A0A5K4F523_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F523, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 68 aa.

						>A0A5K4F523_SCHMA|A0A5K4F523
MNCKQTIFTDSNHKYHHYIRQISTIQTNKRKLTTGEYGIAFVLDAYIVDINVYNVNVISNILIISQFA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	34.3	Very low	42.5	Very low	235 Å²	235	144.1 Å²	144.1	100%	1.158	76%	0.758	S	S	*	*				0	111.4	0	-63	172.2	175.3	0	0	105.9
2	N	37.4	Very low	43.2	Very low	155 Å²	155	143 Å²	143	83%	0.829	75%	0.753	S	S	*	*			cis	-146.8	120.2	19.8	-79.9	-22	0	0	0	108.5
3	C	35.1	Very low	43.4	Very low	113 Å²	113	143 Å²	143	76%	0.764	75%	0.746	S	S	*	*			trans	-87.9	119.2	163.2	-178.3	0	0	0	0	107.1	Q5	C3-Q5 VanDerWaalsContact C-N 3.33Å; C3-Q5 PolarHBondContact O-N 3.11Å
4	K	47.7	Very low	43.8	Very low	194 Å²	194	142.5 Å²	142.5	84%	0.843	74%	0.735	S	S	*	*			trans	-74.1	90	168.1	-79	-176.6	175.7	-178.4	0	107.9	T6	K4-T6 PolarHBondContact O-N 3.45Å
5	Q	35	Very low	44.2	Very low	178 Å²	178	143.7 Å²	143.7	83%	0.832	73%	0.728	S	S	*	*			trans	-74.2	99.5	163.8	-83.1	176.2	-29.2	0	0	108.1	C3	C3-Q5 VanDerWaalsContact C-N 3.33Å; C3-Q5 PolarHBondContact O-N 3.11Å
6	T	42	Very low	44.7	Very low	97 Å²	97	143.3 Å²	143.3	60%	0.595	72%	0.722	S	S	*	*			trans	-103.8	105	171.1	-20.6	0	0	0	0	108.8	K4 F8	K4-T6 PolarHBondContact O-N 3.45Å; T6-F8 WeakPolarHBondContact O-CD2 3.47Å; T6-F8 PolarHBondContact O-N 3.29Å
7	I	45.4	Very low	45.1	Very low	143 Å²	143	141.7 Å²	141.7	73%	0.733	71%	0.711	S	S	*	*			trans	-12.5	89.4	156	-49.6	164.3	0	0	0	114
8	F	46.7	Very low	45.4	Very low	171 Å²	171	141.4 Å²	141.4	75%	0.75	70%	0.701	S	S	*	*			trans	-126.5	16.3	172.7	-87.1	-73.3	0	0	0	113.7	T6	T6-F8 WeakPolarHBondContact O-CD2 3.47Å; T6-F8 PolarHBondContact O-N 3.29Å
9	T	47.8	Very low	46.1	Very low	117 Å²	117	138.3 Å²	138.3	72%	0.718	69%	0.687	S	S	*	*	S	Bend	trans	-113.5	-5.4	-172.3	42	0	0	0	0	115.2
10	D	49	Very low	46.5	Very low	98 Å²	98	141.2 Å²	141.2	52%	0.524	69%	0.689	S	S	.	*	S	Bend	trans	-93.2	-26.8	-179.5	-112.9	-24.4	0	0	0	114.1	H13 K14	D10-H13 PolarHBondContact O-N 3.07Å; D10-K14 PolarHBondContact O-N 2.82Å
11	S	47	Very low	46.8	Very low	84 Å²	84	138.8 Å²	138.8	59%	0.587	68%	0.677	S	S	*	*	H	α-helix	trans	-69	-37.8	-177.1	-47.9	0	0	0	0	112.2	K14 Y15	S11-K14 PolarHBondContact O-N 3.37Å; S11-Y15 WeakPolarHBondContact O-CB 3.39Å; S11-Y15 PolarHBondContact O-N 3.37Å
12	N	50.6	Low	47.9	Very low	131 Å²	131	131.9 Å²	131.9	70%	0.701	64%	0.644	S	S	*	*	H	α-helix	trans	-70.2	-33.1	177.6	-90.4	9.6	0	0	0	112.8	Y15 H16	N12-Y15 PolarHBondContact O-N 3.13Å; N12-H16 PolarHBondContact O-N 3.16Å
13	H	46.1	Very low	48.6	Very low	143 Å²	143	127.6 Å²	127.6	66%	0.662	63%	0.626	S	S	*	*	H	α-helix	trans	-68.7	-40.3	175.3	-101.5	132.7	0	0	0	112	D10 Y15 H16 H17	D10-H13 PolarHBondContact O-N 3.07Å; H13-Y15 VanDerWaalsContact C-N 3.33Å; H13-H16 PolarHBondContact O-N 2.99Å; H13-H17 PolarHBondContact O-N 3.47Å; H13-H17 VanDerWaalsContact O-N 3.15Å
14	K	48.9	Very low	49.5	Very low	136 Å²	136	125.9 Å²	125.9	59%	0.591	61%	0.612	S	S	*	*	H	α-helix	trans	-62.6	-43.1	172.5	-69.3	180	-176.8	179.2	0	110.6	D10 S11 H16 H17 Y18	D10-K14 PolarHBondContact O-N 2.82Å; S11-K14 PolarHBondContact O-N 3.37Å; K14-H16 VanDerWaalsContact C-N 3.33Å; K14-H16 PolarHBondContact O-N 3.22Å; K14-H17 PolarHBondContact O-N 3.08Å; K14-Y18 VanDerWaalsContact O-CD2 3.29Å; K14-Y18 WeakPolarHBondContact O-CD2 3.43Å; K14-Y18 PolarHBondContact O-N 3.17Å
15	Y	50	Low	49.8	Very low	160 Å²	160	120.7 Å²	120.7	63%	0.627	59%	0.592	S	S	*	*	H	α-helix	trans	-59.2	-42.3	177.9	-157.9	-103.9	0	0	0	112.6	S11 N12 H13 H17 Y18 I19	S11-Y15 WeakPolarHBondContact O-CB 3.39Å; S11-Y15 PolarHBondContact O-N 3.37Å; N12-Y15 PolarHBondContact O-N 3.13Å; H13-Y15 VanDerWaalsContact C-N 3.33Å; Y15-H17 PolarHBondContact O-N 3.41Å; Y15-Y18 PolarHBondContact O-N 3.5Å; Y15-I19 HydrophobicContact CD1-CD1 3.57Å; Y15-I19 HydrophobicContact CD1-CG1 4.27Å; Y15-I19 HydrophobicContact CE1-CD1 3.56Å; Y15-I19 HydrophobicContact CE1-CG1 4.2Å; Y15-I19 WeakPolarHBondContact O-CG1 3.47Å; Y15-I19 PolarHBondContact O-N 2.78Å
16	H	52.1	Low	50.7	Low	137 Å²	137	118 Å²	118	63%	0.634	58%	0.58	S	S	*	*	H	α-helix	trans	-68.3	-36.4	179.5	-144.7	169.1	0	0	0	112.5	N12 H13 K14 R20	N12-H16 PolarHBondContact O-N 3.16Å; H13-H16 PolarHBondContact O-N 2.99Å; K14-H16 VanDerWaalsContact C-N 3.33Å; K14-H16 PolarHBondContact O-N 3.22Å; H16-R20 PolarHBondContact O-N 3.37Å
17	H	50.9	Low	51.2	Low	117 Å²	117	116.9 Å²	116.9	54%	0.542	57%	0.573	S	S	.	*	H	α-helix	trans	-66.1	-40.4	173.8	-167.4	-93.9	0	0	0	111.8	H13 K14 Y15 R20 Q21	H13-H17 PolarHBondContact O-N 3.47Å; H13-H17 VanDerWaalsContact O-N 3.15Å; K14-H17 PolarHBondContact O-N 3.08Å; Y15-H17 PolarHBondContact O-N 3.41Å; H17-R20 PolarHBondContact O-N 3.06Å; H17-Q21 PolarHBondContact CE1-NE2 3.39Å; H17-Q21 WeakPolarHBondContact O-CG 3.4Å; H17-Q21 PolarHBondContact O-N 3.48Å; H17-Q21 VanDerWaalsContact O-N 3.11Å
18	Y	52.2	Low	51.3	Low	136 Å²	136	113.7 Å²	113.7	53%	0.533	56%	0.557	S	S	.	*	H	α-helix	trans	-63.9	-43.9	175.9	-94	-81.6	0	0	0	112.6	K14 Y15 R20 Q21 I22	K14-Y18 VanDerWaalsContact O-CD2 3.29Å; K14-Y18 WeakPolarHBondContact O-CD2 3.43Å; K14-Y18 PolarHBondContact O-N 3.17Å; Y15-Y18 PolarHBondContact O-N 3.5Å; Y18-R20 VanDerWaalsContact C-N 3.28Å; Y18-R20 PolarHBondContact O-N 3.4Å; Y18-Q21 PolarHBondContact O-N 3.22Å; Y18-I22 WeakPolarHBondContact O-CG1 3.43Å; Y18-I22 PolarHBondContact O-N 3.07Å
19	I	57.6	Low	51.4	Low	83 Å²	83	108.4 Å²	108.4	43%	0.426	53%	0.534	S	S	.	.	H	α-helix	trans	-58.8	-41.7	176.6	-68.7	167.4	0	0	0	111	Y15 I22 S23	Y15-I19 HydrophobicContact CD1-CD1 3.57Å; Y15-I19 HydrophobicContact CD1-CG1 4.27Å; Y15-I19 HydrophobicContact CE1-CD1 3.56Å; Y15-I19 HydrophobicContact CE1-CG1 4.2Å; Y15-I19 WeakPolarHBondContact O-CG1 3.47Å; Y15-I19 PolarHBondContact O-N 2.78Å; I19-I22 PolarHBondContact O-N 3.19Å; I19-S23 PolarHBondContact O-N 2.87Å
20	R	54.7	Low	51.5	Low	196 Å²	196	112.7 Å²	112.7	74%	0.74	54%	0.537	S	S	*	.	H	α-helix	trans	-67	-37.3	-179.9	-156.3	174.2	-176.4	-173.7	0.7	112.3	H16 H17 Y18 T24	H16-R20 PolarHBondContact O-N 3.37Å; H17-R20 PolarHBondContact O-N 3.06Å; Y18-R20 VanDerWaalsContact C-N 3.28Å; Y18-R20 PolarHBondContact O-N 3.4Å; R20-T24 PolarHBondContact O-N 3.22Å; R20-T24 PolarHBondContact O-OG1 3.46Å
21	Q	52.4	Low	51.5	Low	91 Å²	91	115.3 Å²	115.3	43%	0.425	54%	0.544	S	S	.	.	H	α-helix	trans	-65.6	-42.8	172.9	-72.4	-175.7	-20	0	0	111.9	H17 Y18 S23 T24 I25	H17-Q21 PolarHBondContact CE1-NE2 3.39Å; H17-Q21 WeakPolarHBondContact O-CG 3.4Å; H17-Q21 PolarHBondContact O-N 3.48Å; H17-Q21 VanDerWaalsContact O-N 3.11Å; Y18-Q21 PolarHBondContact O-N 3.22Å; Q21-S23 PolarHBondContact O-N 3.37Å; Q21-T24 WeakPolarHBondContact O-CB 3.32Å; Q21-T24 PolarHBondContact O-N 2.88Å; Q21-I25 WeakPolarHBondContact O-CG1 3.45Å; Q21-I25 PolarHBondContact O-N 3.22Å
22	I	57.4	Low	51.6	Low	90 Å²	90	113.6 Å²	113.6	46%	0.462	53%	0.528	S	S	.	.	H	α-helix	trans	-62	-43.2	177.7	-66.5	166.1	0	0	0	111.3	Y18 I19 T24 I25 Q26	Y18-I22 WeakPolarHBondContact O-CG1 3.43Å; Y18-I22 PolarHBondContact O-N 3.07Å; I19-I22 PolarHBondContact O-N 3.19Å; I22-T24 VanDerWaalsContact C-N 3.29Å; I22-T24 PolarHBondContact O-N 3Å; I22-I25 PolarHBondContact O-N 3.33Å; I22-Q26 WeakPolarHBondContact O-CG 3.48Å; I22-Q26 PolarHBondContact O-N 3.33Å
23	S	52.8	Low	51.7	Low	64 Å²	64	111.3 Å²	111.3	45%	0.448	52%	0.519	S	S	.	.	H	α-helix	trans	-62	-37.5	176.6	179.2	0	0	0	0	112.4	I19 Q21 Q26 T27	I19-S23 PolarHBondContact O-N 2.87Å; Q21-S23 PolarHBondContact O-N 3.37Å; S23-Q26 PolarHBondContact O-N 3.11Å; S23-T27 PolarHBondContact O-N 3.41Å; S23-T27 VanDerWaalsContact O-N 3.08Å; S23-T27 PolarHBondContact O-OG1 3.3Å
24	T	52.9	Low	51.9	Low	77 Å²	77	110.2 Å²	110.2	47%	0.472	52%	0.522	S	S	.	.	H	α-helix	trans	-66.7	-42	176.4	-52.7	0	0	0	0	111.1	R20 Q21 I22 T27 N28	R20-T24 PolarHBondContact O-N 3.22Å; R20-T24 PolarHBondContact O-OG1 3.46Å; Q21-T24 WeakPolarHBondContact O-CB 3.32Å; Q21-T24 PolarHBondContact O-N 2.88Å; I22-T24 VanDerWaalsContact C-N 3.29Å; I22-T24 PolarHBondContact O-N 3Å; T24-T27 PolarHBondContact O-N 3.27Å; T24-N28 PolarHBondContact O-N 3.2Å; T24-N28 PolarHBondContact O-ND2 3.34Å
25	I	55.2	Low	52.1	Low	85 Å²	85	106.7 Å²	106.7	44%	0.436	52%	0.524	S	S	.	.	H	α-helix	trans	-65.2	-43.7	177.3	-66.4	163.7	0	0	0	111.2	Q21 I22 T27 N28 K29 I47	Q21-I25 WeakPolarHBondContact O-CG1 3.45Å; Q21-I25 PolarHBondContact O-N 3.22Å; I22-I25 PolarHBondContact O-N 3.33Å; I25-T27 VanDerWaalsContact C-N 3.31Å; I25-T27 PolarHBondContact O-N 3.01Å; I25-N28 PolarHBondContact O-N 2.98Å; I25-K29 PolarHBondContact O-N 2.95Å; I25-I47 HydrophobicContact CG2-CD1 3.97Å
26	Q	52	Low	52.1	Low	123 Å²	123	103.7 Å²	103.7	58%	0.575	52%	0.516	S	S	*	.	H	α-helix	trans	-62.9	-37.5	177.1	-73.4	-177.2	-14.3	0	0	112.6	I22 S23 N28 K29 R30	I22-Q26 WeakPolarHBondContact O-CG 3.48Å; I22-Q26 PolarHBondContact O-N 3.33Å; S23-Q26 PolarHBondContact O-N 3.11Å; Q26-N28 VanDerWaalsContact C-N 3.34Å; Q26-K29 PolarHBondContact O-N 3.23Å; Q26-R30 PolarHBondContact O-N 3.1Å
27	T	53	Low	51.8	Low	72 Å²	72	106.7 Å²	106.7	44%	0.442	52%	0.523	S	S	.	.	H	α-helix	trans	-66.9	-38.2	176.6	-52.7	0	0	0	0	111.2	S23 T24 I25 R30 K31	S23-T27 PolarHBondContact O-N 3.41Å; S23-T27 VanDerWaalsContact O-N 3.08Å; S23-T27 PolarHBondContact O-OG1 3.3Å; T24-T27 PolarHBondContact O-N 3.27Å; I25-T27 VanDerWaalsContact C-N 3.31Å; I25-T27 PolarHBondContact O-N 3.01Å; T27-R30 PolarHBondContact O-N 3.2Å; T27-K31 PolarHBondContact O-N 2.96Å
28	N	48.3	Very low	51.7	Low	77 Å²	77	103.9 Å²	103.9	41%	0.412	53%	0.526	S	S	.	.	H	α-helix	trans	-70.9	-35.8	175.2	-69.9	-22.8	0	0	0	112.3	T24 I25 Q26 R30 K31 L32	T24-N28 PolarHBondContact O-N 3.2Å; T24-N28 PolarHBondContact O-ND2 3.34Å; I25-N28 PolarHBondContact O-N 2.98Å; Q26-N28 VanDerWaalsContact C-N 3.34Å; N28-R30 VanDerWaalsContact C-N 3.33Å; N28-R30 PolarHBondContact O-N 3.39Å; N28-K31 PolarHBondContact O-N 3.29Å; N28-K31 VanDerWaalsContact O-N 3.11Å; N28-L32 WeakPolarHBondContact O-CD1 3.34Å; N28-L32 WeakPolarHBondContact O-CG 3.37Å; N28-L32 PolarHBondContact O-N 3.48Å
29	K	49.2	Very low	51.4	Low	60 Å²	60	101.4 Å²	101.4	26%	0.261	52%	0.521	S	S	.	.	H	α-helix	trans	-56.4	-45	172	-78.4	-163.5	178.2	-163.6	0	112.2	I25 Q26 K31 L32 T33 D44 I47	I25-K29 PolarHBondContact O-N 2.95Å; Q26-K29 PolarHBondContact O-N 3.23Å; K29-K31 PolarHBondContact O-N 3.23Å; K29-L32 PolarHBondContact O-N 3.37Å; K29-L32 VanDerWaalsContact O-N 3.16Å; K29-T33 WeakPolarHBondContact O-CG2 3.29Å; K29-T33 PolarHBondContact O-N 3.36Å; K29-T33 PolarHBondContact O-OG1 2.67Å; K29-D44 IonicContact NZ-OD1 2.67Å; K29-D44 PolarHBondContact NZ-OD1 3.47Å; K29-I47 HydrophobicContact CD-CD1 4.49Å; K29-I47 VanDerWaalsContact NZ-CD1 3.3Å
30	R	49.6	Very low	50.8	Low	207 Å²	207	98.7 Å²	98.7	78%	0.781	51%	0.511	S	S	*	.	H	α-helix	trans	-62.6	-29	177.8	-75.4	-173.1	178.6	176.9	0.5	113.4	Q26 T27 N28 T33	Q26-R30 PolarHBondContact O-N 3.1Å; T27-R30 PolarHBondContact O-N 3.2Å; N28-R30 VanDerWaalsContact C-N 3.33Å; N28-R30 PolarHBondContact O-N 3.39Å; R30-T33 WeakPolarHBondContact CA-OG1 3.48Å; R30-T33 PolarHBondContact O-OG1 3.15Å
31	K	49.4	Very low	50.2	Low	152 Å²	152	97.1 Å²	97.1	66%	0.661	51%	0.51	S	S	*	.	H	α-helix	trans	-78.7	-30	176.1	-70.9	-178	176.4	-178.6	0	112.8	T27 N28 K29 T34	T27-K31 PolarHBondContact O-N 2.96Å; N28-K31 PolarHBondContact O-N 3.29Å; N28-K31 VanDerWaalsContact O-N 3.11Å; K29-K31 PolarHBondContact O-N 3.23Å; K31-T34 PolarHBondContact O-OG1 3.12Å
32	L	48.7	Very low	50.1	Low	49 Å²	49	97.8 Å²	97.8	26%	0.257	52%	0.52	S	S	.	.	H	α-helix	trans	-80.4	-29	179.8	-72.4	157.2	0	0	0	112.7	N28 K29 T34 G35 E36 L43	N28-L32 WeakPolarHBondContact O-CD1 3.34Å; N28-L32 WeakPolarHBondContact O-CG 3.37Å; N28-L32 PolarHBondContact O-N 3.48Å; K29-L32 PolarHBondContact O-N 3.37Å; K29-L32 VanDerWaalsContact O-N 3.16Å; L32-T34 PolarHBondContact O-N 3.43Å; L32-T34 VanDerWaalsContact O-N 3.13Å; L32-G35 PolarHBondContact O-N 3.37Å; L32-E36 WeakPolarHBondContact CD2-OE2 3.35Å; L32-L43 HydrophobicContact CD1-CD1 3.72Å
33	T	51.2	Low	49.6	Very low	83 Å²	83	96.6 Å²	96.6	51%	0.509	51%	0.514	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.2	-9.3	-179	43.3	0	0	0	0	115.4	K29 R30	K29-T33 WeakPolarHBondContact O-CG2 3.29Å; K29-T33 PolarHBondContact O-N 3.36Å; K29-T33 PolarHBondContact O-OG1 2.67Å; R30-T33 WeakPolarHBondContact CA-OG1 3.48Å; R30-T33 PolarHBondContact O-OG1 3.15Å
34	T	52	Low	49.4	Very low	120 Å²	120	97.3 Å²	97.3	74%	0.736	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	-109	2.8	-177.2	46.9	0	0	0	0	114.7	K31 L32	K31-T34 PolarHBondContact O-OG1 3.12Å; L32-T34 PolarHBondContact O-N 3.43Å; L32-T34 VanDerWaalsContact O-N 3.13Å
35	G	52.5	Low	49.1	Very low	61 Å²	61	96.3 Å²	96.3	63%	0.629	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-145.6	-18.2	-173.9	0	0	0	0	0	117.9	L32	L32-G35 PolarHBondContact O-N 3.37Å
36	E	50.7	Low	48.9	Very low	98 Å²	98	99.8 Å²	99.8	46%	0.458	52%	0.521	S	S	.	.			trans	-142.8	74.6	-167.4	-66.1	179.7	148.1	0	0	111.6	L32 G38 I39	L32-E36 WeakPolarHBondContact CD2-OE2 3.35Å; E36-G38 PolarHBondContact O-N 3.03Å; E36-I39 HydrophobicContact CB-CD1 4.4Å; E36-I39 PolarHBondContact O-N 2.99Å
37	Y	45	Very low	49	Very low	199 Å²	199	95.8 Å²	95.8	78%	0.78	50%	0.503	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.5	-1.6	178.9	-81.9	-86.5	0	0	0	115.1
38	G	47.9	Very low	48.9	Very low	59 Å²	59	96.5 Å²	96.5	61%	0.608	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-98.6	-26.2	176.4	0	0	0	0	0	115.8	E36	E36-G38 PolarHBondContact O-N 3.03Å
39	I	47	Very low	49	Very low	84 Å²	84	97.3 Å²	97.3	43%	0.431	51%	0.512	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.5	-24.4	-171.2	-62.1	169.1	0	0	0	111.5	E36 F41 V42 L43	E36-I39 HydrophobicContact CB-CD1 4.4Å; E36-I39 PolarHBondContact O-N 2.99Å; I39-F41 VanDerWaalsContact C-N 3.33Å; I39-F41 PolarHBondContact O-N 3.35Å; I39-V42 PolarHBondContact O-N 3.05Å; I39-L43 HydrophobicContact CG2-CD1 4.08Å; I39-L43 PolarHBondContact O-N 3.33Å
40	A	43.9	Very low	49.3	Very low	26 Å²	26	98.4 Å²	98.4	22%	0.215	52%	0.52	C	S	.	.	H	α-helix	trans	-61.4	-35.7	-179.4	0	0	0	0	0	113.6	V42 L43 D44	A40-V42 PolarHBondContact O-N 3.49Å; A40-L43 PolarHBondContact O-N 3.21Å; A40-D44 PolarHBondContact O-N 3.23Å; A40-D44 VanDerWaalsContact O-N 3.1Å
41	F	43.7	Very low	49.3	Very low	162 Å²	162	92.8 Å²	92.8	71%	0.711	51%	0.505	S	S	*	.	H	α-helix	trans	-67.2	-35.5	-179.8	-78.1	-81.7	0	0	0	113.3	I39 A45	I39-F41 VanDerWaalsContact C-N 3.33Å; I39-F41 PolarHBondContact O-N 3.35Å; F41-A45 PolarHBondContact O-N 3.42Å
42	V	49.3	Very low	49.5	Very low	105 Å²	105	89.7 Å²	89.7	64%	0.636	50%	0.499	S	S	*	.	H	α-helix	trans	-72.8	-36.6	-179.9	-177.2	0	0	0	0	110.8	I39 A40 Y46	I39-V42 PolarHBondContact O-N 3.05Å; A40-V42 PolarHBondContact O-N 3.49Å; V42-Y46 WeakPolarHBondContact O-CB 3.38Å; V42-Y46 PolarHBondContact O-N 3Å; V42-Y46 VanDerWaalsContact O-N 3.12Å
43	L	48	Very low	49.7	Very low	65 Å²	65	95.7 Å²	95.7	34%	0.34	52%	0.519	S	S	.	.	H	α-helix	trans	-68.9	-38.1	176.6	-77.8	161.2	0	0	0	112.4	L32 I39 A40 Y46 I47	L32-L43 HydrophobicContact CD1-CD1 3.72Å; I39-L43 HydrophobicContact CG2-CD1 4.08Å; I39-L43 PolarHBondContact O-N 3.33Å; A40-L43 PolarHBondContact O-N 3.21Å; L43-Y46 PolarHBondContact O-N 2.99Å; L43-I47 WeakPolarHBondContact O-CB 3.3Å; L43-I47 WeakPolarHBondContact O-CD1 3.47Å; L43-I47 WeakPolarHBondContact O-CG1 3.28Å; L43-I47 PolarHBondContact O-N 3.18Å
44	D	47.4	Very low	49.6	Very low	80 Å²	80	95.5 Å²	95.5	43%	0.428	52%	0.515	S	S	.	.	H	α-helix	trans	-67.4	-40.8	177	-80.3	-22.7	0	0	0	112	K29 A40 I47 V48	K29-D44 IonicContact NZ-OD1 2.67Å; K29-D44 PolarHBondContact NZ-OD1 3.47Å; A40-D44 PolarHBondContact O-N 3.23Å; A40-D44 VanDerWaalsContact O-N 3.1Å; D44-I47 PolarHBondContact O-N 3.03Å; D44-V48 VanDerWaalsContact O-CG2 3.3Å; D44-V48 WeakPolarHBondContact O-CG2 3.2Å; D44-V48 PolarHBondContact O-N 3.45Å
45	A	47.8	Very low	49.6	Very low	55 Å²	55	94.2 Å²	94.2	46%	0.455	51%	0.507	S	S	.	.	H	α-helix	trans	-61	-46.2	174	0	0	0	0	0	112	F41 I47 V48 D49	F41-A45 PolarHBondContact O-N 3.42Å; A45-I47 VanDerWaalsContact C-N 3.29Å; A45-I47 PolarHBondContact O-N 3.37Å; A45-V48 PolarHBondContact O-N 2.96Å; A45-D49 PolarHBondContact O-N 3.12Å
46	Y	51.4	Low	49.5	Very low	159 Å²	159	96 Å²	96	62%	0.624	50%	0.502	S	S	*	.	H	α-helix	trans	-64	-34.1	179.9	-163	-106.8	0	0	0	112.7	V42 L43 I50	V42-Y46 WeakPolarHBondContact O-CB 3.38Å; V42-Y46 PolarHBondContact O-N 3Å; V42-Y46 VanDerWaalsContact O-N 3.12Å; L43-Y46 PolarHBondContact O-N 2.99Å; Y46-I50 HydrophobicContact CD1-CD1 3.54Å; Y46-I50 HydrophobicContact CD1-CG1 4.49Å; Y46-I50 HydrophobicContact CE1-CD1 3.39Å; Y46-I50 HydrophobicContact CE1-CG1 4.38Å; Y46-I50 HydrophobicContact CG-CD1 4.44Å; Y46-I50 WeakPolarHBondContact O-CD1 3.27Å; Y46-I50 VanDerWaalsContact O-CG1 3.28Å; Y46-I50 WeakPolarHBondContact O-CG1 3.39Å; Y46-I50 PolarHBondContact O-N 2.92Å; Y46-I50 VanDerWaalsContact O-N 3.12Å
47	I	52.1	Low	49.5	Very low	38 Å²	38	95 Å²	95	20%	0.195	50%	0.502	C	S	.	.	H	α-helix	trans	-76.8	-33.3	179	-71.5	167.6	0	0	0	111.6	I25 K29 L43 D44 A45 N51	I25-I47 HydrophobicContact CG2-CD1 3.97Å; K29-I47 HydrophobicContact CD-CD1 4.49Å; K29-I47 VanDerWaalsContact NZ-CD1 3.3Å; L43-I47 WeakPolarHBondContact O-CB 3.3Å; L43-I47 WeakPolarHBondContact O-CD1 3.47Å; L43-I47 WeakPolarHBondContact O-CG1 3.28Å; L43-I47 PolarHBondContact O-N 3.18Å; D44-I47 PolarHBondContact O-N 3.03Å; A45-I47 VanDerWaalsContact C-N 3.29Å; A45-I47 PolarHBondContact O-N 3.37Å; I47-N51 WeakPolarHBondContact O-CB 3.5Å; I47-N51 PolarHBondContact O-N 3.05Å; I47-N51 PolarHBondContact O-ND2 3.46Å; I47-N51 VanDerWaalsContact O-ND2 3.13Å
48	V	52.5	Low	49.7	Very low	88 Å²	88	90.1 Å²	90.1	53%	0.533	49%	0.489	S	S	.	.	H	α-helix	trans	-64.8	-46	172	173.1	0	0	0	0	110.3	D44 A45 I50 N51 V52	D44-V48 VanDerWaalsContact O-CG2 3.3Å; D44-V48 WeakPolarHBondContact O-CG2 3.2Å; D44-V48 PolarHBondContact O-N 3.45Å; A45-V48 PolarHBondContact O-N 2.96Å; V48-I50 PolarHBondContact O-N 3.13Å; V48-N51 PolarHBondContact O-N 3.38Å; V48-V52 HydrophobicContact CG1-CG2 4.33Å; V48-V52 WeakPolarHBondContact O-CG2 3.35Å; V48-V52 PolarHBondContact O-N 3.43Å
49	D	50.3	Low	49.6	Very low	94 Å²	94	89.8 Å²	89.8	50%	0.503	48%	0.477	S	S	.	.	H	α-helix	trans	-59.4	-46.4	177.5	-81	-30.3	0	0	0	111.7	A45 N51 V52 Y53	A45-D49 PolarHBondContact O-N 3.12Å; D49-N51 VanDerWaalsContact C-N 3.31Å; D49-N51 PolarHBondContact O-N 3.47Å; D49-V52 PolarHBondContact O-N 2.94Å; D49-Y53 VanDerWaalsContact O-CD2 3.27Å; D49-Y53 WeakPolarHBondContact O-CD2 3.28Å; D49-Y53 PolarHBondContact O-N 3.1Å
50	I	54	Low	49.4	Very low	83 Å²	83	90.2 Å²	90.2	43%	0.426	48%	0.48	S	S	.	.	H	α-helix	trans	-61.2	-40.5	177.2	-69.5	167.5	0	0	0	111.7	Y46 V48 Y53 N54	Y46-I50 HydrophobicContact CD1-CD1 3.54Å; Y46-I50 HydrophobicContact CD1-CG1 4.49Å; Y46-I50 HydrophobicContact CE1-CD1 3.39Å; Y46-I50 HydrophobicContact CE1-CG1 4.38Å; Y46-I50 HydrophobicContact CG-CD1 4.44Å; Y46-I50 WeakPolarHBondContact O-CD1 3.27Å; Y46-I50 VanDerWaalsContact O-CG1 3.28Å; Y46-I50 WeakPolarHBondContact O-CG1 3.39Å; Y46-I50 PolarHBondContact O-N 2.92Å; Y46-I50 VanDerWaalsContact O-N 3.12Å; V48-I50 PolarHBondContact O-N 3.13Å; I50-Y53 PolarHBondContact O-N 3.04Å; I50-N54 WeakPolarHBondContact O-CB 3.33Å; I50-N54 PolarHBondContact O-N 3.25Å
51	N	51.4	Low	49.5	Very low	89 Å²	89	94 Å²	94	48%	0.476	50%	0.496	S	S	.	.	H	α-helix	trans	-67.1	-39.4	178.4	-75	-27.4	0	0	0	111.8	I47 V48 D49 N54 V55	I47-N51 WeakPolarHBondContact O-CB 3.5Å; I47-N51 PolarHBondContact O-N 3.05Å; I47-N51 PolarHBondContact O-ND2 3.46Å; I47-N51 VanDerWaalsContact O-ND2 3.13Å; V48-N51 PolarHBondContact O-N 3.38Å; D49-N51 VanDerWaalsContact C-N 3.31Å; D49-N51 PolarHBondContact O-N 3.47Å; N51-N54 PolarHBondContact O-N 3.06Å; N51-V55 WeakPolarHBondContact O-CB 3.26Å; N51-V55 VanDerWaalsContact O-CG2 3.26Å; N51-V55 WeakPolarHBondContact O-CG2 3.49Å; N51-V55 PolarHBondContact O-N 3.06Å
52	V	53.7	Low	49.3	Very low	87 Å²	87	91 Å²	91	53%	0.527	49%	0.487	S	S	.	.	H	α-helix	trans	-65.4	-44.8	176	173.9	0	0	0	0	110.6	V48 D49 N54 V55 N56	V48-V52 HydrophobicContact CG1-CG2 4.33Å; V48-V52 WeakPolarHBondContact O-CG2 3.35Å; V48-V52 PolarHBondContact O-N 3.43Å; D49-V52 PolarHBondContact O-N 2.94Å; V52-N54 VanDerWaalsContact C-N 3.32Å; V52-N54 PolarHBondContact O-N 3.47Å; V52-V55 PolarHBondContact O-N 3.37Å; V52-N56 WeakPolarHBondContact O-CB 3.26Å; V52-N56 PolarHBondContact O-N 3.41Å
53	Y	51	Low	49	Very low	174 Å²	174	90.5 Å²	90.5	68%	0.682	48%	0.48	S	S	*	.	H	α-helix	trans	-59.8	-42	175	-89.9	-79.4	0	0	0	112	D49 I50 N56 V57	D49-Y53 VanDerWaalsContact O-CD2 3.27Å; D49-Y53 WeakPolarHBondContact O-CD2 3.28Å; D49-Y53 PolarHBondContact O-N 3.1Å; I50-Y53 PolarHBondContact O-N 3.04Å; Y53-N56 PolarHBondContact O-N 3.46Å; Y53-V57 VanDerWaalsContact O-CG2 3.28Å; Y53-V57 WeakPolarHBondContact O-CG2 3.48Å; Y53-V57 PolarHBondContact O-N 2.92Å; Y53-V57 VanDerWaalsContact O-N 3.1Å
54	N	51.1	Low	48.7	Very low	79 Å²	79	93.3 Å²	93.3	42%	0.422	49%	0.493	S	S	.	.	H	α-helix	trans	-72.8	-38.5	-177.7	-157.9	13.4	0	0	0	112.7	I50 N51 V52 N56 V57 I58	I50-N54 WeakPolarHBondContact O-CB 3.33Å; I50-N54 PolarHBondContact O-N 3.25Å; N51-N54 PolarHBondContact O-N 3.06Å; V52-N54 VanDerWaalsContact C-N 3.32Å; V52-N54 PolarHBondContact O-N 3.47Å; N54-N56 VanDerWaalsContact C-N 3.31Å; N54-N56 PolarHBondContact O-N 3.24Å; N54-V57 PolarHBondContact O-N 2.95Å; N54-I58 WeakPolarHBondContact O-CB 3.39Å; N54-I58 VanDerWaalsContact O-CG1 3.26Å; N54-I58 WeakPolarHBondContact O-CG1 3.29Å; N54-I58 PolarHBondContact O-N 3.25Å
55	V	51.3	Low	48.4	Very low	93 Å²	93	92.9 Å²	92.9	56%	0.564	50%	0.497	S	S	*	.	H	α-helix	trans	-65.3	-37.2	174.8	172.6	0	0	0	0	111.1	N51 V52 I58 S59	N51-V55 WeakPolarHBondContact O-CB 3.26Å; N51-V55 VanDerWaalsContact O-CG2 3.26Å; N51-V55 WeakPolarHBondContact O-CG2 3.49Å; N51-V55 PolarHBondContact O-N 3.06Å; V52-V55 PolarHBondContact O-N 3.37Å; V55-I58 PolarHBondContact O-N 3.48Å; V55-S59 VanDerWaalsContact O-CB 3.3Å; V55-S59 WeakPolarHBondContact O-CB 3.49Å; V55-S59 PolarHBondContact O-N 3.3Å; V55-S59 PolarHBondContact O-OG 3.1Å
56	N	50.2	Low	48.2	Very low	99 Å²	99	96.8 Å²	96.8	53%	0.529	51%	0.506	S	S	.	.	H	α-helix	trans	-69.1	-37.1	178.6	-141.4	6.5	0	0	0	112	V52 Y53 N54 N60	V52-N56 WeakPolarHBondContact O-CB 3.26Å; V52-N56 PolarHBondContact O-N 3.41Å; Y53-N56 PolarHBondContact O-N 3.46Å; N54-N56 VanDerWaalsContact C-N 3.31Å; N54-N56 PolarHBondContact O-N 3.24Å; N56-N60 WeakPolarHBondContact O-CB 3.21Å; N56-N60 PolarHBondContact O-N 3.02Å; N56-N60 VanDerWaalsContact O-N 3.1Å; N56-N60 PolarHBondContact O-ND2 3.32Å
57	V	50.2	Low	48	Very low	77 Å²	77	97.8 Å²	97.8	47%	0.467	51%	0.514	S	S	.	.	H	α-helix	trans	-69.6	-43.2	174.5	173.6	0	0	0	0	111.5	Y53 N54 S59 N60 I61	Y53-V57 VanDerWaalsContact O-CG2 3.28Å; Y53-V57 WeakPolarHBondContact O-CG2 3.48Å; Y53-V57 PolarHBondContact O-N 2.92Å; Y53-V57 VanDerWaalsContact O-N 3.1Å; N54-V57 PolarHBondContact O-N 2.95Å; V57-S59 VanDerWaalsContact C-N 3.33Å; V57-S59 PolarHBondContact O-N 3.48Å; V57-N60 PolarHBondContact O-N 3.36Å; V57-I61 HydrophobicContact CG1-CD1 3.8Å; V57-I61 VanDerWaalsContact O-CG1 3.29Å; V57-I61 WeakPolarHBondContact O-CG1 3.41Å; V57-I61 PolarHBondContact O-N 3.39Å
58	I	49.6	Very low	47.6	Very low	97 Å²	97	102.8 Å²	102.8	50%	0.497	56%	0.561	S	S	.	*	H	α-helix	trans	-64.8	-39.2	177.1	-68.2	167.3	0	0	0	110.9	N54 V55 I61 L62	N54-I58 WeakPolarHBondContact O-CB 3.39Å; N54-I58 VanDerWaalsContact O-CG1 3.26Å; N54-I58 WeakPolarHBondContact O-CG1 3.29Å; N54-I58 PolarHBondContact O-N 3.25Å; V55-I58 PolarHBondContact O-N 3.48Å; I58-I61 PolarHBondContact O-N 2.91Å; I58-L62 WeakPolarHBondContact O-CB 3.3Å; I58-L62 PolarHBondContact O-N 2.73Å
59	S	46.5	Very low	47.4	Very low	52 Å²	52	103.6 Å²	103.6	36%	0.364	56%	0.562	S	S	.	*	H	α-helix	trans	-65.6	-40.5	177.9	-58.5	0	0	0	0	111.6	V55 V57 L62 I63	V55-S59 VanDerWaalsContact O-CB 3.3Å; V55-S59 WeakPolarHBondContact O-CB 3.49Å; V55-S59 PolarHBondContact O-N 3.3Å; V55-S59 PolarHBondContact O-OG 3.1Å; V57-S59 VanDerWaalsContact C-N 3.33Å; V57-S59 PolarHBondContact O-N 3.48Å; S59-L62 PolarHBondContact O-N 3.24Å; S59-I63 WeakPolarHBondContact O-CD1 3.4Å; S59-I63 VanDerWaalsContact O-CG1 3.29Å; S59-I63 WeakPolarHBondContact O-CG1 3.38Å; S59-I63 PolarHBondContact O-N 3.27Å; S59-I63 VanDerWaalsContact O-N 3.09Å
60	N	41.8	Very low	47.2	Very low	92 Å²	92	104.1 Å²	104.1	49%	0.492	57%	0.565	S	S	.	*	H	α-helix	trans	-68.2	-34.3	175.4	-77.9	-27.7	0	0	0	113	N56 V57 I64	N56-N60 WeakPolarHBondContact O-CB 3.21Å; N56-N60 PolarHBondContact O-N 3.02Å; N56-N60 VanDerWaalsContact O-N 3.1Å; N56-N60 PolarHBondContact O-ND2 3.32Å; V57-N60 PolarHBondContact O-N 3.36Å; N60-I64 WeakPolarHBondContact O-CD1 3.29Å; N60-I64 VanDerWaalsContact O-CG1 3.27Å; N60-I64 WeakPolarHBondContact O-CG1 3.5Å; N60-I64 PolarHBondContact O-N 2.9Å
61	I	46.3	Very low	46.8	Very low	105 Å²	105	105.2 Å²	105.2	54%	0.538	57%	0.573	S	S	.	*	H	α-helix	trans	-72.5	-36.5	175.3	-66.6	166.6	0	0	0	111.2	V57 I58 I63 I64 S65	V57-I61 HydrophobicContact CG1-CD1 3.8Å; V57-I61 VanDerWaalsContact O-CG1 3.29Å; V57-I61 WeakPolarHBondContact O-CG1 3.41Å; V57-I61 PolarHBondContact O-N 3.39Å; I58-I61 PolarHBondContact O-N 2.91Å; I61-I63 VanDerWaalsContact C-N 3.35Å; I61-I64 PolarHBondContact O-N 3.44Å; I61-S65 PolarHBondContact O-N 3.17Å; I61-S65 PolarHBondContact O-OG 3.38Å
62	L	40.8	Very low	46.6	Very low	100 Å²	100	106.2 Å²	106.2	52%	0.524	58%	0.579	S	S	.	*	H	α-helix	trans	-67.9	-35.3	178.2	-164.2	72.1	0	0	0	111.9	I58 S59 S65 Q66	I58-L62 WeakPolarHBondContact O-CB 3.3Å; I58-L62 PolarHBondContact O-N 2.73Å; S59-L62 PolarHBondContact O-N 3.24Å; L62-S65 WeakPolarHBondContact CA-OG 3.37Å; L62-S65 PolarHBondContact O-OG 3.06Å; L62-Q66 WeakPolarHBondContact O-CG 3.41Å; L62-Q66 PolarHBondContact O-N 3.39Å
63	I	42.5	Very low	46.1	Very low	95 Å²	95	107.4 Å²	107.4	49%	0.487	58%	0.582	S	S	.	*	H	α-helix	trans	-69.4	-42.3	175.2	-66.6	165.2	0	0	0	110.5	S59 I61 S65 Q66 F67	S59-I63 WeakPolarHBondContact O-CD1 3.4Å; S59-I63 VanDerWaalsContact O-CG1 3.29Å; S59-I63 WeakPolarHBondContact O-CG1 3.38Å; S59-I63 PolarHBondContact O-N 3.27Å; S59-I63 VanDerWaalsContact O-N 3.09Å; I61-I63 VanDerWaalsContact C-N 3.35Å; I63-S65 VanDerWaalsContact C-N 3.3Å; I63-S65 PolarHBondContact O-N 2.78Å; I63-Q66 PolarHBondContact O-N 3.09Å; I63-F67 HydrophobicContact CG2-CD2 4.48Å; I63-F67 WeakPolarHBondContact O-CD2 3.27Å
64	I	42	Very low	45.8	Very low	123 Å²	123	102.9 Å²	102.9	63%	0.631	58%	0.575	S	S	*	*	H	α-helix	trans	-69.1	-29.3	-179.4	-65.4	166.8	0	0	0	112.1	N60 I61 Q66	N60-I64 WeakPolarHBondContact O-CD1 3.29Å; N60-I64 VanDerWaalsContact O-CG1 3.27Å; N60-I64 WeakPolarHBondContact O-CG1 3.5Å; N60-I64 PolarHBondContact O-N 2.9Å; I61-I64 PolarHBondContact O-N 3.44Å; I64-Q66 VanDerWaalsContact C-N 3.33Å
65	S	40.8	Very low	45.4	Very low	72 Å²	72	104.6 Å²	104.6	50%	0.503	59%	0.586	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81.1	-6.9	177.4	47.3	0	0	0	0	114.8	I61 L62 I63	I61-S65 PolarHBondContact O-N 3.17Å; I61-S65 PolarHBondContact O-OG 3.38Å; L62-S65 WeakPolarHBondContact CA-OG 3.37Å; L62-S65 PolarHBondContact O-OG 3.06Å; I63-S65 VanDerWaalsContact C-N 3.3Å; I63-S65 PolarHBondContact O-N 2.78Å
66	Q	43.2	Very low	45	Very low	137 Å²	137	105.5 Å²	105.5	64%	0.64	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95	-7.3	172.9	-71.7	-178.8	-2.3	0	0	113.3	L62 I63 I64	L62-Q66 WeakPolarHBondContact O-CG 3.41Å; L62-Q66 PolarHBondContact O-N 3.39Å; I63-Q66 PolarHBondContact O-N 3.09Å; I64-Q66 VanDerWaalsContact C-N 3.33Å
67	F	47.9	Very low	44.6	Very low	180 Å²	180	106.1 Å²	106.1	79%	0.789	59%	0.593	S	S	*	*			trans	-125	12	-177.8	-71.4	-79.9	0	0	0	114.2	I63	I63-F67 HydrophobicContact CG2-CD2 4.48Å; I63-F67 WeakPolarHBondContact O-CD2 3.27Å
68	A	43.2	Very low	44	Very low	143 Å²	143	108.7 Å²	108.7	100%	1.182	60%	0.604	S	S	*	*			trans	-115.6	0	175.2	0	0	0	0	0	111

Retrieved 68 of 68 residues in 44.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).