A0A5K4F4G9_SCHMA Loading...

Transcriptional regulator

AlphaFold DB , UniProt , Accession A0A5K4F4G9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 67 aa.

						>A0A5K4F4G9_SCHMA|A0A5K4F4G9
MSTLSEQIAIQEAVQNELQQTVFSQPIYERFGGNIFFPVSRTNALIQCKEKLLKLSKNSSELKTDKD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.8	Low	84.9	Confident	242 Å²	242	79.5 Å²	79.5	100%	1.192	44%	0.441	S	S	*	.				0	113.7	0	-69.8	-65.8	-119.9	0	0	106.5
2	S	70.6	Confident	85.6	Confident	57 Å²	57	80.9 Å²	80.9	40%	0.399	44%	0.441	S	S	.	.			trans	-73.7	140.3	174	44.9	0	0	0	0	110	E6 Q7	S2-E6 WeakPolarHBondContact CA-OE2 3.45Å; S2-E6 VanDerWaalsContact CB-OE2 3.3Å; S2-E6 WeakPolarHBondContact CB-OE2 3.49Å; S2-Q7 PolarHBondContact O-NE2 2.96Å; S2-Q7 WeakPolarHBondContact OG-CG 3.38Å; S2-Q7 PolarHBondContact OG-NE2 2.87Å
3	T	85.7	Confident	86.2	Confident	65 Å²	65	79 Å²	79	40%	0.399	44%	0.443	S	S	.	.			trans	-66.1	155	174.9	58.8	0	0	0	0	110.4	S5 E6 Q7	T3-S5 PolarHBondContact O-N 3.05Å; T3-S5 PolarHBondContact OG1-OG 3.27Å; T3-E6 WeakPolarHBondContact CG2-OE1 3.42Å; T3-E6 PolarHBondContact N-OE2 3.49Å; T3-E6 VanDerWaalsContact N-OE2 3.1Å; T3-E6 WeakPolarHBondContact O-CB 3.46Å; T3-E6 PolarHBondContact O-N 2.88Å; T3-E6 WeakPolarHBondContact OG1-CG 3.43Å; T3-E6 PolarHBondContact OG1-N 2.92Å; T3-E6 PolarHBondContact OG1-OE1 3.32Å; T3-Q7 PolarHBondContact O-N 3.21Å
4	L	87.1	Confident	86.7	Confident	41 Å²	41	77.3 Å²	77.3	22%	0.215	44%	0.435	C	S	.	.	H	α-helix	trans	-58.2	-35.6	177	-175.4	66.4	0	0	0	111.6	Q7 I8 L55 N58 S59 L62	L4-Q7 PolarHBondContact O-N 3.23Å; L4-I8 HydrophobicContact CG-CD1 4.37Å; L4-I8 WeakPolarHBondContact O-CG1 3.4Å; L4-I8 PolarHBondContact O-N 3.44Å; L4-L55 HydrophobicContact CD1-CB 4.33Å; L4-L55 HydrophobicContact CD1-CD2 3.68Å; L4-N58 HydrophobicContact CD1-CB 4.47Å; L4-N58 HydrophobicContact CD2-CB 4.34Å; L4-S59 VanDerWaalsContact CD2-CB 3.49Å; L4-L62 HydrophobicContact CD2-CD1 3.94Å
5	S	87	Confident	87.1	Confident	83 Å²	83	74.3 Å²	74.3	58%	0.58	42%	0.416	S	S	*	.	H	α-helix	trans	-62.2	-42.2	172.6	43.6	0	0	0	0	112.8	T3 Q7 I8 A9	T3-S5 PolarHBondContact O-N 3.05Å; T3-S5 PolarHBondContact OG1-OG 3.27Å; S5-Q7 VanDerWaalsContact C-N 3.34Å; S5-I8 PolarHBondContact O-N 3.01Å; S5-A9 WeakPolarHBondContact O-CB 3.18Å; S5-A9 PolarHBondContact O-N 2.91Å
6	E	90.3	Very high	87.5	Confident	93 Å²	93	74.6 Å²	74.6	44%	0.435	42%	0.416	S	S	.	.	H	α-helix	trans	-63.6	-40.9	174	-76.7	155.5	-136.4	0	0	111.4	S2 T3 I8 A9 I10	S2-E6 WeakPolarHBondContact CA-OE2 3.45Å; S2-E6 VanDerWaalsContact CB-OE2 3.3Å; S2-E6 WeakPolarHBondContact CB-OE2 3.49Å; T3-E6 WeakPolarHBondContact CG2-OE1 3.42Å; T3-E6 PolarHBondContact N-OE2 3.49Å; T3-E6 VanDerWaalsContact N-OE2 3.1Å; T3-E6 WeakPolarHBondContact O-CB 3.46Å; T3-E6 PolarHBondContact O-N 2.88Å; T3-E6 WeakPolarHBondContact OG1-CG 3.43Å; T3-E6 PolarHBondContact OG1-N 2.92Å; T3-E6 PolarHBondContact OG1-OE1 3.32Å; E6-I8 VanDerWaalsContact C-N 3.34Å; E6-I8 PolarHBondContact O-N 3.32Å; E6-A9 PolarHBondContact O-N 3.24Å; E6-I10 WeakPolarHBondContact O-CB 3.47Å; E6-I10 WeakPolarHBondContact O-CD1 3.45Å; E6-I10 WeakPolarHBondContact O-CG1 3.44Å; E6-I10 PolarHBondContact O-N 2.77Å
7	Q	90.5	Very high	87.9	Confident	76 Å²	76	77.5 Å²	77.5	36%	0.355	43%	0.426	S	S	.	.	H	α-helix	trans	-63.4	-41.1	178.2	-67.3	179	19.1	0	0	112	S2 T3 L4 S5 Q11 L55	S2-Q7 PolarHBondContact O-NE2 2.96Å; S2-Q7 WeakPolarHBondContact OG-CG 3.38Å; S2-Q7 PolarHBondContact OG-NE2 2.87Å; T3-Q7 PolarHBondContact O-N 3.21Å; L4-Q7 PolarHBondContact O-N 3.23Å; S5-Q7 VanDerWaalsContact C-N 3.34Å; Q7-Q11 WeakPolarHBondContact O-CB 3.4Å; Q7-Q11 PolarHBondContact O-N 3.25Å; Q7-L55 HydrophobicContact CB-CD1 4.07Å; Q7-L55 HydrophobicContact CB-CD2 4.08Å; Q7-L55 VanDerWaalsContact OE1-CD2 3.31Å
8	I	91.6	Very high	88.1	Confident	31 Å²	31	74.4 Å²	74.4	16%	0.159	41%	0.409	C	S	.	.	H	α-helix	trans	-62.7	-50.5	174.4	-68.2	168	0	0	0	109.9	L4 S5 E6 I10 Q11 E12 L52 L55	L4-I8 HydrophobicContact CG-CD1 4.37Å; L4-I8 WeakPolarHBondContact O-CG1 3.4Å; L4-I8 PolarHBondContact O-N 3.44Å; S5-I8 PolarHBondContact O-N 3.01Å; E6-I8 VanDerWaalsContact C-N 3.34Å; E6-I8 PolarHBondContact O-N 3.32Å; I8-I10 VanDerWaalsContact C-N 3.34Å; I8-I10 PolarHBondContact O-N 3.03Å; I8-Q11 PolarHBondContact O-N 2.98Å; I8-Q11 VanDerWaalsContact O-N 3.07Å; I8-E12 HydrophobicContact CG2-CG 4.28Å; I8-E12 WeakPolarHBondContact O-CG 3.38Å; I8-E12 PolarHBondContact O-N 2.77Å; I8-L52 HydrophobicContact CG2-CD2 4.27Å; I8-L55 HydrophobicContact CD1-CB 4.35Å; I8-L55 HydrophobicContact CG1-CB 3.68Å; I8-L55 HydrophobicContact CG1-CD1 4.34Å
9	A	92.4	Very high	88.3	Confident	54 Å²	54	76.4 Å²	76.4	45%	0.446	42%	0.415	S	S	.	.	H	α-helix	trans	-59.9	-41.7	-179.2	0	0	0	0	0	112.6	S5 E6 Q11 E12 A13	S5-A9 WeakPolarHBondContact O-CB 3.18Å; S5-A9 PolarHBondContact O-N 2.91Å; E6-A9 PolarHBondContact O-N 3.24Å; A9-Q11 VanDerWaalsContact C-N 3.34Å; A9-E12 PolarHBondContact O-N 3.01Å; A9-A13 WeakPolarHBondContact O-CB 3.46Å; A9-A13 PolarHBondContact O-N 2.91Å
10	I	92.5	Very high	88.5	Confident	102 Å²	102	80.7 Å²	80.7	52%	0.523	43%	0.432	S	S	.	.	H	α-helix	trans	-61.8	-45.2	174.8	-69.5	164.5	0	0	0	110.1	E6 I8 A13 V14	E6-I10 WeakPolarHBondContact O-CB 3.47Å; E6-I10 WeakPolarHBondContact O-CD1 3.45Å; E6-I10 WeakPolarHBondContact O-CG1 3.44Å; E6-I10 PolarHBondContact O-N 2.77Å; I8-I10 VanDerWaalsContact C-N 3.34Å; I8-I10 PolarHBondContact O-N 3.03Å; I10-A13 PolarHBondContact O-N 3.44Å; I10-V14 VanDerWaalsContact O-CG2 3.32Å; I10-V14 WeakPolarHBondContact O-CG2 3.27Å; I10-V14 PolarHBondContact O-N 3.46Å
11	Q	92.2	Very high	88.4	Confident	31 Å²	31	78.2 Å²	78.2	15%	0.145	42%	0.42	C	S	.	.	H	α-helix	trans	-69.6	-35.2	-177.2	-167.4	68.5	50.8	0	0	112.2	Q7 I8 A9 V14 Q15 C48 K51 L52 L55	Q7-Q11 WeakPolarHBondContact O-CB 3.4Å; Q7-Q11 PolarHBondContact O-N 3.25Å; I8-Q11 PolarHBondContact O-N 2.98Å; I8-Q11 VanDerWaalsContact O-N 3.07Å; A9-Q11 VanDerWaalsContact C-N 3.34Å; Q11-V14 PolarHBondContact O-N 2.88Å; Q11-Q15 PolarHBondContact O-N 3.41Å; Q11-C48 PolarHBondContact NE2-SG 2.96Å; Q11-C48 PolarHBondContact O-SG 3.36Å; Q11-C48 VanDerWaalsContact O-SG 3.42Å; Q11-K51 HydrophobicContact CG-CB 4.08Å; Q11-L52 HydrophobicContact CB-CD2 3.63Å; Q11-L52 HydrophobicContact CB-CG 4.1Å; Q11-L52 HydrophobicContact CG-CD1 4.39Å; Q11-L52 HydrophobicContact CG-CD2 3.71Å; Q11-L52 HydrophobicContact CG-CG 3.58Å; Q11-L55 HydrophobicContact CB-CD1 4.31Å
12	E	93.6	Very high	90.1	Very high	96 Å²	96	71.2 Å²	71.2	45%	0.449	39%	0.391	S	S	.	.	H	α-helix	trans	-65	-43.3	171.6	-71.9	177.6	165.2	0	0	111.5	I8 A9 V14 Q15 N16 L52	I8-E12 HydrophobicContact CG2-CG 4.28Å; I8-E12 WeakPolarHBondContact O-CG 3.38Å; I8-E12 PolarHBondContact O-N 2.77Å; A9-E12 PolarHBondContact O-N 3.01Å; E12-V14 VanDerWaalsContact C-N 3.35Å; E12-V14 PolarHBondContact O-N 3.38Å; E12-Q15 WeakPolarHBondContact O-CB 3.37Å; E12-Q15 PolarHBondContact O-N 3.05Å; E12-N16 PolarHBondContact O-N 3.03Å; E12-N16 PolarHBondContact O-ND2 3.32Å; E12-L52 HydrophobicContact CG-CD1 4.31Å; E12-L52 HydrophobicContact CG-CD2 3.73Å
13	A	93.9	Very high	90.8	Very high	56 Å²	56	77 Å²	77	46%	0.463	41%	0.409	S	S	.	.	H	α-helix	trans	-59.2	-45.7	174.8	0	0	0	0	0	111.6	A9 I10 Q15 N16 E17	A9-A13 WeakPolarHBondContact O-CB 3.46Å; A9-A13 PolarHBondContact O-N 2.91Å; I10-A13 PolarHBondContact O-N 3.44Å; A13-Q15 VanDerWaalsContact C-N 3.32Å; A13-Q15 PolarHBondContact O-N 3.44Å; A13-N16 PolarHBondContact O-N 3.01Å; A13-E17 WeakPolarHBondContact O-CB 3.34Å; A13-E17 PolarHBondContact O-N 2.96Å
14	V	92.4	Very high	91	Very high	55 Å²	55	78.8 Å²	78.8	33%	0.333	42%	0.424	S	S	.	.	H	α-helix	trans	-62	-40	175.5	172.1	0	0	0	0	111.4	I10 Q11 E12 E17 L18	I10-V14 VanDerWaalsContact O-CG2 3.32Å; I10-V14 WeakPolarHBondContact O-CG2 3.27Å; I10-V14 PolarHBondContact O-N 3.46Å; Q11-V14 PolarHBondContact O-N 2.88Å; E12-V14 VanDerWaalsContact C-N 3.35Å; E12-V14 PolarHBondContact O-N 3.38Å; V14-E17 PolarHBondContact O-N 3.32Å; V14-L18 HydrophobicContact CG1-CD1 4.04Å; V14-L18 HydrophobicContact CG1-CG 4.41Å; V14-L18 WeakPolarHBondContact O-CB 3.45Å; V14-L18 VanDerWaalsContact O-CG 3.28Å; V14-L18 WeakPolarHBondContact O-CG 3.42Å; V14-L18 PolarHBondContact O-N 3.36Å
15	Q	93.4	Very high	91.2	Very high	33 Å²	33	81.8 Å²	81.8	15%	0.154	44%	0.437	C	S	.	.	H	α-helix	trans	-59.8	-48.1	175.6	-165.1	177	31.8	0	0	111.9	Q11 E12 A13 E17 L18 Q19 L45 C48 K49	Q11-Q15 PolarHBondContact O-N 3.41Å; E12-Q15 WeakPolarHBondContact O-CB 3.37Å; E12-Q15 PolarHBondContact O-N 3.05Å; A13-Q15 VanDerWaalsContact C-N 3.32Å; A13-Q15 PolarHBondContact O-N 3.44Å; Q15-E17 VanDerWaalsContact C-N 3.35Å; Q15-L18 PolarHBondContact O-N 2.95Å; Q15-Q19 WeakPolarHBondContact O-CG 3.46Å; Q15-Q19 PolarHBondContact O-N 3.31Å; Q15-L45 HydrophobicContact CG-CD2 4.36Å; Q15-C48 WeakPolarHBondContact CB-SG 3.3Å; Q15-K49 VanDerWaalsContact NE2-CG 3.27Å
16	N	93.8	Very high	91.5	Very high	78 Å²	78	81.7 Å²	81.7	42%	0.417	43%	0.434	S	S	.	.	H	α-helix	trans	-63.3	-42.9	-179.5	-71.5	-27.8	0	0	0	111	E12 A13 Q19 Q20	E12-N16 PolarHBondContact O-N 3.03Å; E12-N16 PolarHBondContact O-ND2 3.32Å; A13-N16 PolarHBondContact O-N 3.01Å; N16-Q19 PolarHBondContact O-N 3.3Å; N16-Q20 WeakPolarHBondContact O-CB 3.4Å; N16-Q20 VanDerWaalsContact O-CG 3.3Å; N16-Q20 WeakPolarHBondContact O-CG 3.42Å; N16-Q20 PolarHBondContact O-N 3.07Å
17	E	93.2	Very high	91.6	Very high	125 Å²	125	78.3 Å²	78.3	58%	0.584	42%	0.419	S	S	*	.	H	α-helix	trans	-60.6	-48.2	176	-170.9	178.1	173.9	0	0	111.2	A13 V14 Q15 Q19 Q20 T21	A13-E17 WeakPolarHBondContact O-CB 3.34Å; A13-E17 PolarHBondContact O-N 2.96Å; V14-E17 PolarHBondContact O-N 3.32Å; Q15-E17 VanDerWaalsContact C-N 3.35Å; E17-Q19 PolarHBondContact O-N 2.86Å; E17-Q20 PolarHBondContact O-N 3.36Å; E17-Q20 VanDerWaalsContact O-N 3.11Å; E17-T21 HydrophobicContact CG-CG2 4.27Å; E17-T21 WeakPolarHBondContact O-CG2 3.42Å; E17-T21 PolarHBondContact O-N 3.48Å
18	L	92.2	Very high	91.8	Very high	21 Å²	21	81.1 Å²	81.1	11%	0.11	43%	0.427	C	S	.	.	H	α-helix	trans	-59.4	-33.6	177.3	-73.1	172.5	0	0	0	113.1	V14 Q15 T21 I27 A44 L45	V14-L18 HydrophobicContact CG1-CD1 4.04Å; V14-L18 HydrophobicContact CG1-CG 4.41Å; V14-L18 WeakPolarHBondContact O-CB 3.45Å; V14-L18 VanDerWaalsContact O-CG 3.28Å; V14-L18 WeakPolarHBondContact O-CG 3.42Å; V14-L18 PolarHBondContact O-N 3.36Å; Q15-L18 PolarHBondContact O-N 2.95Å; L18-T21 PolarHBondContact O-OG1 3.32Å; L18-I27 HydrophobicContact CD2-CD1 3.79Å; L18-I27 HydrophobicContact CD2-CG1 4.05Å; L18-I27 HydrophobicContact CD2-CG2 3.8Å; L18-A44 HydrophobicContact CD1-CB 3.94Å; L18-A44 HydrophobicContact CD2-CB 4.25Å; L18-L45 HydrophobicContact CB-CD2 3.68Å; L18-L45 HydrophobicContact CB-CG 4.34Å; L18-L45 HydrophobicContact CD1-CD2 4.31Å
19	Q	91.6	Very high	91.9	Very high	112 Å²	112	82.7 Å²	82.7	52%	0.523	43%	0.434	S	S	.	.	H	α-helix	trans	-75.1	-34	176.7	-73.2	178.4	-17.1	0	0	113	Q15 N16 E17 L45	Q15-Q19 WeakPolarHBondContact O-CG 3.46Å; Q15-Q19 PolarHBondContact O-N 3.31Å; N16-Q19 PolarHBondContact O-N 3.3Å; E17-Q19 PolarHBondContact O-N 2.86Å; Q19-L45 HydrophobicContact CG-CD2 3.87Å
20	Q	91.4	Very high	92	Very high	163 Å²	163	87.7 Å²	87.7	76%	0.762	44%	0.442	S	S	*	.	H	α-helix	trans	-86.8	-20.9	-178.2	-68.8	177.7	4	0	0	113.2	N16 E17	N16-Q20 WeakPolarHBondContact O-CB 3.4Å; N16-Q20 VanDerWaalsContact O-CG 3.3Å; N16-Q20 WeakPolarHBondContact O-CG 3.42Å; N16-Q20 PolarHBondContact O-N 3.07Å; E17-Q20 PolarHBondContact O-N 3.36Å; E17-Q20 VanDerWaalsContact O-N 3.11Å
21	T	87.7	Confident	91.9	Very high	28 Å²	28	90.6 Å²	90.6	17%	0.172	45%	0.45	C	S	.	.	S	Bend	trans	-57.9	139.3	178	58.3	0	0	0	0	112.2	E17 L18 F23 R41	E17-T21 HydrophobicContact CG-CG2 4.27Å; E17-T21 WeakPolarHBondContact O-CG2 3.42Å; E17-T21 PolarHBondContact O-N 3.48Å; L18-T21 PolarHBondContact O-OG1 3.32Å; T21-F23 PolarHBondContact O-N 2.87Å; T21-R41 PolarHBondContact OG1-NE 2.96Å; T21-R41 PolarHBondContact OG1-NH2 3.47Å
22	V	88.6	Confident	91.8	Very high	96 Å²	96	90.8 Å²	90.8	58%	0.582	46%	0.461	S	S	*	.			trans	-59.6	137.7	177	-177.1	0	0	0	0	109.4	S24 Q25 R41	V22-S24 WeakPolarHBondContact CG1-OG 3.4Å; V22-S24 PolarHBondContact O-N 3.02Å; V22-Q25 VanDerWaalsContact O-CB 3.3Å; V22-Q25 WeakPolarHBondContact O-CB 3.18Å; V22-Q25 PolarHBondContact O-N 3.1Å; V22-R41 PolarHBondContact O-NH2 3.48Å
23	F	85.5	Confident	91.8	Very high	177 Å²	177	88.8 Å²	88.8	78%	0.776	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.2	-34.6	-173.1	-172.6	-97.5	0	0	0	113.9	T21 Q25 R41	T21-F23 PolarHBondContact O-N 2.87Å; F23-Q25 VanDerWaalsContact C-N 3.28Å; F23-Q25 PolarHBondContact O-N 3.41Å; F23-R41 PolarHBondContact O-NH1 3.27Å; F23-R41 PolarHBondContact O-NH2 2.98Å
24	S	90.2	Very high	91.8	Very high	103 Å²	103	93 Å²	93	72%	0.72	48%	0.481	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.2	-12.8	179.1	54.5	0	0	0	0	114.8	V22	V22-S24 WeakPolarHBondContact CG1-OG 3.4Å; V22-S24 PolarHBondContact O-N 3.02Å
25	Q	91.1	Very high	92	Very high	104 Å²	104	94.9 Å²	94.9	49%	0.486	49%	0.488	S	S	.	.	S	Bend	trans	-74.7	125.4	-179.2	-170.7	172.2	-10.1	0	0	110.4	V22 F23 R41	V22-Q25 VanDerWaalsContact O-CB 3.3Å; V22-Q25 WeakPolarHBondContact O-CB 3.18Å; V22-Q25 PolarHBondContact O-N 3.1Å; F23-Q25 VanDerWaalsContact C-N 3.28Å; F23-Q25 PolarHBondContact O-N 3.41Å; Q25-R41 PolarHBondContact O-NH2 2.96Å
26	P	92.6	Very high	92.2	Very high	81 Å²	81	98.8 Å²	98.8	53%	0.526	51%	0.505	S	S	.	.			trans	-69.9	143.9	176.1	29.4	-34.4	0	0	0	110.8	Y28	P26-Y28 HydrophobicContact CB-CE2 3.74Å; P26-Y28 HydrophobicContact CG-CE2 3.87Å
27	I	94.3	Very high	92.3	Very high	23 Å²	23	100.1 Å²	100.1	12%	0.118	51%	0.507	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	137	178	-62	158.4	0	0	0	107.8	L18 P38 V39 R41 A44	L18-I27 HydrophobicContact CD2-CD1 3.79Å; L18-I27 HydrophobicContact CD2-CG1 4.05Å; L18-I27 HydrophobicContact CD2-CG2 3.8Å; I27-P38 WeakPolarHBondContact O-CA 3.44Å; I27-V39 HydrophobicContact CB-CG2 4.23Å; I27-V39 HydrophobicContact CG2-CG2 3.67Å; I27-V39 PolarHBondContact O-N 3.39Å; I27-R41 VanDerWaalsContact CD1-CA 3.49Å; I27-R41 HydrophobicContact CD1-CB 3.51Å; I27-R41 HydrophobicContact CD1-CG 3.72Å; I27-A44 HydrophobicContact CG2-CB 4.07Å
28	Y	94.3	Very high	92.4	Very high	134 Å²	134	98.7 Å²	98.7	53%	0.525	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	139.4	179.4	-62.4	-93.2	0	0	0	111.1	P26 F36 F37 P38	P26-Y28 HydrophobicContact CB-CE2 3.74Å; P26-Y28 HydrophobicContact CG-CE2 3.87Å; Y28-F36 HydrophobicContact CD1-CB 4.39Å; Y28-F37 CarbonylContact C-O 3.52Å; Y28-F37 VanDerWaalsContact CA-O 3.23Å; Y28-F37 WeakPolarHBondContact CA-O 3.15Å; Y28-P38 HydrophobicContact CD1-CB 4.25Å; Y28-P38 HydrophobicContact CE1-CB 4.06Å
29	E	93.3	Very high	92.5	Very high	65 Å²	65	99.3 Å²	99.3	30%	0.304	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	136.1	170.8	-173.9	169.3	-152.9	0	0	109.9	F36 F37 V39 Q47 K51	E29-F36 CarbonylContact O-C 3.59Å; E29-F36 WeakPolarHBondContact O-CA 3.32Å; E29-F37 PolarHBondContact N-O 3.02Å; E29-F37 PolarHBondContact O-N 3.3Å; E29-V39 HydrophobicContact CB-CG1 3.77Å; E29-V39 HydrophobicContact CB-CG2 4.23Å; E29-Q47 PolarHBondContact OE1-OE1 2.97Å; E29-Q47 VanDerWaalsContact OE1-OE1 3.13Å; E29-Q47 PolarHBondContact OE2-NE2 3.47Å; E29-Q47 PolarHBondContact OE2-OE1 3.04Å; E29-K51 IonicContact OE1-NZ 3.83Å
30	R	94	Very high	92.6	Very high	159 Å²	159	96.6 Å²	96.6	60%	0.6	51%	0.506	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79.7	122.4	178.2	-172.8	-179.4	-177.2	-168.2	3.6	110	G33 I35 F36	R30-G33 PolarHBondContact NE-O 3.14Å; R30-G33 PolarHBondContact NH2-O 2.96Å; R30-I35 WeakPolarHBondContact CA-O 3.37Å; R30-F36 HydrophobicContact CB-CD1 3.98Å; R30-F36 HydrophobicContact CB-CE1 3.8Å; R30-F36 HydrophobicContact CG-CD1 4.37Å; R30-F36 HydrophobicContact CG-CE1 3.98Å; R30-F36 HydrophobicContact CG-CZ 4.28Å
31	F	90.6	Very high	92.6	Very high	162 Å²	162	90.8 Å²	90.8	71%	0.711	48%	0.477	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.5	-13.2	-179.9	-168	-103.6	0	0	0	113.9	I35 F37	F31-I35 HydrophobicContact CB-CG2 4.4Å; F31-I35 PolarHBondContact N-O 2.92Å; F31-F37 HydrophobicContact CB-CD2 3.6Å; F31-F37 HydrophobicContact CB-CE2 3.56Å; F31-F37 AromaticContact CD1-CE2 3.85Å; F31-F37 HydrophobicContact CD1-CE2 3.85Å; F31-F37 HydrophobicContact CD2-CD2 4.14Å; F31-F37 HydrophobicContact CD2-CE2 4.03Å; F31-F37 AromaticContact CG-CD2 3.9Å; F31-F37 HydrophobicContact CG-CD2 3.9Å; F31-F37 AromaticContact CG-CE2 3.55Å; F31-F37 HydrophobicContact CG-CE2 3.55Å
32	G	90.5	Very high	92.8	Very high	36 Å²	36	93.9 Å²	93.9	37%	0.371	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	142.9	153.1	-179.2	0	0	0	0	0	111.4	N34 I35	G32-N34 PolarHBondContact O-N 3Å; G32-I35 WeakPolarHBondContact O-CB 3.35Å; G32-I35 PolarHBondContact O-N 3.36Å
33	G	93.1	Very high	93.1	Very high	53 Å²	53	93.6 Å²	93.6	55%	0.546	49%	0.491	S	S	.	.	T	Hydrogen-bonded Turn	trans	52.5	-124.3	-176.1	0	0	0	0	0	111.3	R30	R30-G33 PolarHBondContact NE-O 3.14Å; R30-G33 PolarHBondContact NH2-O 2.96Å
34	N	94.9	Very high	93.5	Very high	144 Å²	144	85.6 Å²	85.6	77%	0.77	46%	0.458	S	S	*	.	T	Hydrogen-bonded Turn	trans	-108.8	26.2	176.2	-63	-22	0	0	0	112.6	G32 F36	G32-N34 PolarHBondContact O-N 3Å; N34-F36 WeakPolarHBondContact O-CD2 3.35Å
35	I	96.1	Very high	93.7	Very high	95 Å²	95	82.4 Å²	82.4	49%	0.487	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	130.4	-178.1	-56.9	175	0	0	0	110.2	R30 F31 G32 F37	R30-I35 WeakPolarHBondContact CA-O 3.37Å; F31-I35 HydrophobicContact CB-CG2 4.4Å; F31-I35 PolarHBondContact N-O 2.92Å; G32-I35 WeakPolarHBondContact O-CB 3.35Å; G32-I35 PolarHBondContact O-N 3.36Å; I35-F37 HydrophobicContact CG2-CD2 4.47Å; I35-F37 HydrophobicContact CG2-CE2 3.87Å; I35-F37 HydrophobicContact CG2-CZ 3.98Å
36	F	96.7	Very high	93.8	Very high	116 Å²	116	81.3 Å²	81.3	51%	0.509	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130	130.8	-178.4	-64.4	-90.7	0	0	0	110	Y28 E29 R30 N34	Y28-F36 HydrophobicContact CD1-CB 4.39Å; E29-F36 CarbonylContact O-C 3.59Å; E29-F36 WeakPolarHBondContact O-CA 3.32Å; R30-F36 HydrophobicContact CB-CD1 3.98Å; R30-F36 HydrophobicContact CB-CE1 3.8Å; R30-F36 HydrophobicContact CG-CD1 4.37Å; R30-F36 HydrophobicContact CG-CE1 3.98Å; R30-F36 HydrophobicContact CG-CZ 4.28Å; N34-F36 WeakPolarHBondContact O-CD2 3.35Å
37	F	95.8	Very high	93.8	Very high	106 Å²	106	80.3 Å²	80.3	47%	0.465	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	139.5	175.8	-71.4	-67.9	0	0	0	111.3	Y28 E29 F31 I35 V39	Y28-F37 CarbonylContact C-O 3.52Å; Y28-F37 VanDerWaalsContact CA-O 3.23Å; Y28-F37 WeakPolarHBondContact CA-O 3.15Å; E29-F37 PolarHBondContact N-O 3.02Å; E29-F37 PolarHBondContact O-N 3.3Å; F31-F37 HydrophobicContact CB-CD2 3.6Å; F31-F37 HydrophobicContact CB-CE2 3.56Å; F31-F37 AromaticContact CD1-CE2 3.85Å; F31-F37 HydrophobicContact CD1-CE2 3.85Å; F31-F37 HydrophobicContact CD2-CD2 4.14Å; F31-F37 HydrophobicContact CD2-CE2 4.03Å; F31-F37 AromaticContact CG-CD2 3.9Å; F31-F37 HydrophobicContact CG-CD2 3.9Å; F31-F37 AromaticContact CG-CE2 3.55Å; F31-F37 HydrophobicContact CG-CE2 3.55Å; I35-F37 HydrophobicContact CG2-CD2 4.47Å; I35-F37 HydrophobicContact CG2-CE2 3.87Å; I35-F37 HydrophobicContact CG2-CZ 3.98Å; F37-V39 PolarHBondContact O-N 3.5Å
38	P	95.5	Very high	93.8	Very high	94 Å²	94	79.3 Å²	79.3	61%	0.61	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.3	136	173.8	29	-33.8	0	0	0	109.7	I27 Y28	I27-P38 WeakPolarHBondContact O-CA 3.44Å; Y28-P38 HydrophobicContact CD1-CB 4.25Å; Y28-P38 HydrophobicContact CE1-CB 4.06Å
39	V	94.8	Very high	93.7	Very high	35 Å²	35	78.8 Å²	78.8	21%	0.212	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	151.2	176	-64.9	0	0	0	0	109.9	I27 E29 F37 A44	I27-V39 HydrophobicContact CB-CG2 4.23Å; I27-V39 HydrophobicContact CG2-CG2 3.67Å; I27-V39 PolarHBondContact O-N 3.39Å; E29-V39 HydrophobicContact CB-CG1 3.77Å; E29-V39 HydrophobicContact CB-CG2 4.23Å; F37-V39 PolarHBondContact O-N 3.5Å; V39-A44 HydrophobicContact CG2-CB 4.14Å
40	S	93.5	Very high	93.8	Very high	54 Å²	54	80.6 Å²	80.6	38%	0.378	42%	0.422	S	S	.	.			trans	-70.2	146.1	173.8	76.5	0	0	0	0	110	T42 N43 A44	S40-T42 PolarHBondContact O-N 3.11Å; S40-N43 PolarHBondContact O-N 2.94Å; S40-N43 VanDerWaalsContact O-N 3.1Å; S40-N43 VanDerWaalsContact OG-CB 3.28Å; S40-N43 WeakPolarHBondContact OG-CB 3.38Å; S40-N43 PolarHBondContact OG-N 3.27Å; S40-N43 PolarHBondContact OG-ND2 3.24Å; S40-N43 PolarHBondContact OG-OD1 3.42Å; S40-A44 PolarHBondContact O-N 2.92Å
41	R	91.8	Very high	93.7	Very high	42 Å²	42	77.3 Å²	77.3	16%	0.158	41%	0.412	C	S	.	.	H	α-helix	trans	-54.1	-41.7	174.4	-174.9	174.2	-75.2	95.1	5.3	111.7	T21 V22 F23 Q25 I27 N43 A44 L45	T21-R41 PolarHBondContact OG1-NE 2.96Å; T21-R41 PolarHBondContact OG1-NH2 3.47Å; V22-R41 PolarHBondContact O-NH2 3.48Å; F23-R41 PolarHBondContact O-NH1 3.27Å; F23-R41 PolarHBondContact O-NH2 2.98Å; Q25-R41 PolarHBondContact O-NH2 2.96Å; I27-R41 VanDerWaalsContact CD1-CA 3.49Å; I27-R41 HydrophobicContact CD1-CB 3.51Å; I27-R41 HydrophobicContact CD1-CG 3.72Å; R41-N43 PolarHBondContact O-N 2.95Å; R41-A44 PolarHBondContact O-N 3.05Å; R41-L45 HydrophobicContact CG-CD1 3.98Å; R41-L45 HydrophobicContact CG-CG 4.42Å; R41-L45 WeakPolarHBondContact O-CB 3.46Å; R41-L45 WeakPolarHBondContact O-CG 3.28Å; R41-L45 PolarHBondContact O-N 3.43Å
42	T	92.8	Very high	93.7	Very high	93 Å²	93	70.7 Å²	70.7	57%	0.571	38%	0.384	S	S	*	.	H	α-helix	trans	-58.7	-48.2	177.1	-50.1	0	0	0	0	111.3	S40 L45 I46	S40-T42 PolarHBondContact O-N 3.11Å; T42-L45 PolarHBondContact O-N 3.23Å; T42-I46 HydrophobicContact CG2-CD1 3.95Å; T42-I46 VanDerWaalsContact O-CG1 3.27Å; T42-I46 WeakPolarHBondContact O-CG1 3.33Å; T42-I46 PolarHBondContact O-N 3.46Å
43	N	94	Very high	93.8	Very high	89 Å²	89	73.7 Å²	73.7	48%	0.476	39%	0.39	S	S	.	.	H	α-helix	trans	-65.7	-43.3	179.7	-69.2	5.5	0	0	0	111.2	S40 R41 L45 I46 Q47	S40-N43 PolarHBondContact O-N 2.94Å; S40-N43 VanDerWaalsContact O-N 3.1Å; S40-N43 VanDerWaalsContact OG-CB 3.28Å; S40-N43 WeakPolarHBondContact OG-CB 3.38Å; S40-N43 PolarHBondContact OG-N 3.27Å; S40-N43 PolarHBondContact OG-ND2 3.24Å; S40-N43 PolarHBondContact OG-OD1 3.42Å; R41-N43 PolarHBondContact O-N 2.95Å; N43-L45 VanDerWaalsContact C-N 3.33Å; N43-L45 PolarHBondContact O-N 3.35Å; N43-I46 PolarHBondContact O-N 2.95Å; N43-Q47 WeakPolarHBondContact O-CB 3.46Å; N43-Q47 WeakPolarHBondContact O-CG 3.3Å; N43-Q47 PolarHBondContact O-N 3.46Å
44	A	93.7	Very high	93.7	Very high	9 Å²	9	77.7 Å²	77.7	7%	0.074	39%	0.393	C	S	.	.	H	α-helix	trans	-59.7	-42.5	177	0	0	0	0	0	112	L18 I27 V39 S40 R41 C48	L18-A44 HydrophobicContact CD1-CB 3.94Å; L18-A44 HydrophobicContact CD2-CB 4.25Å; I27-A44 HydrophobicContact CG2-CB 4.07Å; V39-A44 HydrophobicContact CG2-CB 4.14Å; S40-A44 PolarHBondContact O-N 2.92Å; R41-A44 PolarHBondContact O-N 3.05Å; A44-C48 WeakPolarHBondContact O-CB 3.46Å; A44-C48 PolarHBondContact O-N 3.05Å
45	L	93.4	Very high	93.5	Very high	36 Å²	36	71.9 Å²	71.9	19%	0.188	36%	0.362	C	S	.	.	H	α-helix	trans	-67.9	-39	176.5	-73.5	172	0	0	0	112.7	Q15 L18 Q19 R41 T42 N43 C48 K49	Q15-L45 HydrophobicContact CG-CD2 4.36Å; L18-L45 HydrophobicContact CB-CD2 3.68Å; L18-L45 HydrophobicContact CB-CG 4.34Å; L18-L45 HydrophobicContact CD1-CD2 4.31Å; Q19-L45 HydrophobicContact CG-CD2 3.87Å; R41-L45 HydrophobicContact CG-CD1 3.98Å; R41-L45 HydrophobicContact CG-CG 4.42Å; R41-L45 WeakPolarHBondContact O-CB 3.46Å; R41-L45 WeakPolarHBondContact O-CG 3.28Å; R41-L45 PolarHBondContact O-N 3.43Å; T42-L45 PolarHBondContact O-N 3.23Å; N43-L45 VanDerWaalsContact C-N 3.33Å; N43-L45 PolarHBondContact O-N 3.35Å; L45-C48 PolarHBondContact O-N 3.18Å; L45-K49 WeakPolarHBondContact O-CG 3.44Å; L45-K49 PolarHBondContact O-N 2.91Å
46	I	94.2	Very high	93.1	Very high	81 Å²	81	69.7 Å²	69.7	42%	0.415	36%	0.355	S	S	.	.	H	α-helix	trans	-62.9	-52	175.6	-70.9	166.4	0	0	0	109.9	T42 N43 C48 K49 E50	T42-I46 HydrophobicContact CG2-CD1 3.95Å; T42-I46 VanDerWaalsContact O-CG1 3.27Å; T42-I46 WeakPolarHBondContact O-CG1 3.33Å; T42-I46 PolarHBondContact O-N 3.46Å; N43-I46 PolarHBondContact O-N 2.95Å; I46-C48 VanDerWaalsContact C-N 3.26Å; I46-C48 PolarHBondContact O-N 2.98Å; I46-K49 PolarHBondContact O-N 3.29Å; I46-K49 VanDerWaalsContact O-N 3.14Å; I46-E50 HydrophobicContact CG2-CG 4.48Å; I46-E50 WeakPolarHBondContact O-CG 3.27Å; I46-E50 PolarHBondContact O-N 3.24Å
47	Q	93.2	Very high	92.7	Very high	61 Å²	61	69.7 Å²	69.7	29%	0.285	35%	0.354	S	S	.	.	H	α-helix	trans	-58.1	-40	177.6	-71.3	176.8	-3.6	0	0	111.9	E29 N43 E50 K51	E29-Q47 PolarHBondContact OE1-OE1 2.97Å; E29-Q47 VanDerWaalsContact OE1-OE1 3.13Å; E29-Q47 PolarHBondContact OE2-NE2 3.47Å; E29-Q47 PolarHBondContact OE2-OE1 3.04Å; N43-Q47 WeakPolarHBondContact O-CB 3.46Å; N43-Q47 WeakPolarHBondContact O-CG 3.3Å; N43-Q47 PolarHBondContact O-N 3.46Å; Q47-E50 PolarHBondContact O-N 3.44Å; Q47-K51 WeakPolarHBondContact O-CB 3.5Å; Q47-K51 VanDerWaalsContact O-CG 3.32Å; Q47-K51 WeakPolarHBondContact O-CG 3.32Å; Q47-K51 PolarHBondContact O-N 3.46Å
48	C	93.1	Very high	92.1	Very high	2 Å²	2	68.3 Å²	68.3	1%	0.014	35%	0.352	C	S	.	.	H	α-helix	trans	-61.8	-46.4	177.1	-178.2	0	0	0	0	111.8	Q11 Q15 A44 L45 I46 E50 K51 L52	Q11-C48 PolarHBondContact NE2-SG 2.96Å; Q11-C48 PolarHBondContact O-SG 3.36Å; Q11-C48 VanDerWaalsContact O-SG 3.42Å; Q15-C48 WeakPolarHBondContact CB-SG 3.3Å; A44-C48 WeakPolarHBondContact O-CB 3.46Å; A44-C48 PolarHBondContact O-N 3.05Å; L45-C48 PolarHBondContact O-N 3.18Å; I46-C48 VanDerWaalsContact C-N 3.26Å; I46-C48 PolarHBondContact O-N 2.98Å; C48-E50 PolarHBondContact O-N 2.92Å; C48-K51 PolarHBondContact O-N 2.96Å; C48-L52 PolarHBondContact O-N 3.33Å
49	K	93.1	Very high	91.3	Very high	122 Å²	122	65.4 Å²	65.4	53%	0.53	33%	0.334	S	S	.	.	H	α-helix	trans	-62	-42.5	175.1	-74.2	177.5	-180	-174.8	0	112.3	Q15 L45 I46 K51 L52 L53	Q15-K49 VanDerWaalsContact NE2-CG 3.27Å; L45-K49 WeakPolarHBondContact O-CG 3.44Å; L45-K49 PolarHBondContact O-N 2.91Å; I46-K49 PolarHBondContact O-N 3.29Å; I46-K49 VanDerWaalsContact O-N 3.14Å; K49-K51 VanDerWaalsContact C-N 3.35Å; K49-L52 PolarHBondContact O-N 3.46Å; K49-L53 WeakPolarHBondContact O-CB 3.32Å; K49-L53 PolarHBondContact O-N 3.49Å
50	E	94.3	Very high	90.3	Very high	104 Å²	104	67.1 Å²	67.1	49%	0.486	35%	0.347	S	S	.	.	H	α-helix	trans	-63.2	-40.9	176.5	-72	178.9	177.7	0	0	112	I46 Q47 C48 L53 K54	I46-E50 HydrophobicContact CG2-CG 4.48Å; I46-E50 WeakPolarHBondContact O-CG 3.27Å; I46-E50 PolarHBondContact O-N 3.24Å; Q47-E50 PolarHBondContact O-N 3.44Å; C48-E50 PolarHBondContact O-N 2.92Å; E50-L53 PolarHBondContact O-N 3.1Å; E50-K54 WeakPolarHBondContact O-CG 3.5Å; E50-K54 PolarHBondContact O-N 2.95Å
51	K	92.4	Very high	89.3	Confident	90 Å²	90	70.3 Å²	70.3	39%	0.391	36%	0.357	S	S	.	.	H	α-helix	trans	-62.6	-46.3	174.8	-75.6	171.8	-179.3	169.4	0	111.1	Q11 E29 Q47 C48 K49 L53 K54 L55	Q11-K51 HydrophobicContact CG-CB 4.08Å; E29-K51 IonicContact OE1-NZ 3.83Å; Q47-K51 WeakPolarHBondContact O-CB 3.5Å; Q47-K51 VanDerWaalsContact O-CG 3.32Å; Q47-K51 WeakPolarHBondContact O-CG 3.32Å; Q47-K51 PolarHBondContact O-N 3.46Å; C48-K51 PolarHBondContact O-N 2.96Å; K49-K51 VanDerWaalsContact C-N 3.35Å; K51-L53 VanDerWaalsContact C-N 3.34Å; K51-L53 PolarHBondContact O-N 3.48Å; K51-K54 PolarHBondContact O-N 3.19Å; K51-L55 VanDerWaalsContact O-CG 3.32Å; K51-L55 WeakPolarHBondContact O-CG 3.45Å; K51-L55 PolarHBondContact O-N 3.27Å
52	L	91.9	Very high	87.8	Confident	23 Å²	23	74.1 Å²	74.1	12%	0.12	38%	0.379	C	S	.	.	H	α-helix	trans	-60.1	-42.3	175.1	-76.1	169.9	0	0	0	112.5	I8 Q11 E12 C48 K49 K54 L55 S56	I8-L52 HydrophobicContact CG2-CD2 4.27Å; Q11-L52 HydrophobicContact CB-CD2 3.63Å; Q11-L52 HydrophobicContact CB-CG 4.1Å; Q11-L52 HydrophobicContact CG-CD1 4.39Å; Q11-L52 HydrophobicContact CG-CD2 3.71Å; Q11-L52 HydrophobicContact CG-CG 3.58Å; E12-L52 HydrophobicContact CG-CD1 4.31Å; E12-L52 HydrophobicContact CG-CD2 3.73Å; C48-L52 PolarHBondContact O-N 3.33Å; K49-L52 PolarHBondContact O-N 3.46Å; L52-K54 VanDerWaalsContact C-N 3.33Å; L52-K54 PolarHBondContact O-N 3.23Å; L52-L55 PolarHBondContact O-N 2.88Å; L52-S56 WeakPolarHBondContact O-CB 3.33Å; L52-S56 PolarHBondContact O-N 3.06Å; L52-S56 PolarHBondContact O-OG 3.23Å
53	L	91.8	Very high	86.2	Confident	98 Å²	98	77 Å²	77	51%	0.513	38%	0.384	S	S	.	.	H	α-helix	trans	-62.7	-40.9	177.4	-170.4	70.1	0	0	0	111.6	K49 E50 K51 S56 K57	K49-L53 WeakPolarHBondContact O-CB 3.32Å; K49-L53 PolarHBondContact O-N 3.49Å; E50-L53 PolarHBondContact O-N 3.1Å; K51-L53 VanDerWaalsContact C-N 3.34Å; K51-L53 PolarHBondContact O-N 3.48Å; L53-S56 WeakPolarHBondContact CA-OG 3.43Å; L53-S56 PolarHBondContact O-OG 3.13Å; L53-K57 WeakPolarHBondContact O-CB 3.19Å; L53-K57 VanDerWaalsContact O-CG 3.27Å; L53-K57 WeakPolarHBondContact O-CG 3.28Å; L53-K57 PolarHBondContact O-N 2.86Å
54	K	91.7	Very high	84.5	Confident	137 Å²	137	77.9 Å²	77.9	60%	0.596	39%	0.393	S	S	*	.	H	α-helix	trans	-66	-45.2	176	-71	175.2	-174.6	179.3	0	111.7	E50 K51 L52 K57 N58	E50-K54 WeakPolarHBondContact O-CG 3.5Å; E50-K54 PolarHBondContact O-N 2.95Å; K51-K54 PolarHBondContact O-N 3.19Å; L52-K54 VanDerWaalsContact C-N 3.33Å; L52-K54 PolarHBondContact O-N 3.23Å; K54-K57 PolarHBondContact O-N 3.04Å; K54-N58 VanDerWaalsContact O-CG 3.25Å; K54-N58 PolarHBondContact O-N 3.41Å; K54-N58 PolarHBondContact O-OD1 3.05Å
55	L	90.3	Very high	82.7	Confident	23 Å²	23	84.5 Å²	84.5	12%	0.12	43%	0.427	C	S	.	.	H	α-helix	trans	-65.7	-41	179.8	-68.3	170.7	0	0	0	112.3	L4 Q7 I8 Q11 K51 L52 N58 S59	L4-L55 HydrophobicContact CD1-CB 4.33Å; L4-L55 HydrophobicContact CD1-CD2 3.68Å; Q7-L55 HydrophobicContact CB-CD1 4.07Å; Q7-L55 HydrophobicContact CB-CD2 4.08Å; Q7-L55 VanDerWaalsContact OE1-CD2 3.31Å; I8-L55 HydrophobicContact CD1-CB 4.35Å; I8-L55 HydrophobicContact CG1-CB 3.68Å; I8-L55 HydrophobicContact CG1-CD1 4.34Å; Q11-L55 HydrophobicContact CB-CD1 4.31Å; K51-L55 VanDerWaalsContact O-CG 3.32Å; K51-L55 WeakPolarHBondContact O-CG 3.45Å; K51-L55 PolarHBondContact O-N 3.27Å; L52-L55 PolarHBondContact O-N 2.88Å; L55-N58 PolarHBondContact O-N 3.37Å; L55-S59 WeakPolarHBondContact O-CB 3.41Å; L55-S59 PolarHBondContact O-N 3.27Å
56	S	87	Confident	80.6	Confident	48 Å²	48	91.7 Å²	91.7	34%	0.336	46%	0.456	S	S	.	.	H	α-helix	trans	-68.5	-35.8	176.9	54.1	0	0	0	0	113	L52 L53 S59 S60	L52-S56 WeakPolarHBondContact O-CB 3.33Å; L52-S56 PolarHBondContact O-N 3.06Å; L52-S56 PolarHBondContact O-OG 3.23Å; L53-S56 WeakPolarHBondContact CA-OG 3.43Å; L53-S56 PolarHBondContact O-OG 3.13Å; S56-S59 WeakPolarHBondContact O-CB 3.3Å; S56-S59 PolarHBondContact O-N 2.94Å; S56-S60 PolarHBondContact O-N 2.87Å; S56-S60 PolarHBondContact O-OG 3.48Å
57	K	88.3	Confident	78.2	Confident	116 Å²	116	98.3 Å²	98.3	50%	0.504	49%	0.493	S	S	.	.	H	α-helix	trans	-62	-50	170.6	-79	178.9	176.2	-170.5	0	111.7	L53 K54 S59 S60 E61	L53-K57 WeakPolarHBondContact O-CB 3.19Å; L53-K57 VanDerWaalsContact O-CG 3.27Å; L53-K57 WeakPolarHBondContact O-CG 3.28Å; L53-K57 PolarHBondContact O-N 2.86Å; K54-K57 PolarHBondContact O-N 3.04Å; K57-S59 PolarHBondContact O-N 3.41Å; K57-S60 WeakPolarHBondContact O-CA 3.04Å; K57-S60 WeakPolarHBondContact O-CB 3.42Å; K57-S60 PolarHBondContact O-N 3.38Å; K57-E61 WeakPolarHBondContact O-CG 3.36Å; K57-E61 PolarHBondContact O-N 2.86Å
58	N	82.8	Confident	77.5	Confident	77 Å²	77	100.2 Å²	100.2	41%	0.412	50%	0.503	S	S	.	.	H	α-helix	trans	-58.1	-36	175.9	-66.1	-3.2	0	0	0	111.7	L4 K54 L55 S60 L62	L4-N58 HydrophobicContact CD1-CB 4.47Å; L4-N58 HydrophobicContact CD2-CB 4.34Å; K54-N58 VanDerWaalsContact O-CG 3.25Å; K54-N58 PolarHBondContact O-N 3.41Å; K54-N58 PolarHBondContact O-OD1 3.05Å; L55-N58 PolarHBondContact O-N 3.37Å; N58-S60 VanDerWaalsContact C-N 3.32Å; N58-L62 WeakPolarHBondContact O-CB 3.47Å; N58-L62 WeakPolarHBondContact O-CD1 3.34Å; N58-L62 PolarHBondContact O-N 2.96Å
59	S	78.8	Confident	76.7	Confident	33 Å²	33	105.4 Å²	105.4	23%	0.231	53%	0.529	C	S	.	.	H	α-helix	trans	-67.8	-33.2	176.8	-170.9	0	0	0	0	112.5	L4 L55 S56 K57 K63	L4-S59 VanDerWaalsContact CD2-CB 3.49Å; L55-S59 WeakPolarHBondContact O-CB 3.41Å; L55-S59 PolarHBondContact O-N 3.27Å; S56-S59 WeakPolarHBondContact O-CB 3.3Å; S56-S59 PolarHBondContact O-N 2.94Å; K57-S59 PolarHBondContact O-N 3.41Å; S59-K63 WeakPolarHBondContact O-CG 3.44Å
60	S	74	Confident	75.8	Confident	71 Å²	71	104.4 Å²	104.4	50%	0.497	53%	0.529	S	S	.	.	H	α-helix	trans	-76.4	-42.5	177.2	-54.4	0	0	0	0	111.2	S56 K57 N58 L62 K63 T64	S56-S60 PolarHBondContact O-N 2.87Å; S56-S60 PolarHBondContact O-OG 3.48Å; K57-S60 WeakPolarHBondContact O-CA 3.04Å; K57-S60 WeakPolarHBondContact O-CB 3.42Å; K57-S60 PolarHBondContact O-N 3.38Å; N58-S60 VanDerWaalsContact C-N 3.32Å; S60-L62 VanDerWaalsContact C-N 3.32Å; S60-L62 PolarHBondContact O-N 2.9Å; S60-K63 WeakPolarHBondContact O-CB 3.23Å; S60-K63 PolarHBondContact O-N 2.91Å; S60-T64 PolarHBondContact O-N 3.17Å; S60-T64 PolarHBondContact O-OG1 2.82Å
61	E	71.8	Confident	74.7	Confident	122 Å²	122	104.5 Å²	104.5	57%	0.57	53%	0.532	S	S	*	.	H	α-helix	trans	-63	-37.7	176.6	-70.8	171.1	-168.7	0	0	111.9	K57 K63 T64	K57-E61 WeakPolarHBondContact O-CG 3.36Å; K57-E61 PolarHBondContact O-N 2.86Å; E61-K63 PolarHBondContact O-N 2.89Å; E61-T64 WeakPolarHBondContact CA-OG1 3.4Å; E61-T64 PolarHBondContact O-N 2.96Å; E61-T64 PolarHBondContact O-OG1 2.74Å
62	L	62	Low	73.6	Confident	121 Å²	121	105.4 Å²	105.4	63%	0.634	54%	0.54	S	S	*	.	H	α-helix	trans	-66.3	-18.6	173.7	-89	154.8	0	0	0	114	L4 N58 S60	L4-L62 HydrophobicContact CD2-CD1 3.94Å; N58-L62 WeakPolarHBondContact O-CB 3.47Å; N58-L62 WeakPolarHBondContact O-CD1 3.34Å; N58-L62 PolarHBondContact O-N 2.96Å; S60-L62 VanDerWaalsContact C-N 3.32Å; S60-L62 PolarHBondContact O-N 2.9Å
63	K	58.8	Low	72.3	Confident	154 Å²	154	110.9 Å²	110.9	67%	0.67	57%	0.568	S	S	*	*	H	α-helix	trans	-89.2	-22.2	175.7	-71	177.5	-176.3	-178.1	0	112.7	S59 S60 E61	S59-K63 WeakPolarHBondContact O-CG 3.44Å; S60-K63 WeakPolarHBondContact O-CB 3.23Å; S60-K63 PolarHBondContact O-N 2.91Å; E61-K63 PolarHBondContact O-N 2.89Å
64	T	57.6	Low	71	Confident	108 Å²	108	111.8 Å²	111.8	66%	0.663	57%	0.572	S	S	*	*	H	α-helix	trans	-87.9	-9.7	-177.6	46.9	0	0	0	0	114.4	S60 E61 K66	S60-T64 PolarHBondContact O-N 3.17Å; S60-T64 PolarHBondContact O-OG1 2.82Å; E61-T64 WeakPolarHBondContact CA-OG1 3.4Å; E61-T64 PolarHBondContact O-N 2.96Å; E61-T64 PolarHBondContact O-OG1 2.74Å; T64-K66 VanDerWaalsContact C-N 3.34Å
65	D	55.7	Low	69.4	Low	147 Å²	147	109.8 Å²	109.8	79%	0.786	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.6	17.2	179.7	-148.3	-106.7	0	0	0	113.2
66	K	50.9	Low	67.6	Low	187 Å²	187	117.1 Å²	117.1	81%	0.813	61%	0.608	S	S	*	*			trans	-128.3	8.1	-175.7	-87.4	-166.8	177.1	-177.8	0	116.3	T64	T64-K66 VanDerWaalsContact C-N 3.34Å
67	D	43.7	Very low	65.9	Low	221 Å²	221	123.4 Å²	123.4	100%	1.182	63%	0.633	S	S	*	*			trans	-110.2	0	167.3	-75.2	-40.2	0	0	0	110.1

Retrieved 67 of 67 residues in 42.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).