A0A5K4F4E1_SCHMA Loading...

DNA-directed RNA polymerase I subunit H

Core component of RNA polymerase I (Pol I), a DNA-dependent RNA polymerase which synthesizes ribosomal RNA precursors using the four ribonucleoside triphosphates as substrates. Can mediate Pol I proofreading of the nascent RNA transcript. Anchors into the Pol I active site to monitor transcription fidelity and cleave mis-incorporated 5'-ribonucleotides.

AlphaFold DB , UniProt , Accession A0A5K4F4E1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 80 aa.

						>A0A5K4F4E1_SCHMA|A0A5K4F4E1
MIRGAKKILRSEIALKEALESQFENSTSQSTFDGPSIRKECAYCGNDRMTYVTVQTRSADEGQTVIYTCTQFSEKEIENT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.5	Very low	58.2	Low	233 Å²	233	162.4 Å²	162.4	100%	1.148	82%	0.818	S	S	*	*				0	114.1	0	-71.6	174.3	179.2	0	0	108	R3	M1-R3 PolarHBondContact O-N 3.09Å; M1-R3 VanDerWaalsContact O-N 3.09Å
2	I	55.7	Low	59.5	Low	182 Å²	182	157.8 Å²	157.8	93%	0.933	79%	0.792	S	S	*	*			trans	-77.9	98.6	-160.7	-46.7	165.5	0	0	0	108.8
3	R	54.2	Low	61	Low	242 Å²	242	152.6 Å²	152.6	91%	0.913	77%	0.766	S	S	*	*			trans	-89.8	120.4	175.6	-66.9	179.9	177.3	-169.1	-0.7	108.4	M1	M1-R3 PolarHBondContact O-N 3.09Å; M1-R3 VanDerWaalsContact O-N 3.09Å
4	G	49.9	Very low	62.5	Low	81 Å²	81	145.5 Å²	145.5	84%	0.835	74%	0.743	S	S	*	*			trans	116.6	75.8	162.3	0	0	0	0	0	113.9
5	A	56.8	Low	63.8	Low	92 Å²	92	144.1 Å²	144.1	76%	0.76	74%	0.737	S	S	*	*			trans	-132	145.5	158.6	0	0	0	0	0	107.2
6	K	59.5	Low	65.1	Low	202 Å²	202	144.3 Å²	144.3	88%	0.878	73%	0.731	S	S	*	*			trans	90.1	70.8	179.4	-52.1	179.8	174.7	-168.1	0	115.8
7	K	57.1	Low	66.2	Low	211 Å²	211	142.8 Å²	142.8	92%	0.917	72%	0.721	S	S	*	*			trans	-125.1	19.5	153	-73.9	-166.2	-180	-178.5	0	113.6
8	I	60.2	Low	67.2	Low	127 Å²	127	137.4 Å²	137.4	65%	0.651	70%	0.701	S	S	*	*			trans	-122	82.6	176.8	-49.9	170.5	0	0	0	106.9
9	L	63.9	Low	67.9	Low	123 Å²	123	135.7 Å²	135.7	64%	0.644	69%	0.694	S	S	*	*	S	Bend	trans	-135.6	-15.4	170.5	-157.8	68	0	0	0	113	I13	L9-I13 WeakPolarHBondContact O-CD1 3.41Å
10	R	66.9	Low	68.5	Low	228 Å²	228	135 Å²	135	86%	0.86	69%	0.687	S	S	*	*	H	α-helix	trans	-81.3	-35.3	-176.1	-41.3	-172.6	-166.8	-169.2	2.6	112.3	A14	R10-A14 PolarHBondContact O-N 2.88Å
11	S	69.6	Low	68.9	Low	65 Å²	65	131.6 Å²	131.6	46%	0.455	68%	0.676	S	S	.	*	H	α-helix	trans	-72.1	-34.8	-174.8	50.4	0	0	0	0	113.2	L15	S11-L15 PolarHBondContact O-N 3.23Å; S11-L15 VanDerWaalsContact O-N 3.12Å
12	E	74.1	Confident	70	Confident	108 Å²	108	126.7 Å²	126.7	51%	0.505	65%	0.65	S	S	.	*	H	α-helix	trans	-69.9	-36.4	-179	-64.7	174.1	113.2	0	0	112	K16	E12-K16 WeakPolarHBondContact O-CG 3.36Å; E12-K16 PolarHBondContact O-N 2.83Å
13	I	78.5	Confident	70.6	Confident	90 Å²	90	124.6 Å²	124.6	46%	0.462	63%	0.634	S	S	.	*	H	α-helix	trans	-67.5	-49.4	178	-60.6	170.3	0	0	0	109.7	L9 L15 K16 E17	L9-I13 WeakPolarHBondContact O-CD1 3.41Å; I13-L15 VanDerWaalsContact C-N 3.27Å; I13-L15 PolarHBondContact O-N 3.39Å; I13-K16 WeakPolarHBondContact O-CB 3.21Å; I13-K16 PolarHBondContact O-N 3.1Å; I13-E17 HydrophobicContact CG2-CG 4.42Å; I13-E17 WeakPolarHBondContact O-CG 3.46Å; I13-E17 PolarHBondContact O-N 3.28Å
14	A	82.3	Confident	70.9	Confident	53 Å²	53	120.3 Å²	120.3	44%	0.438	62%	0.624	S	S	.	*	H	α-helix	trans	-60.7	-35.1	179.1	0	0	0	0	0	112.9	R10 A18	R10-A14 PolarHBondContact O-N 2.88Å; A14-A18 WeakPolarHBondContact O-CB 3.31Å; A14-A18 PolarHBondContact O-N 3.44Å; A14-A18 VanDerWaalsContact O-N 3.12Å
15	L	81.4	Confident	71.4	Confident	125 Å²	125	121.3 Å²	121.3	65%	0.654	61%	0.611	S	S	*	*	H	α-helix	trans	-66.3	-37.5	174.2	-92.6	162.6	0	0	0	112.6	S11 I13 L19	S11-L15 PolarHBondContact O-N 3.23Å; S11-L15 VanDerWaalsContact O-N 3.12Å; I13-L15 VanDerWaalsContact C-N 3.27Å; I13-L15 PolarHBondContact O-N 3.39Å; L15-L19 WeakPolarHBondContact O-CB 3.3Å; L15-L19 PolarHBondContact O-N 2.66Å; L15-L19 VanDerWaalsContact O-N 3.13Å
16	K	85	Confident	71.3	Confident	146 Å²	146	120 Å²	120	64%	0.635	60%	0.596	S	S	*	*	H	α-helix	trans	-69	-47.3	177.2	-74.7	-175.9	174.3	-159.2	0	111.9	E12 I13 A18 L19 E20	E12-K16 WeakPolarHBondContact O-CG 3.36Å; E12-K16 PolarHBondContact O-N 2.83Å; I13-K16 WeakPolarHBondContact O-CB 3.21Å; I13-K16 PolarHBondContact O-N 3.1Å; K16-A18 VanDerWaalsContact C-N 3.29Å; K16-A18 PolarHBondContact O-N 2.86Å; K16-L19 WeakPolarHBondContact O-CB 3.41Å; K16-L19 PolarHBondContact O-N 2.77Å; K16-E20 WeakPolarHBondContact O-CG 3.44Å; K16-E20 PolarHBondContact O-N 3.17Å
17	E	84.1	Confident	71.2	Confident	120 Å²	120	116.2 Å²	116.2	56%	0.561	59%	0.59	S	S	*	*	H	α-helix	trans	-59.9	-41.4	178.5	-66.6	173.3	136.2	0	0	111.3	I13 L19 E20 S21	I13-E17 HydrophobicContact CG2-CG 4.42Å; I13-E17 WeakPolarHBondContact O-CG 3.46Å; I13-E17 PolarHBondContact O-N 3.28Å; E17-L19 PolarHBondContact O-N 2.79Å; E17-E20 PolarHBondContact O-N 3.46Å; E17-S21 PolarHBondContact O-N 3.08Å; E17-S21 PolarHBondContact O-OG 3.28Å
18	A	83.3	Confident	71	Confident	45 Å²	45	110.5 Å²	110.5	37%	0.372	58%	0.576	S	S	.	*	H	α-helix	trans	-63.6	-39.6	175	0	0	0	0	0	112.3	A14 K16 S21 Q22	A14-A18 WeakPolarHBondContact O-CB 3.31Å; A14-A18 PolarHBondContact O-N 3.44Å; A14-A18 VanDerWaalsContact O-N 3.12Å; K16-A18 VanDerWaalsContact C-N 3.29Å; K16-A18 PolarHBondContact O-N 2.86Å; A18-S21 PolarHBondContact O-OG 3.43Å; A18-Q22 WeakPolarHBondContact O-CG 3.48Å; A18-Q22 PolarHBondContact O-N 2.85Å
19	L	81	Confident	70.7	Confident	106 Å²	106	110.7 Å²	110.7	56%	0.555	58%	0.575	S	S	*	*	H	α-helix	trans	-65.6	-46.7	176.6	-166.7	106	0	0	0	111.3	L15 K16 E17 S21 Q22 F23	L15-L19 WeakPolarHBondContact O-CB 3.3Å; L15-L19 PolarHBondContact O-N 2.66Å; L15-L19 VanDerWaalsContact O-N 3.13Å; K16-L19 WeakPolarHBondContact O-CB 3.41Å; K16-L19 PolarHBondContact O-N 2.77Å; E17-L19 PolarHBondContact O-N 2.79Å; L19-S21 PolarHBondContact O-N 2.76Å; L19-Q22 PolarHBondContact O-N 3.16Å; L19-F23 HydrophobicContact CD2-CE2 4.12Å; L19-F23 HydrophobicContact CG-CD2 4.44Å; L19-F23 HydrophobicContact CG-CE2 4.2Å; L19-F23 WeakPolarHBondContact O-CD2 3.28Å; L19-F23 PolarHBondContact O-N 3.23Å
20	E	79.8	Confident	70.2	Confident	121 Å²	121	109.6 Å²	109.6	57%	0.565	58%	0.577	S	S	*	*	H	α-helix	trans	-59.5	-45.2	179.1	-71.4	173.3	112.8	0	0	111.5	K16 E17 Q22 F23 E24	K16-E20 WeakPolarHBondContact O-CG 3.44Å; K16-E20 PolarHBondContact O-N 3.17Å; E17-E20 PolarHBondContact O-N 3.46Å; E20-Q22 PolarHBondContact O-N 2.88Å; E20-F23 PolarHBondContact O-N 3.33Å; E20-F23 VanDerWaalsContact O-N 3.11Å; E20-E24 PolarHBondContact O-N 3.47Å
21	S	76	Confident	69.8	Low	64 Å²	64	104.3 Å²	104.3	45%	0.448	57%	0.571	S	S	.	*	H	α-helix	trans	-60.6	-30.6	178.5	72	0	0	0	0	113.7	E17 A18 L19 N25	E17-S21 PolarHBondContact O-N 3.08Å; E17-S21 PolarHBondContact O-OG 3.28Å; A18-S21 PolarHBondContact O-OG 3.43Å; L19-S21 PolarHBondContact O-N 2.76Å; S21-N25 PolarHBondContact O-N 3.05Å
22	Q	70.5	Confident	69.3	Low	130 Å²	130	109.7 Å²	109.7	61%	0.607	59%	0.586	S	S	*	*	H	α-helix	trans	-72.9	-35.4	177.5	-71.2	-176.9	27.2	0	0	112.4	A18 L19 E20 S26	A18-Q22 WeakPolarHBondContact O-CG 3.48Å; A18-Q22 PolarHBondContact O-N 2.85Å; L19-Q22 PolarHBondContact O-N 3.16Å; E20-Q22 PolarHBondContact O-N 2.88Å; Q22-S26 WeakPolarHBondContact O-CB 3.43Å; Q22-S26 PolarHBondContact O-N 3.25Å; Q22-S26 PolarHBondContact O-OG 3.46Å
23	F	67.4	Low	69.1	Low	138 Å²	138	107.7 Å²	107.7	61%	0.605	58%	0.579	S	S	*	*	H	α-helix	trans	-67.4	-40.9	177.5	-87.8	-85.2	0	0	0	111.8	L19 E20 S26 T27	L19-F23 HydrophobicContact CD2-CE2 4.12Å; L19-F23 HydrophobicContact CG-CD2 4.44Å; L19-F23 HydrophobicContact CG-CE2 4.2Å; L19-F23 WeakPolarHBondContact O-CD2 3.28Å; L19-F23 PolarHBondContact O-N 3.23Å; E20-F23 PolarHBondContact O-N 3.33Å; E20-F23 VanDerWaalsContact O-N 3.11Å; F23-S26 PolarHBondContact O-N 3.26Å; F23-T27 PolarHBondContact O-N 2.91Å; F23-T27 VanDerWaalsContact O-N 3.11Å; F23-T27 PolarHBondContact O-OG1 3.28Å
24	E	62.5	Low	69.4	Low	151 Å²	151	104.2 Å²	104.2	71%	0.706	57%	0.565	S	S	*	*	H	α-helix	trans	-64.9	-41.9	177.2	-65.2	-173.2	120.2	0	0	111.8	E20 T27 S28	E20-E24 PolarHBondContact O-N 3.47Å; E24-T27 PolarHBondContact O-N 3.5Å; E24-S28 PolarHBondContact O-OG 2.83Å
25	N	59	Low	69.8	Low	103 Å²	103	104.7 Å²	104.7	55%	0.551	56%	0.564	S	S	*	*	H	α-helix	trans	-69.6	-33.5	177.2	-165.9	73.8	0	0	0	112.3	S21 S28 Q29	S21-N25 PolarHBondContact O-N 3.05Å; N25-S28 PolarHBondContact O-N 3.11Å; N25-S28 PolarHBondContact O-OG 3.47Å; N25-S28 VanDerWaalsContact O-OG 3.05Å; N25-Q29 WeakPolarHBondContact O-CB 3.29Å; N25-Q29 PolarHBondContact O-N 3.04Å; N25-Q29 VanDerWaalsContact O-N 3.16Å
26	S	55.9	Low	70.2	Confident	64 Å²	64	102.5 Å²	102.5	45%	0.448	56%	0.559	S	S	.	*	H	α-helix	trans	-70.2	-33.2	178.4	-58.6	0	0	0	0	112.4	Q22 F23 S28 Q29	Q22-S26 WeakPolarHBondContact O-CB 3.43Å; Q22-S26 PolarHBondContact O-N 3.25Å; Q22-S26 PolarHBondContact O-OG 3.46Å; F23-S26 PolarHBondContact O-N 3.26Å; S26-S28 VanDerWaalsContact C-N 3.32Å; S26-S28 PolarHBondContact O-N 3.21Å; S26-Q29 WeakPolarHBondContact O-CB 3.24Å; S26-Q29 PolarHBondContact O-N 3.44Å
27	T	55.7	Low	70.6	Confident	123 Å²	123	99.2 Å²	99.2	76%	0.755	55%	0.548	S	S	*	.	H	α-helix	trans	-68.6	-33.7	179.3	-52.9	0	0	0	0	111.8	F23 E24 Q29	F23-T27 PolarHBondContact O-N 2.91Å; F23-T27 VanDerWaalsContact O-N 3.11Å; F23-T27 PolarHBondContact O-OG1 3.28Å; E24-T27 PolarHBondContact O-N 3.5Å; T27-Q29 VanDerWaalsContact C-N 3.35Å
28	S	53.4	Low	71	Confident	90 Å²	90	102.5 Å²	102.5	63%	0.629	56%	0.555	S	S	*	*	H	α-helix	trans	-83.7	-12.8	175.8	48.1	0	0	0	0	113.2	E24 N25 S26 S30	E24-S28 PolarHBondContact O-OG 2.83Å; N25-S28 PolarHBondContact O-N 3.11Å; N25-S28 PolarHBondContact O-OG 3.47Å; N25-S28 VanDerWaalsContact O-OG 3.05Å; S26-S28 VanDerWaalsContact C-N 3.32Å; S26-S28 PolarHBondContact O-N 3.21Å; S28-S30 PolarHBondContact O-N 3.49Å
29	Q	54.4	Low	71.4	Confident	132 Å²	132	103.2 Å²	103.2	62%	0.617	55%	0.549	S	S	*	.	S	Bend	trans	-78.4	72.5	175.3	-158.6	173.4	28	0	0	109.1	N25 S26 T27 T31	N25-Q29 WeakPolarHBondContact O-CB 3.29Å; N25-Q29 PolarHBondContact O-N 3.04Å; N25-Q29 VanDerWaalsContact O-N 3.16Å; S26-Q29 WeakPolarHBondContact O-CB 3.24Å; S26-Q29 PolarHBondContact O-N 3.44Å; T27-Q29 VanDerWaalsContact C-N 3.35Å; Q29-T31 VanDerWaalsContact C-N 3.3Å; Q29-T31 PolarHBondContact O-N 2.98Å
30	S	54	Low	71.9	Confident	99 Å²	99	104.3 Å²	104.3	69%	0.692	55%	0.552	S	S	*	*			trans	0.4	81.7	159.2	166.1	0	0	0	0	111.2	S28 F32	S28-S30 PolarHBondContact O-N 3.49Å; S30-F32 VanDerWaalsContact C-N 3.3Å; S30-F32 PolarHBondContact O-N 2.94Å
31	T	58.1	Low	72.3	Confident	118 Å²	118	98.6 Å²	98.6	72%	0.724	53%	0.525	S	S	*	.			trans	-59.2	107.7	173.3	-50	0	0	0	0	103.3	Q29 D33	Q29-T31 VanDerWaalsContact C-N 3.3Å; Q29-T31 PolarHBondContact O-N 2.98Å; T31-D33 PolarHBondContact O-N 3.38Å
32	F	58.9	Low	72.9	Confident	177 Å²	177	99.3 Å²	99.3	78%	0.776	54%	0.535	S	S	*	.			trans	-69.5	85.5	-173	178.2	-97	0	0	0	106.4	S30 G34	S30-F32 VanDerWaalsContact C-N 3.3Å; S30-F32 PolarHBondContact O-N 2.94Å; F32-G34 PolarHBondContact O-N 2.56Å
33	D	70	Confident	73.7	Confident	67 Å²	67	100.6 Å²	100.6	36%	0.358	54%	0.535	S	S	.	.			trans	-81.7	25.6	-170.1	-166.4	52.9	0	0	0	111.4	T31 T50	T31-D33 PolarHBondContact O-N 3.38Å; D33-T50 HydrophobicContact CB-CG2 3.77Å; D33-T50 WeakPolarHBondContact O-CB 3.44Å; D33-T50 WeakPolarHBondContact O-CG2 3.36Å; D33-T50 PolarHBondContact O-OG1 3.35Å; D33-T50 WeakPolarHBondContact OD2-CB 3.41Å; D33-T50 PolarHBondContact OD2-OG1 3.12Å
34	G	84.6	Confident	74.7	Confident	17 Å²	17	96.4 Å²	96.4	18%	0.175	52%	0.523	C	S	.	.	S	Bend	trans	86.6	-172.6	-178.3	0	0	0	0	0	114.5	F32	F32-G34 PolarHBondContact O-N 2.56Å
35	P	91.3	Very high	75.9	Confident	63 Å²	63	91.4 Å²	91.4	41%	0.409	51%	0.512	S	S	.	.			trans	-64.7	136.1	-179.8	28.3	-34.7	0	0	0	110.8	T50 Y51	P35-T50 CarbonylContact O-C 3.49Å; P35-T50 VanDerWaalsContact O-CA 3.23Å; P35-T50 WeakPolarHBondContact O-CA 3.34Å; P35-Y51 HydrophobicContact CB-CD1 4.31Å; P35-Y51 HydrophobicContact CB-CE1 3.63Å; P35-Y51 WeakPolarHBondContact CD-O 3.32Å; P35-Y51 HydrophobicContact CG-CD1 4.04Å; P35-Y51 HydrophobicContact CG-CD2 4.32Å; P35-Y51 HydrophobicContact CG-CE1 3.62Å; P35-Y51 HydrophobicContact CG-CE2 3.92Å; P35-Y51 HydrophobicContact CG-CG 4.36Å; P35-Y51 WeakPolarHBondContact CG-O 3.41Å; P35-Y51 VanDerWaalsContact O-CD1 3.29Å; P35-Y51 WeakPolarHBondContact O-CD1 3.48Å; P35-Y51 PolarHBondContact O-N 3.02Å
36	S	90.2	Very high	77.3	Confident	79 Å²	79	88.2 Å²	88.2	55%	0.552	50%	0.495	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-100.1	143.4	178.3	-56.7	0	0	0	0	112.1	M49	S36-M49 CarbonylContact C-O 3.55Å; S36-M49 WeakPolarHBondContact CA-O 3.47Å
37	I	92.9	Very high	79	Confident	77 Å²	77	88.5 Å²	88.5	40%	0.395	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	157.2	175.9	-167.9	161.2	0	0	0	110.5	K39 M49 Y51 Y67	I37-K39 HydrophobicContact CG2-CB 4.14Å; I37-K39 PolarHBondContact O-N 2.8Å; I37-M49 PolarHBondContact N-O 3.05Å; I37-M49 PolarHBondContact O-N 2.99Å; I37-M49 VanDerWaalsContact O-N 3.1Å; I37-Y51 HydrophobicContact CB-CD1 4.2Å; I37-Y51 HydrophobicContact CB-CE1 4.42Å; I37-Y51 HydrophobicContact CG2-CD1 4.12Å; I37-Y67 HydrophobicContact CG2-CD1 4.21Å; I37-Y67 HydrophobicContact CG2-CE1 4.13Å
38	R	92.6	Very high	80.6	Confident	188 Å²	188	89.6 Å²	89.6	71%	0.709	48%	0.482	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.4	98.8	170.7	-71.9	-178.1	178.9	-99.3	11.2	109.6	D47	R38-D47 CarbonylContact C-O 3.42Å; R38-D47 WeakPolarHBondContact CA-O 3.15Å; R38-D47 IonicContact NH1-OD1 2.77Å; R38-D47 PolarHBondContact NH1-OD1 3.42Å; R38-D47 VanDerWaalsContact NH1-OD1 3.09Å
39	K	90	Very high	82.5	Confident	60 Å²	60	85.3 Å²	85.3	26%	0.261	45%	0.452	S	S	.	.			trans	-148	128.9	178.4	-170	-94.1	179.1	-155.9	0	107.7	I37 C41 D47 M49 E76	I37-K39 HydrophobicContact CG2-CB 4.14Å; I37-K39 PolarHBondContact O-N 2.8Å; K39-C41 PolarHBondContact O-N 2.79Å; K39-D47 PolarHBondContact N-O 3.21Å; K39-D47 CarbonylContact O-C 3.54Å; K39-D47 VanDerWaalsContact O-C 3.23Å; K39-M49 HydrophobicContact CD-CG 4.32Å; K39-M49 HydrophobicContact CD-SD 3.36Å; K39-M49 WeakPolarHBondContact CD-SD 3.46Å; K39-M49 WeakPolarHBondContact O-CG 3.04Å; K39-E76 IonicContact NZ-OE1 2.66Å; K39-E76 PolarHBondContact NZ-OE1 2.72Å; K39-E76 IonicContact NZ-OE2 3.09Å; K39-E76 PolarHBondContact NZ-OE2 2.91Å
40	E	91.7	Very high	84.2	Confident	129 Å²	129	79.2 Å²	79.2	60%	0.603	42%	0.423	S	S	*	.			trans	-74.2	124.6	-179.4	-168.8	177.6	88.8	0	0	110.7	A42 N46	E40-A42 PolarHBondContact O-N 2.69Å; E40-N46 CarbonylContact C-O 3.52Å; E40-N46 VanDerWaalsContact CA-O 3.31Å; E40-N46 WeakPolarHBondContact CA-O 3.23Å
41	C	89.8	Confident	86	Confident	1 Å²	1	78.4 Å²	78.4	1%	0.007	41%	0.406	C	S	.	.			trans	-73.8	120.8	172.7	178.3	0	0	0	0	109.8	K39 Y43 C44 G45 N46 M49 C69	K39-C41 PolarHBondContact O-N 2.79Å; C41-Y43 PolarHBondContact O-N 2.74Å; C41-Y43 VanDerWaalsContact O-N 3.08Å; C41-C44 VanDerWaalsContact CB-SG 3.57Å; C41-C44 PolarHBondContact O-N 3.11Å; C41-G45 WeakPolarHBondContact O-CA 3.35Å; C41-G45 PolarHBondContact O-N 3.34Å; C41-N46 HydrophobicContact CB-CB 4.44Å; C41-N46 PolarHBondContact N-O 2.8Å; C41-M49 HydrophobicContact CB-CG 4.3Å; C41-M49 HydrophobicContact CB-SD 3.87Å; C41-C69 HydrophobicContact CB-CB 4.23Å
42	A	87.2	Confident	87.7	Confident	80 Å²	80	75.8 Å²	75.8	66%	0.661	39%	0.389	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.1	-20.2	-178.1	0	0	0	0	0	113.9	E40	E40-A42 PolarHBondContact O-N 2.69Å
43	Y	87.1	Confident	89.2	Confident	156 Å²	156	70.9 Å²	70.9	61%	0.612	37%	0.374	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.2	-32.7	-177	-62.1	-82.8	0	0	0	113.9	C41 E74 E76	C41-Y43 PolarHBondContact O-N 2.74Å; C41-Y43 VanDerWaalsContact O-N 3.08Å; Y43-E74 HydrophobicContact CD2-CB 3.94Å; Y43-E74 HydrophobicContact CD2-CG 4.16Å; Y43-E74 HydrophobicContact CE2-CB 4.3Å; Y43-E74 HydrophobicContact CG-CB 4.46Å; Y43-E74 HydrophobicContact CG-CG 4.2Å; Y43-E76 HydrophobicContact CE2-CG 4.43Å
44	C	88.2	Confident	90.2	Very high	51 Å²	51	70.1 Å²	70.1	35%	0.345	37%	0.371	S	S	.	.	T	Hydrogen-bonded Turn	trans	-130.2	-7.2	-172.2	64.5	0	0	0	0	114.9	C41 N46 F72	C41-C44 VanDerWaalsContact CB-SG 3.57Å; C41-C44 PolarHBondContact O-N 3.11Å; C44-N46 PolarHBondContact O-N 2.97Å; C44-N46 VanDerWaalsContact SG-CB 3.52Å; C44-F72 HydrophobicContact CB-CD2 3.62Å; C44-F72 HydrophobicContact CB-CE2 3.38Å
45	G	87.9	Confident	90.5	Very high	45 Å²	45	75.2 Å²	75.2	46%	0.464	39%	0.391	S	S	.	.			trans	71.7	14.4	-177.3	0	0	0	0	0	114.4	C41	C41-G45 WeakPolarHBondContact O-CA 3.35Å; C41-G45 PolarHBondContact O-N 3.34Å
46	N	88.2	Confident	90.2	Very high	36 Å²	36	76.5 Å²	76.5	19%	0.193	40%	0.398	C	S	.	.			trans	-73	128.5	176.7	179.5	37.9	0	0	0	110.8	E40 C41 C44 R48 T70 Q71	E40-N46 CarbonylContact C-O 3.52Å; E40-N46 VanDerWaalsContact CA-O 3.31Å; E40-N46 WeakPolarHBondContact CA-O 3.23Å; C41-N46 HydrophobicContact CB-CB 4.44Å; C41-N46 PolarHBondContact N-O 2.8Å; C44-N46 PolarHBondContact O-N 2.97Å; C44-N46 VanDerWaalsContact SG-CB 3.52Å; N46-R48 PolarHBondContact ND2-O 2.9Å; N46-R48 PolarHBondContact O-N 3.46Å; N46-T70 PolarHBondContact ND2-OG1 3.39Å; N46-Q71 HydrophobicContact CB-CG 4.08Å; N46-Q71 WeakPolarHBondContact ND2-CG 3.38Å
47	D	91.8	Very high	90.1	Very high	71 Å²	71	78.6 Å²	78.6	38%	0.38	39%	0.394	S	S	.	.	S	Bend	trans	-73.3	-4.8	-178	-172.5	-114	0	0	0	113.6	R38 K39	R38-D47 CarbonylContact C-O 3.42Å; R38-D47 WeakPolarHBondContact CA-O 3.15Å; R38-D47 IonicContact NH1-OD1 2.77Å; R38-D47 PolarHBondContact NH1-OD1 3.42Å; R38-D47 VanDerWaalsContact NH1-OD1 3.09Å; K39-D47 PolarHBondContact N-O 3.21Å; K39-D47 CarbonylContact O-C 3.54Å; K39-D47 VanDerWaalsContact O-C 3.23Å
48	R	90.1	Very high	89.9	Confident	146 Å²	146	78.3 Å²	78.3	55%	0.551	40%	0.398	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-121.2	128.4	-176.3	-66.4	-176.7	-179.1	177.8	0.5	112.2	N46 T70	N46-R48 PolarHBondContact ND2-O 2.9Å; N46-R48 PolarHBondContact O-N 3.46Å; R48-T70 HydrophobicContact CB-CG2 4.35Å; R48-T70 PolarHBondContact O-OG1 3.05Å
49	M	92.3	Very high	89.3	Confident	0 Å²	0	73.9 Å²	73.9	0%	0	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.9	145.8	172.1	-64.2	-171.2	71.4	0	0	109.3	S36 I37 K39 C41 T68 C69 E76	S36-M49 CarbonylContact C-O 3.55Å; S36-M49 WeakPolarHBondContact CA-O 3.47Å; I37-M49 PolarHBondContact N-O 3.05Å; I37-M49 PolarHBondContact O-N 2.99Å; I37-M49 VanDerWaalsContact O-N 3.1Å; K39-M49 HydrophobicContact CD-CG 4.32Å; K39-M49 HydrophobicContact CD-SD 3.36Å; K39-M49 WeakPolarHBondContact CD-SD 3.46Å; K39-M49 WeakPolarHBondContact O-CG 3.04Å; C41-M49 HydrophobicContact CB-CG 4.3Å; C41-M49 HydrophobicContact CB-SD 3.87Å; M49-T68 CarbonylContact C-O 3.41Å; M49-T68 VanDerWaalsContact CA-O 3.3Å; M49-T68 WeakPolarHBondContact CA-O 3.44Å; M49-T68 WeakPolarHBondContact CB-O 3.27Å; M49-C69 HydrophobicContact CE-CB 4.09Å; M49-E76 HydrophobicContact CE-CG 4.44Å; M49-E76 VanDerWaalsContact CE-OE2 3.24Å; M49-E76 WeakPolarHBondContact CE-OE2 3.48Å
50	T	92	Very high	89.1	Confident	4 Å²	4	78.5 Å²	78.5	3%	0.025	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	156.9	168	55.1	0	0	0	0	109.7	D33 P35 Y67 T68 T70	D33-T50 HydrophobicContact CB-CG2 3.77Å; D33-T50 WeakPolarHBondContact O-CB 3.44Å; D33-T50 WeakPolarHBondContact O-CG2 3.36Å; D33-T50 PolarHBondContact O-OG1 3.35Å; D33-T50 WeakPolarHBondContact OD2-CB 3.41Å; D33-T50 PolarHBondContact OD2-OG1 3.12Å; P35-T50 CarbonylContact O-C 3.49Å; P35-T50 VanDerWaalsContact O-CA 3.23Å; P35-T50 WeakPolarHBondContact O-CA 3.34Å; T50-Y67 CarbonylContact O-C 3.45Å; T50-Y67 WeakPolarHBondContact O-CA 3.42Å; T50-T68 PolarHBondContact N-O 3.13Å; T50-T68 PolarHBondContact O-N 3.43Å; T50-T68 WeakPolarHBondContact OG1-CB 3.38Å; T50-T68 PolarHBondContact OG1-O 3.02Å; T50-T68 VanDerWaalsContact OG1-O 3.05Å; T50-T70 HydrophobicContact CG2-CG2 3.8Å
51	Y	91.8	Very high	88.5	Confident	82 Å²	82	77.6 Å²	77.6	32%	0.322	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.2	147.3	175.4	72.3	-85.5	0	0	0	112	P35 I37 V65 I66 Y67	P35-Y51 HydrophobicContact CB-CD1 4.31Å; P35-Y51 HydrophobicContact CB-CE1 3.63Å; P35-Y51 WeakPolarHBondContact CD-O 3.32Å; P35-Y51 HydrophobicContact CG-CD1 4.04Å; P35-Y51 HydrophobicContact CG-CD2 4.32Å; P35-Y51 HydrophobicContact CG-CE1 3.62Å; P35-Y51 HydrophobicContact CG-CE2 3.92Å; P35-Y51 HydrophobicContact CG-CG 4.36Å; P35-Y51 WeakPolarHBondContact CG-O 3.41Å; P35-Y51 VanDerWaalsContact O-CD1 3.29Å; P35-Y51 WeakPolarHBondContact O-CD1 3.48Å; P35-Y51 PolarHBondContact O-N 3.02Å; I37-Y51 HydrophobicContact CB-CD1 4.2Å; I37-Y51 HydrophobicContact CB-CE1 4.42Å; I37-Y51 HydrophobicContact CG2-CD1 4.12Å; Y51-V65 HydrophobicContact CD2-CG1 4.18Å; Y51-I66 CarbonylContact C-O 3.5Å; Y51-I66 VanDerWaalsContact CA-O 3.27Å; Y51-I66 WeakPolarHBondContact CA-O 3.49Å; Y51-Y67 HydrophobicContact CG-CE1 4.4Å
52	V	92.1	Very high	88.3	Confident	63 Å²	63	79 Å²	79	38%	0.382	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	138.1	172.7	-62.4	0	0	0	0	109.6	V65 I66	V52-V65 WeakPolarHBondContact O-CA 3.45Å; V52-I66 HydrophobicContact CG2-CB 3.85Å; V52-I66 PolarHBondContact N-O 3.2Å; V52-I66 PolarHBondContact O-N 3.27Å
53	T	91.9	Very high	88.5	Confident	73 Å²	73	78.8 Å²	78.8	45%	0.448	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	123.6	176.9	55.7	0	0	0	0	109.2	T64 V65	T53-T64 CarbonylContact C-O 3.58Å; T53-T64 WeakPolarHBondContact CA-O 3.49Å; T53-V65 HydrophobicContact CG2-CG2 4.24Å
54	V	91.4	Very high	88.7	Confident	51 Å²	51	71.6 Å²	71.6	31%	0.309	40%	0.397	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.4	137.6	-178	-66.5	0	0	0	0	110.8	T56 T64 I66	V54-T56 HydrophobicContact CB-CG2 4.42Å; V54-T56 HydrophobicContact CG2-CG2 3.8Å; V54-T56 PolarHBondContact O-N 2.79Å; V54-T64 HydrophobicContact CG2-CG2 4.48Å; V54-T64 PolarHBondContact N-O 3.12Å; V54-T64 PolarHBondContact O-N 2.87Å; V54-I66 HydrophobicContact CG2-CD1 3.54Å; V54-I66 HydrophobicContact CG2-CG1 3.94Å
55	Q	89.6	Confident	88.9	Confident	124 Å²	124	69.9 Å²	69.9	58%	0.579	39%	0.385	S	S	*	.			trans	-87.9	96.1	174.1	-149.1	86.2	70.8	0	0	108.4	G62 Q63	Q55-G62 VanDerWaalsContact NE2-C 3.28Å; Q55-G62 PolarHBondContact NE2-O 3.38Å; Q55-Q63 VanDerWaalsContact NE2-CA 3.32Å
56	T	86.3	Confident	89.2	Confident	91 Å²	91	69.3 Å²	69.3	56%	0.558	37%	0.371	S	S	*	.			trans	-97.5	-15	179.4	55.8	0	0	0	0	112.9	V54 T64	V54-T56 HydrophobicContact CB-CG2 4.42Å; V54-T56 HydrophobicContact CG2-CG2 3.8Å; V54-T56 PolarHBondContact O-N 2.79Å; T56-T64 PolarHBondContact OG1-OG1 2.9Å
57	R	86.9	Confident	89.4	Confident	123 Å²	123	69.2 Å²	69.2	46%	0.464	37%	0.368	S	S	.	.	S	Bend	trans	-121.4	176.9	-174.6	-58.2	-173.3	-170	-172	4.9	111.5	E61 N79	R57-E61 HydrophobicContact CB-CB 4Å; R57-N79 PolarHBondContact NH2-OD1 3.04Å
58	S	88.5	Confident	89.4	Confident	70 Å²	70	66.2 Å²	66.2	49%	0.49	35%	0.353	S	S	.	.			trans	-53.4	152.6	177.3	-46.5	0	0	0	0	111.2	D60 E61	S58-D60 PolarHBondContact O-N 2.81Å; S58-E61 PolarHBondContact O-N 2.76Å; S58-E61 PolarHBondContact OG-OE2 2.82Å
59	A	80.9	Confident	89.4	Confident	96 Å²	96	59.5 Å²	59.5	79%	0.793	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.4	-25.3	-178	0	0	0	0	0	113.5
60	D	85.7	Confident	89.1	Confident	157 Å²	157	62.1 Å²	62.1	84%	0.84	34%	0.344	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.6	-17	178.1	-57.6	-67	0	0	0	114.1	S58	S58-D60 PolarHBondContact O-N 2.81Å
61	E	78.4	Confident	88.7	Confident	110 Å²	110	68.1 Å²	68.1	51%	0.514	37%	0.372	S	S	.	.	S	Bend	trans	-102.1	17.2	-166.8	-64.1	-176	108.8	0	0	114.4	R57 S58	R57-E61 HydrophobicContact CB-CB 4Å; S58-E61 PolarHBondContact O-N 2.76Å; S58-E61 PolarHBondContact OG-OE2 2.82Å
62	G	86.6	Confident	88.2	Confident	29 Å²	29	69.9 Å²	69.9	30%	0.299	38%	0.381	S	S	.	.			trans	74.8	179.1	178.1	0	0	0	0	0	114.1	Q55	Q55-G62 VanDerWaalsContact NE2-C 3.28Å; Q55-G62 PolarHBondContact NE2-O 3.38Å
63	Q	90.1	Very high	87.6	Confident	77 Å²	77	71.9 Å²	71.9	36%	0.36	40%	0.398	S	S	.	.	P	Polyproline II helix	trans	-101.6	155	-180	68.1	179.2	4.7	0	0	111.1	Q55 T80	Q55-Q63 VanDerWaalsContact NE2-CA 3.32Å; Q63-T80 HydrophobicContact CG-CG2 3.82Å; Q63-T80 WeakPolarHBondContact O-CG2 3.45Å; Q63-T80 PolarHBondContact O-N 3.19Å
64	T	92.1	Very high	87.3	Confident	5 Å²	5	72.7 Å²	72.7	3%	0.031	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.7	131	173.4	-58.5	0	0	0	0	109.6	T53 V54 T56 I66 I77 N79	T53-T64 CarbonylContact C-O 3.58Å; T53-T64 WeakPolarHBondContact CA-O 3.49Å; V54-T64 HydrophobicContact CG2-CG2 4.48Å; V54-T64 PolarHBondContact N-O 3.12Å; V54-T64 PolarHBondContact O-N 2.87Å; T56-T64 PolarHBondContact OG1-OG1 2.9Å; T64-I66 HydrophobicContact CG2-CG1 4.3Å; T64-I77 HydrophobicContact CG2-CG2 3.25Å; T64-N79 PolarHBondContact OG1-OD1 2.82Å
65	V	93.4	Very high	87.2	Confident	14 Å²	14	75.7 Å²	75.7	9%	0.085	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	123.6	173.8	-169.4	0	0	0	0	108.2	Y51 V52 T53 Y67 E78	Y51-V65 HydrophobicContact CD2-CG1 4.18Å; V52-V65 WeakPolarHBondContact O-CA 3.45Å; T53-V65 HydrophobicContact CG2-CG2 4.24Å; V65-Y67 HydrophobicContact CB-CE2 4.29Å; V65-Y67 HydrophobicContact CG1-CD2 4.47Å; V65-Y67 HydrophobicContact CG1-CE1 4Å; V65-Y67 HydrophobicContact CG1-CE2 3.92Å; V65-E78 PolarHBondContact N-O 2.95Å; V65-E78 PolarHBondContact O-N 3.02Å; V65-E78 VanDerWaalsContact O-O 3.11Å
66	I	92.7	Very high	87.1	Confident	34 Å²	34	72 Å²	72	17%	0.174	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	116.7	176.2	-55.6	176.3	0	0	0	107.7	Y51 V52 V54 T64 K75 E76 I77	Y51-I66 CarbonylContact C-O 3.5Å; Y51-I66 VanDerWaalsContact CA-O 3.27Å; Y51-I66 WeakPolarHBondContact CA-O 3.49Å; V52-I66 HydrophobicContact CG2-CB 3.85Å; V52-I66 PolarHBondContact N-O 3.2Å; V52-I66 PolarHBondContact O-N 3.27Å; V54-I66 HydrophobicContact CG2-CD1 3.54Å; V54-I66 HydrophobicContact CG2-CG1 3.94Å; T64-I66 HydrophobicContact CG2-CG1 4.3Å; I66-K75 HydrophobicContact CG2-CB 4.22Å; I66-K75 HydrophobicContact CG2-CD 4.42Å; I66-E76 CarbonylContact C-O 3.53Å; I66-I77 HydrophobicContact CG1-CG1 4.26Å; I66-I77 HydrophobicContact CG1-CG2 4.42Å; I66-I77 HydrophobicContact CG2-CG1 4.37Å
67	Y	93.1	Very high	87.3	Confident	33 Å²	33	73.1 Å²	73.1	13%	0.129	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	131.8	172.5	-57.5	-83.1	0	0	0	109.8	I37 T50 Y51 V65 K75 E76 E78	I37-Y67 HydrophobicContact CG2-CD1 4.21Å; I37-Y67 HydrophobicContact CG2-CE1 4.13Å; T50-Y67 CarbonylContact O-C 3.45Å; T50-Y67 WeakPolarHBondContact O-CA 3.42Å; Y51-Y67 HydrophobicContact CG-CE1 4.4Å; V65-Y67 HydrophobicContact CB-CE2 4.29Å; V65-Y67 HydrophobicContact CG1-CD2 4.47Å; V65-Y67 HydrophobicContact CG1-CE1 4Å; V65-Y67 HydrophobicContact CG1-CE2 3.92Å; Y67-K75 CarbonylContact O-C 3.23Å; Y67-K75 VanDerWaalsContact O-CA 3.23Å; Y67-K75 WeakPolarHBondContact O-CA 3.42Å; Y67-E76 PolarHBondContact N-O 3.09Å; Y67-E76 PolarHBondContact O-N 3.23Å; Y67-E78 HydrophobicContact CD2-CB 4.39Å; Y67-E78 HydrophobicContact CE2-CB 3.73Å; Y67-E78 PolarHBondContact OH-OE1 2.89Å
68	T	91.3	Very high	87.3	Confident	9 Å²	9	72.2 Å²	72.2	6%	0.055	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	136.7	173	-57	0	0	0	0	109.2	M49 T50 K75	M49-T68 CarbonylContact C-O 3.41Å; M49-T68 VanDerWaalsContact CA-O 3.3Å; M49-T68 WeakPolarHBondContact CA-O 3.44Å; M49-T68 WeakPolarHBondContact CB-O 3.27Å; T50-T68 PolarHBondContact N-O 3.13Å; T50-T68 PolarHBondContact O-N 3.43Å; T50-T68 WeakPolarHBondContact OG1-CB 3.38Å; T50-T68 PolarHBondContact OG1-O 3.02Å; T50-T68 VanDerWaalsContact OG1-O 3.05Å; T68-K75 HydrophobicContact CG2-CG 4.23Å; T68-K75 VanDerWaalsContact CG2-NZ 3.34Å; T68-K75 PolarHBondContact OG1-NZ 2.86Å
69	C	90.1	Very high	87	Confident	4 Å²	4	72.9 Å²	72.9	3%	0.027	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.2	136.5	178.3	-178.8	0	0	0	0	110.8	C41 M49 Q71 F72 E74	C41-C69 HydrophobicContact CB-CB 4.23Å; M49-C69 HydrophobicContact CE-CB 4.09Å; C69-Q71 PolarHBondContact O-N 2.8Å; C69-Q71 PolarHBondContact SG-N 2.8Å; C69-Q71 VanDerWaalsContact SG-N 3.43Å; C69-F72 CarbonylContact C-O 3.58Å; C69-F72 VanDerWaalsContact CB-O 3.28Å; C69-F72 WeakPolarHBondContact CB-O 3.23Å; C69-E74 PolarHBondContact N-O 2.89Å
70	T	86.7	Confident	86.8	Confident	55 Å²	55	74.5 Å²	74.5	34%	0.337	39%	0.389	S	S	.	.	S	Bend	trans	-73.2	-13.4	178.5	59.6	0	0	0	0	113.4	N46 R48 T50	N46-T70 PolarHBondContact ND2-OG1 3.39Å; R48-T70 HydrophobicContact CB-CG2 4.35Å; R48-T70 PolarHBondContact O-OG1 3.05Å; T50-T70 HydrophobicContact CG2-CG2 3.8Å
71	Q	84.1	Confident	86.9	Confident	131 Å²	131	70.4 Å²	70.4	61%	0.612	37%	0.366	S	S	*	.	S	Bend	trans	-102	-26.6	-179.3	-66.2	-67.8	-65.4	0	0	112.5	N46 C69	N46-Q71 HydrophobicContact CB-CG 4.08Å; N46-Q71 WeakPolarHBondContact ND2-CG 3.38Å; C69-Q71 PolarHBondContact O-N 2.8Å; C69-Q71 PolarHBondContact SG-N 2.8Å; C69-Q71 VanDerWaalsContact SG-N 3.43Å
72	F	79.7	Confident	87.3	Confident	119 Å²	119	68.3 Å²	68.3	52%	0.522	36%	0.359	S	S	.	.	S	Bend	trans	-142.6	152.7	-177	-60.6	-77.3	0	0	0	110.1	C44 C69 E74	C44-F72 HydrophobicContact CB-CD2 3.62Å; C44-F72 HydrophobicContact CB-CE2 3.38Å; C69-F72 CarbonylContact C-O 3.58Å; C69-F72 VanDerWaalsContact CB-O 3.28Å; C69-F72 WeakPolarHBondContact CB-O 3.23Å; F72-E74 HydrophobicContact CB-CG 4.39Å; F72-E74 PolarHBondContact O-N 3.35Å
73	S	79.5	Confident	87.4	Confident	105 Å²	105	70.4 Å²	70.4	73%	0.734	36%	0.362	S	S	*	.	S	Bend	trans	-72.7	15.5	179.7	-54.8	0	0	0	0	115
74	E	86.3	Confident	87.2	Confident	90 Å²	90	70.1 Å²	70.1	42%	0.421	36%	0.362	S	S	.	.			trans	-70.7	138.5	177.2	-67	-55.9	133.1	0	0	111	Y43 C69 F72	Y43-E74 HydrophobicContact CD2-CB 3.94Å; Y43-E74 HydrophobicContact CD2-CG 4.16Å; Y43-E74 HydrophobicContact CE2-CB 4.3Å; Y43-E74 HydrophobicContact CG-CB 4.46Å; Y43-E74 HydrophobicContact CG-CG 4.2Å; C69-E74 PolarHBondContact N-O 2.89Å; F72-E74 HydrophobicContact CB-CG 4.39Å; F72-E74 PolarHBondContact O-N 3.35Å
75	K	88.5	Confident	86.9	Confident	114 Å²	114	74.1 Å²	74.1	50%	0.496	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	134.9	-173.1	-57.8	-176.3	-176.1	-68.3	0	110.9	I66 Y67 T68	I66-K75 HydrophobicContact CG2-CB 4.22Å; I66-K75 HydrophobicContact CG2-CD 4.42Å; Y67-K75 CarbonylContact O-C 3.23Å; Y67-K75 VanDerWaalsContact O-CA 3.23Å; Y67-K75 WeakPolarHBondContact O-CA 3.42Å; T68-K75 HydrophobicContact CG2-CG 4.23Å; T68-K75 VanDerWaalsContact CG2-NZ 3.34Å; T68-K75 PolarHBondContact OG1-NZ 2.86Å
76	E	88.8	Confident	86.5	Confident	47 Å²	47	78.1 Å²	78.1	22%	0.22	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	131.9	175.2	-67.8	176.4	83.9	0	0	108.6	K39 Y43 M49 I66 Y67	K39-E76 IonicContact NZ-OE1 2.66Å; K39-E76 PolarHBondContact NZ-OE1 2.72Å; K39-E76 IonicContact NZ-OE2 3.09Å; K39-E76 PolarHBondContact NZ-OE2 2.91Å; Y43-E76 HydrophobicContact CE2-CG 4.43Å; M49-E76 HydrophobicContact CE-CG 4.44Å; M49-E76 VanDerWaalsContact CE-OE2 3.24Å; M49-E76 WeakPolarHBondContact CE-OE2 3.48Å; I66-E76 CarbonylContact C-O 3.53Å; Y67-E76 PolarHBondContact N-O 3.09Å; Y67-E76 PolarHBondContact O-N 3.23Å
77	I	90.2	Very high	86	Confident	114 Å²	114	81.3 Å²	81.3	59%	0.585	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-111.9	123.3	-174.1	-55.5	178.5	0	0	0	108.5	T64 I66	T64-I77 HydrophobicContact CG2-CG2 3.25Å; I66-I77 HydrophobicContact CG1-CG1 4.26Å; I66-I77 HydrophobicContact CG1-CG2 4.42Å; I66-I77 HydrophobicContact CG2-CG1 4.37Å
78	E	86.7	Confident	85.5	Confident	103 Å²	103	85 Å²	85	48%	0.481	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	131.6	174.7	-173.2	171.7	76.9	0	0	108.9	V65 Y67	V65-E78 PolarHBondContact N-O 2.95Å; V65-E78 PolarHBondContact O-N 3.02Å; V65-E78 VanDerWaalsContact O-O 3.11Å; Y67-E78 HydrophobicContact CD2-CB 4.39Å; Y67-E78 HydrophobicContact CE2-CB 3.73Å; Y67-E78 PolarHBondContact OH-OE1 2.89Å
79	N	82.7	Confident	85	Confident	85 Å²	85	91.3 Å²	91.3	46%	0.455	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	124.6	176.7	-54.7	-93.6	0	0	0	107	R57 T64	R57-N79 PolarHBondContact NH2-OD1 3.04Å; T64-N79 PolarHBondContact OG1-OD1 2.82Å
80	T	76.8	Confident	84.5	Confident	129 Å²	129	99.3 Å²	99.3	79%	0.791	51%	0.514	S	S	*	.			trans	-102.6	0	173.8	-160	0	0	0	0	112.4	Q63	Q63-T80 HydrophobicContact CG-CG2 3.82Å; Q63-T80 WeakPolarHBondContact O-CG2 3.45Å; Q63-T80 PolarHBondContact O-N 3.19Å

Retrieved 80 of 80 residues in 54.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).