114 WeakPolarHBondContact O-CG2 3.42Å; K110-V114 PolarHBondContact O-N 2.98Å
111	E	96	Very high	93.3	Very high	92 Å²	92	112.1 Å²	112.1	43%	0.43	51%	0.51	S	S	.	.	H	α-helix	trans	-62.6	-39.5	177.2	-72.4	170.1	-169.3	0	0	112.2	R107 R108 V109 K115	R107-E111 HydrophobicContact CG-CG 4.49Å; R107-E111 WeakPolarHBondContact CG-OE1 3.35Å; R107-E111 WeakPolarHBondContact O-CG 3.26Å; R107-E111 PolarHBondContact O-N 3.34Å; R108-E111 PolarHBondContact O-N 3.14Å; V109-E111 PolarHBondContact O-N 3.02Å; E111-K115 WeakPolarHBondContact O-CG 3.39Å; E111-K115 PolarHBondContact O-N 3.24Å
112	N	96.1	Very high	93.6	Very high	85 Å²	85	111.3 Å²	111.3	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-70.5	-38.3	178.2	-72.9	-18.3	0	0	0	112.2	R108 V109 K110 V114 K115 R116	R108-N112 WeakPolarHBondContact O-CB 3.44Å; R108-N112 PolarHBondContact O-N 3.27Å; R108-N112 PolarHBondContact O-ND2 3.07Å; V109-N112 PolarHBondContact O-N 3.42Å; K110-N112 VanDerWaalsContact C-N 3.33Å; K110-N112 PolarHBondContact O-N 2.97Å; N112-V114 VanDerWaalsContact C-N 3.33Å; N112-V114 PolarHBondContact O-N 3.35Å; N112-K115 PolarHBondContact O-N 2.86Å; N112-R116 WeakPolarHBondContact O-CB 3.31Å; N112-R116 VanDerWaalsContact O-CG 3.27Å; N112-R116 WeakPolarHBondContact O-CG 3.4Å; N112-R116 PolarHBondContact O-N 3.11Å
113	D	95.9	Very high	93.7	Very high	85 Å²	85	109.4 Å²	109.4	46%	0.455	52%	0.517	S	S	.	.	H	α-helix	trans	-65.6	-37.4	177.9	-73.6	-21.6	0	0	0	111.9	V109 K110 R116 R117	V109-D113 PolarHBondContact O-N 2.85Å; K110-D113 PolarHBondContact O-N 3.32Å; D113-R116 PolarHBondContact O-N 3.19Å; D113-R117 PolarHBondContact O-N 3.06Å
114	V	96	Very high	93.3	Very high	75 Å²	75	107.8 Å²	107.8	46%	0.455	52%	0.52	S	S	.	.	H	α-helix	trans	-60.1	-53.1	171.5	173.8	0	0	0	0	110.2	K110 N112 R116 R117 D118	K110-V114 WeakPolarHBondContact O-CG2 3.42Å; K110-V114 PolarHBondContact O-N 2.98Å; N112-V114 VanDerWaalsContact C-N 3.33Å; N112-V114 PolarHBondContact O-N 3.35Å; V114-R116 VanDerWaalsContact C-N 3.27Å; V114-R116 PolarHBondContact O-N 3.39Å; V114-R117 WeakPolarHBondContact O-CB 3.46Å; V114-R117 PolarHBondContact O-N 3.45Å; V114-D118 PolarHBondContact O-N 2.64Å
115	K	95.3	Very high	92.6	Very high	134 Å²	134	110.4 Å²	110.4	58%	0.583	54%	0.541	S	S	*	.	H	α-helix	trans	-57.9	-37.2	178.2	-70	173.5	-178.3	177.2	0	113.4	E111 N112 A119	E111-K115 WeakPolarHBondContact O-CG 3.39Å; E111-K115 PolarHBondContact O-N 3.24Å; N112-K115 PolarHBondContact O-N 2.86Å; K115-A119 VanDerWaalsContact O-CB 3.3Å; K115-A119 WeakPolarHBondContact O-CB 3.37Å; K115-A119 PolarHBondContact O-N 2.77Å
116	R	94.7	Very high	91	Very high	182 Å²	182	112.9 Å²	112.9	69%	0.687	57%	0.57	S	S	*	*	H	α-helix	trans	-69.5	-36.1	177.3	-74.4	178.9	73.6	-173.2	4.9	112.2	N112 D113 V114 K120	N112-R116 WeakPolarHBondContact O-CB 3.31Å; N112-R116 VanDerWaalsContact O-CG 3.27Å; N112-R116 WeakPolarHBondContact O-CG 3.4Å; N112-R116 PolarHBondContact O-N 3.11Å; D113-R116 PolarHBondContact O-N 3.19Å; V114-R116 VanDerWaalsContact C-N 3.27Å; V114-R116 PolarHBondContact O-N 3.39Å; R116-K120 WeakPolarHBondContact O-CB 3.29Å; R116-K120 PolarHBondContact O-N 2.9Å; R116-K120 VanDerWaalsContact O-N 3.1Å
117	R	94.9	Very high	90.9	Very high	177 Å²	177	114.1 Å²	114.1	67%	0.668	58%	0.576	S	S	*	*	H	α-helix	trans	-65.5	-50.7	174.3	-169.8	-173.3	-143.3	134.3	4.7	110.4	D113 V114 A119 K120 E121	D113-R117 PolarHBondContact O-N 3.06Å; V114-R117 WeakPolarHBondContact O-CB 3.46Å; V114-R117 PolarHBondContact O-N 3.45Å; R117-A119 VanDerWaalsContact C-N 3.31Å; R117-A119 PolarHBondContact O-N 3.39Å; R117-K120 WeakPolarHBondContact O-CB 3.32Å; R117-K120 PolarHBondContact O-N 3.26Å; R117-E121 IonicContact NE-OE1 3.85Å; R117-E121 PolarHBondContact O-N 2.9Å
118	D	94.7	Very high	90.7	Very high	86 Å²	86	113.1 Å²	113.1	46%	0.46	58%	0.579	S	S	.	*	H	α-helix	trans	-59.3	-42.7	-180	-57.2	-16.9	0	0	0	111.2	V114 K120 E121 M122	V114-D118 PolarHBondContact O-N 2.64Å; D118-K120 PolarHBondContact O-N 3.45Å; D118-E121 PolarHBondContact O-N 3Å; D118-M122 WeakPolarHBondContact O-CB 3.07Å; D118-M122 PolarHBondContact O-N 3.18Å
119	A	94.2	Very high	90.5	Very high	56 Å²	56	111.8 Å²	111.8	46%	0.463	58%	0.583	S	S	.	*	H	α-helix	trans	-65.1	-36.8	176	0	0	0	0	0	112.9	K115 R117 C123	K115-A119 VanDerWaalsContact O-CB 3.3Å; K115-A119 WeakPolarHBondContact O-CB 3.37Å; K115-A119 PolarHBondContact O-N 2.77Å; R117-A119 VanDerWaalsContact C-N 3.31Å; R117-A119 PolarHBondContact O-N 3.39Å; A119-C123 WeakPolarHBondContact O-CB 3.21Å; A119-C123 PolarHBondContact O-N 3.3Å; A119-C123 PolarHBondContact O-SG 3.16Å
120	K	94.2	Very high	90.2	Very high	162 Å²	162	115.3 Å²	115.3	70%	0.704	60%	0.598	S	S	*	*	H	α-helix	trans	-69.4	-41.5	177.7	-173.9	175.5	179.8	-178.7	0	111.4	R116 R117 D118 C123 S124	R116-K120 WeakPolarHBondContact O-CB 3.29Å; R116-K120 PolarHBondContact O-N 2.9Å; R116-K120 VanDerWaalsContact O-N 3.1Å; R117-K120 WeakPolarHBondContact O-CB 3.32Å; R117-K120 PolarHBondContact O-N 3.26Å; D118-K120 PolarHBondContact O-N 3.45Å; K120-C123 PolarHBondContact O-N 3.32Å; K120-S124 PolarHBondContact O-N 3.33Å; K120-S124 PolarHBondContact O-OG 2.84Å; K120-S124 VanDerWaalsContact O-OG 3.11Å
121	E	93.1	Very high	89.8	Confident	107 Å²	107	112.6 Å²	112.6	50%	0.5	59%	0.593	S	S	.	*	H	α-helix	trans	-61.5	-46.8	176	-72.3	176	-170.2	0	0	110.7	R117 D118 C123 S124 S125	R117-E121 IonicContact NE-OE1 3.85Å; R117-E121 PolarHBondContact O-N 2.9Å; D118-E121 PolarHBondContact O-N 3Å; E121-C123 PolarHBondContact O-N 3.34Å; E121-S124 WeakPolarHBondContact CA-OG 3.17Å; E121-S124 PolarHBondContact O-N 3.19Å; E121-S124 VanDerWaalsContact O-N 3.15Å; E121-S124 PolarHBondContact O-OG 3.4Å; E121-S125 PolarHBondContact O-N 2.76Å; E121-S125 PolarHBondContact O-OG 3.31Å; E121-S125 VanDerWaalsContact O-OG 3.11Å
122	M	91.8	Very high	89.4	Confident	130 Å²	130	113.9 Å²	113.9	64%	0.64	60%	0.603	S	S	*	*	H	α-helix	trans	-58.3	-42	175.4	-175	63.9	68	0	0	113.2	D118 S125 S126	D118-M122 WeakPolarHBondContact O-CB 3.07Å; D118-M122 PolarHBondContact O-N 3.18Å; M122-S125 PolarHBondContact O-OG 2.91Å; M122-S126 PolarHBondContact O-OG 3.42Å
123	C	86.2	Confident	88.9	Confident	97 Å²	97	116 Å²	116	66%	0.655	61%	0.614	S	S	*	*	H	α-helix	trans	-72.9	-26.2	177.5	-77.7	0	0	0	0	113.6	A119 K120 E121	A119-C123 WeakPolarHBondContact O-CB 3.21Å; A119-C123 PolarHBondContact O-N 3.3Å; A119-C123 PolarHBondContact O-SG 3.16Å; K120-C123 PolarHBondContact O-N 3.32Å; E121-C123 PolarHBondContact O-N 3.34Å
124	S	80.5	Confident	88.4	Confident	93 Å²	93	118.4 Å²	118.4	65%	0.65	63%	0.626	S	S	*	*	H	α-helix	trans	-84.5	-20.3	177.4	56.8	0	0	0	0	113.9	K120 E121	K120-S124 PolarHBondContact O-N 3.33Å; K120-S124 PolarHBondContact O-OG 2.84Å; K120-S124 VanDerWaalsContact O-OG 3.11Å; E121-S124 WeakPolarHBondContact CA-OG 3.17Å; E121-S124 PolarHBondContact O-N 3.19Å; E121-S124 VanDerWaalsContact O-N 3.15Å; E121-S124 PolarHBondContact O-OG 3.4Å
125	S	75.8	Confident	87.7	Confident	92 Å²	92	122 Å²	122	64%	0.643	64%	0.641	S	S	*	*			trans	-86.2	-6.7	174.5	54.1	0	0	0	0	113.9	E121 M122	E121-S125 PolarHBondContact O-N 2.76Å; E121-S125 PolarHBondContact O-OG 3.31Å; E121-S125 VanDerWaalsContact O-OG 3.11Å; M122-S125 PolarHBondContact O-OG 2.91Å
126	S	57.6	Low	87.1	Confident	148 Å²	148	120.9 Å²	120.9	100%	1.035	65%	0.646	S	S	*	*			trans	-100.7	0	173.3	-55.1	0	0	0	0	110.1	M122	M122-S126 PolarHBondContact O-OG 3.42Å

Retrieved 126 of 126 residues in 60.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).