A0A5K4F578_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F578, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 64 aa.

						>A0A5K4F578_SCHMA|A0A5K4F578
MELLWGEIVSTFVVQFNIFFIILTNQSVILMKYVAKRLTLTKLIFTCSYLVSHLQTTLSGGMKM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.1	Low	86.4	Confident	224 Å²	224	122.3 Å²	122.3	100%	1.103	64%	0.635	S	S	*	*				0	-14.6	0	-69.7	-157.5	178.5	0	0	113.5
2	E	76	Confident	87.2	Confident	177 Å²	177	122.7 Å²	122.7	83%	0.827	63%	0.628	S	S	*	*	H	α-helix	trans	-69.9	-35.2	-177	-160.5	174	102.6	0	0	114.8	L4 W5	E2-L4 PolarHBondContact O-N 3.4Å; E2-W5 PolarHBondContact O-N 2.95Å
3	L	77.1	Confident	88	Confident	157 Å²	157	118.5 Å²	118.5	82%	0.822	61%	0.612	S	S	*	*	H	α-helix	trans	-60.5	-40.9	-178.6	-84	151.1	0	0	0	114.2	W5 G6	L3-W5 VanDerWaalsContact C-N 3.27Å; L3-W5 PolarHBondContact O-N 3.31Å; L3-G6 PolarHBondContact O-N 3.3Å
4	L	88.3	Confident	88.6	Confident	113 Å²	113	115.6 Å²	115.6	59%	0.592	60%	0.602	S	S	*	*	H	α-helix	trans	-67	-30.6	-177.8	-64.2	174.7	0	0	0	112.3	E2 I8	E2-L4 PolarHBondContact O-N 3.4Å; L4-I8 WeakPolarHBondContact O-CD1 3.34Å; L4-I8 VanDerWaalsContact O-CG1 3.3Å; L4-I8 WeakPolarHBondContact O-CG1 3.4Å; L4-I8 PolarHBondContact O-N 2.82Å
5	W	92.6	Very high	89.1	Confident	188 Å²	188	116.2 Å²	116.2	71%	0.712	60%	0.601	S	S	*	*	H	α-helix	trans	-66.7	-42.9	-179.9	-176.2	-103.5	0	0	0	111.5	E2 L3 E7 I8 V9	E2-W5 PolarHBondContact O-N 2.95Å; L3-W5 VanDerWaalsContact C-N 3.27Å; L3-W5 PolarHBondContact O-N 3.31Å; W5-E7 PolarHBondContact O-N 3.43Å; W5-I8 PolarHBondContact O-N 3.46Å; W5-V9 HydrophobicContact CD2-CG2 4.37Å; W5-V9 HydrophobicContact CZ2-CG2 4.28Å; W5-V9 VanDerWaalsContact O-CG2 3.31Å; W5-V9 WeakPolarHBondContact O-CG2 3.43Å; W5-V9 PolarHBondContact O-N 2.9Å
6	G	91.4	Very high	89.5	Confident	43 Å²	43	114.9 Å²	114.9	44%	0.443	59%	0.589	S	S	.	*	H	α-helix	trans	-60.8	-42	179.3	0	0	0	0	0	113.2	L3 V9 S10	L3-G6 PolarHBondContact O-N 3.3Å; G6-V9 PolarHBondContact O-N 3.39Å; G6-S10 WeakPolarHBondContact O-CB 3.37Å; G6-S10 PolarHBondContact O-N 3.46Å
7	E	88	Confident	89.9	Confident	127 Å²	127	113.1 Å²	113.1	59%	0.593	58%	0.581	S	S	*	*	H	α-helix	trans	-66.6	-41.2	179.8	-65.3	-171.8	115.3	0	0	112.6	W5 S10 T11	W5-E7 PolarHBondContact O-N 3.43Å; E7-S10 PolarHBondContact O-N 3.4Å; E7-T11 WeakPolarHBondContact O-CB 3.32Å; E7-T11 PolarHBondContact O-N 3.35Å; E7-T11 PolarHBondContact O-OG1 2.93Å
8	I	92.5	Very high	90.3	Very high	106 Å²	106	111.8 Å²	111.8	54%	0.544	57%	0.574	S	S	.	*	H	α-helix	trans	-63.2	-47.5	176.8	-66.5	166.5	0	0	0	110.2	L4 W5 S10 T11 F12	L4-I8 WeakPolarHBondContact O-CD1 3.34Å; L4-I8 VanDerWaalsContact O-CG1 3.3Å; L4-I8 WeakPolarHBondContact O-CG1 3.4Å; L4-I8 PolarHBondContact O-N 2.82Å; W5-I8 PolarHBondContact O-N 3.46Å; I8-S10 PolarHBondContact O-N 3.07Å; I8-T11 PolarHBondContact O-N 3.36Å; I8-F12 WeakPolarHBondContact O-CB 3.3Å; I8-F12 PolarHBondContact O-N 3.48Å
9	V	95.3	Very high	90.7	Very high	62 Å²	62	112.5 Å²	112.5	38%	0.376	57%	0.573	S	S	.	*	H	α-helix	trans	-62.8	-43.9	179.7	174.6	0	0	0	0	110.8	W5 G6 F12 V13	W5-V9 HydrophobicContact CD2-CG2 4.37Å; W5-V9 HydrophobicContact CZ2-CG2 4.28Å; W5-V9 VanDerWaalsContact O-CG2 3.31Å; W5-V9 WeakPolarHBondContact O-CG2 3.43Å; W5-V9 PolarHBondContact O-N 2.9Å; G6-V9 PolarHBondContact O-N 3.39Å; V9-F12 PolarHBondContact O-N 3.26Å; V9-V13 HydrophobicContact CG1-CG2 4.44Å; V9-V13 VanDerWaalsContact O-CG2 3.28Å; V9-V13 WeakPolarHBondContact O-CG2 3.31Å; V9-V13 PolarHBondContact O-N 3.42Å
10	S	93.7	Very high	91	Very high	72 Å²	72	111.5 Å²	111.5	50%	0.503	57%	0.565	S	S	.	*	H	α-helix	trans	-60.3	-48	177.1	-176.1	0	0	0	0	111.8	G6 E7 I8 F12 V13 V14	G6-S10 WeakPolarHBondContact O-CB 3.37Å; G6-S10 PolarHBondContact O-N 3.46Å; E7-S10 PolarHBondContact O-N 3.4Å; I8-S10 PolarHBondContact O-N 3.07Å; S10-F12 VanDerWaalsContact C-N 3.34Å; S10-F12 PolarHBondContact O-N 2.95Å; S10-V13 PolarHBondContact O-N 3.36Å; S10-V14 WeakPolarHBondContact O-CG2 3.21Å; S10-V14 PolarHBondContact O-N 2.96Å
11	T	95	Very high	91.3	Very high	76 Å²	76	111.1 Å²	111.1	47%	0.466	56%	0.563	S	S	.	*	H	α-helix	trans	-61.1	-43.7	178.5	-57.1	0	0	0	0	111.3	E7 I8 V14 Q15	E7-T11 WeakPolarHBondContact O-CB 3.32Å; E7-T11 PolarHBondContact O-N 3.35Å; E7-T11 PolarHBondContact O-OG1 2.93Å; I8-T11 PolarHBondContact O-N 3.36Å; T11-V14 PolarHBondContact O-N 3.36Å; T11-Q15 HydrophobicContact CG2-CG 4.43Å; T11-Q15 WeakPolarHBondContact O-CB 3.28Å; T11-Q15 WeakPolarHBondContact O-CG 3.35Å; T11-Q15 PolarHBondContact O-N 3.32Å
12	F	96.7	Very high	93.1	Very high	127 Å²	127	104.6 Å²	104.6	56%	0.557	53%	0.532	S	S	*	.	H	α-helix	trans	-60.7	-45.7	177.1	177.7	-97	0	0	0	111.8	I8 V9 S10 V14 Q15 F16	I8-F12 WeakPolarHBondContact O-CB 3.3Å; I8-F12 PolarHBondContact O-N 3.48Å; V9-F12 PolarHBondContact O-N 3.26Å; S10-F12 VanDerWaalsContact C-N 3.34Å; S10-F12 PolarHBondContact O-N 2.95Å; F12-V14 PolarHBondContact O-N 3.46Å; F12-Q15 PolarHBondContact O-N 3.45Å; F12-F16 WeakPolarHBondContact O-CB 3.46Å; F12-F16 PolarHBondContact O-N 2.84Å
13	V	96.9	Very high	94	Very high	69 Å²	69	100.2 Å²	100.2	42%	0.418	51%	0.513	S	S	.	.	H	α-helix	trans	-62.3	-42.7	178.1	171	0	0	0	0	111.1	V9 S10 F16 N17	V9-V13 HydrophobicContact CG1-CG2 4.44Å; V9-V13 VanDerWaalsContact O-CG2 3.28Å; V9-V13 WeakPolarHBondContact O-CG2 3.31Å; V9-V13 PolarHBondContact O-N 3.42Å; S10-V13 PolarHBondContact O-N 3.36Å; V13-F16 PolarHBondContact O-N 2.9Å; V13-N17 WeakPolarHBondContact CG1-ND2 3.44Å; V13-N17 WeakPolarHBondContact O-CB 3.39Å; V13-N17 VanDerWaalsContact O-CG 3.31Å; V13-N17 PolarHBondContact O-N 3.24Å; V13-N17 PolarHBondContact O-ND2 3.46Å
14	V	97	Very high	94.9	Very high	78 Å²	78	96.4 Å²	96.4	47%	0.473	50%	0.497	S	S	.	.	H	α-helix	trans	-63.8	-47.5	177.1	173.6	0	0	0	0	111.1	S10 T11 F12 F16 N17 I18	S10-V14 WeakPolarHBondContact O-CG2 3.21Å; S10-V14 PolarHBondContact O-N 2.96Å; T11-V14 PolarHBondContact O-N 3.36Å; F12-V14 PolarHBondContact O-N 3.46Å; V14-F16 VanDerWaalsContact C-N 3.34Å; V14-F16 PolarHBondContact O-N 3.33Å; V14-N17 PolarHBondContact O-N 3Å; V14-I18 HydrophobicContact CG1-CD1 3.8Å; V14-I18 VanDerWaalsContact O-CG1 3.3Å; V14-I18 WeakPolarHBondContact O-CG1 3.47Å; V14-I18 PolarHBondContact O-N 3Å
15	Q	95.9	Very high	95.2	Very high	124 Å²	124	95.6 Å²	95.6	58%	0.579	49%	0.493	S	S	*	.	H	α-helix	trans	-61.3	-42.4	177.4	-73.3	178.6	-25.3	0	0	112.1	T11 F12 I18 F19	T11-Q15 HydrophobicContact CG2-CG 4.43Å; T11-Q15 WeakPolarHBondContact O-CB 3.28Å; T11-Q15 WeakPolarHBondContact O-CG 3.35Å; T11-Q15 PolarHBondContact O-N 3.32Å; F12-Q15 PolarHBondContact O-N 3.45Å; Q15-I18 PolarHBondContact O-N 3.03Å; Q15-F19 WeakPolarHBondContact O-CB 3.39Å; Q15-F19 PolarHBondContact O-N 3.22Å
16	F	96.4	Very high	95.2	Very high	96 Å²	96	92.7 Å²	92.7	42%	0.421	49%	0.487	S	S	.	.	H	α-helix	trans	-59.8	-49.5	176	-177.8	-92.7	0	0	0	111.1	F12 V13 V14 I18 F19 F20	F12-F16 WeakPolarHBondContact O-CB 3.46Å; F12-F16 PolarHBondContact O-N 2.84Å; V13-F16 PolarHBondContact O-N 2.9Å; V14-F16 VanDerWaalsContact C-N 3.34Å; V14-F16 PolarHBondContact O-N 3.33Å; F16-I18 PolarHBondContact O-N 3.26Å; F16-F19 WeakPolarHBondContact O-CB 3.3Å; F16-F19 PolarHBondContact O-N 2.92Å; F16-F20 AromaticContact CD1-CD2 3.86Å; F16-F20 HydrophobicContact CD1-CD2 3.86Å; F16-F20 HydrophobicContact CD1-CE2 4.02Å; F16-F20 HydrophobicContact CD2-CD2 4.2Å; F16-F20 AromaticContact CD2-CE2 3.83Å; F16-F20 HydrophobicContact CD2-CE2 3.83Å; F16-F20 AromaticContact CE1-CD2 3.62Å; F16-F20 HydrophobicContact CE1-CD2 3.62Å; F16-F20 AromaticContact CE1-CE2 3.42Å; F16-F20 HydrophobicContact CE1-CE2 3.42Å; F16-F20 VanDerWaalsContact CE1-CE2 3.42Å; F16-F20 HydrophobicContact CE1-CG 4.39Å; F16-F20 AromaticContact CE1-CZ 4Å; F16-F20 HydrophobicContact CE1-CZ 4Å; F16-F20 HydrophobicContact CE2-CD2 4Å; F16-F20 AromaticContact CE2-CE2 3.23Å; F16-F20 HydrophobicContact CE2-CE2 3.23Å; F16-F20 AromaticContact CE2-CZ 3.98Å; F16-F20 HydrophobicContact CE2-CZ 3.98Å; F16-F20 HydrophobicContact CG-CD2 4.16Å; F16-F20 HydrophobicContact CG-CE2 4.2Å; F16-F20 AromaticContact CZ-CD2 3.71Å; F16-F20 HydrophobicContact CZ-CD2 3.71Å; F16-F20 HydrophobicContact CZ-CE1 4.48Å; F16-F20 AromaticContact CZ-CE2 2.99Å; F16-F20 HydrophobicContact CZ-CE2 2.99Å; F16-F20 AromaticContact CZ-CZ 3.45Å; F16-F20 HydrophobicContact CZ-CZ 3.45Å; F16-F20 VanDerWaalsContact CZ-CZ 3.45Å; F16-F20 VanDerWaalsContact O-CD2 3.3Å; F16-F20 WeakPolarHBondContact O-CD2 3.3Å; F16-F20 PolarHBondContact O-N 3.45Å
17	N	95.2	Very high	95.2	Very high	83 Å²	83	93 Å²	93	44%	0.444	48%	0.483	S	S	.	.	H	α-helix	trans	-60	-44.4	177.9	-74.8	-41.6	0	0	0	112.3	V13 V14 F19 F20 I21	V13-N17 WeakPolarHBondContact CG1-ND2 3.44Å; V13-N17 WeakPolarHBondContact O-CB 3.39Å; V13-N17 VanDerWaalsContact O-CG 3.31Å; V13-N17 PolarHBondContact O-N 3.24Å; V13-N17 PolarHBondContact O-ND2 3.46Å; V14-N17 PolarHBondContact O-N 3Å; N17-F19 VanDerWaalsContact C-N 3.34Å; N17-F19 PolarHBondContact O-N 3.47Å; N17-F20 PolarHBondContact O-N 3Å; N17-I21 WeakPolarHBondContact O-CG1 3.33Å; N17-I21 PolarHBondContact O-N 2.97Å
18	I	97.5	Very high	95.4	Very high	90 Å²	90	89.9 Å²	89.9	46%	0.462	47%	0.472	S	S	.	.	H	α-helix	trans	-60.7	-45.2	177	-68.1	167.2	0	0	0	110.6	V14 Q15 F16 F20 I21 I22	V14-I18 HydrophobicContact CG1-CD1 3.8Å; V14-I18 VanDerWaalsContact O-CG1 3.3Å; V14-I18 WeakPolarHBondContact O-CG1 3.47Å; V14-I18 PolarHBondContact O-N 3Å; Q15-I18 PolarHBondContact O-N 3.03Å; F16-I18 PolarHBondContact O-N 3.26Å; I18-F20 VanDerWaalsContact C-N 3.34Å; I18-F20 PolarHBondContact O-N 3.43Å; I18-I21 PolarHBondContact O-N 2.97Å; I18-I22 HydrophobicContact CG2-CD1 3.89Å; I18-I22 WeakPolarHBondContact O-CG1 3.48Å; I18-I22 PolarHBondContact O-N 3.28Å
19	F	97.6	Very high	95.5	Very high	125 Å²	125	90.2 Å²	90.2	55%	0.548	47%	0.474	S	S	.	.	H	α-helix	trans	-58.8	-44.7	177.1	178.1	-98.3	0	0	0	111.9	Q15 F16 N17 I21 I22 L23	Q15-F19 WeakPolarHBondContact O-CB 3.39Å; Q15-F19 PolarHBondContact O-N 3.22Å; F16-F19 WeakPolarHBondContact O-CB 3.3Å; F16-F19 PolarHBondContact O-N 2.92Å; N17-F19 VanDerWaalsContact C-N 3.34Å; N17-F19 PolarHBondContact O-N 3.47Å; F19-I21 PolarHBondContact O-N 3.41Å; F19-I22 PolarHBondContact O-N 3.39Å; F19-L23 WeakPolarHBondContact O-CB 3.49Å; F19-L23 PolarHBondContact O-N 2.95Å
20	F	96.9	Very high	95.1	Very high	93 Å²	93	92.5 Å²	92.5	41%	0.408	48%	0.484	S	S	.	.	H	α-helix	trans	-63.2	-39.2	177.1	-92.3	-100.4	0	0	0	113.2	F16 N17 I18 I22 L23 T24	F16-F20 AromaticContact CD1-CD2 3.86Å; F16-F20 HydrophobicContact CD1-CD2 3.86Å; F16-F20 HydrophobicContact CD1-CE2 4.02Å; F16-F20 HydrophobicContact CD2-CD2 4.2Å; F16-F20 AromaticContact CD2-CE2 3.83Å; F16-F20 HydrophobicContact CD2-CE2 3.83Å; F16-F20 AromaticContact CE1-CD2 3.62Å; F16-F20 HydrophobicContact CE1-CD2 3.62Å; F16-F20 AromaticContact CE1-CE2 3.42Å; F16-F20 HydrophobicContact CE1-CE2 3.42Å; F16-F20 VanDerWaalsContact CE1-CE2 3.42Å; F16-F20 HydrophobicContact CE1-CG 4.39Å; F16-F20 AromaticContact CE1-CZ 4Å; F16-F20 HydrophobicContact CE1-CZ 4Å; F16-F20 HydrophobicContact CE2-CD2 4Å; F16-F20 AromaticContact CE2-CE2 3.23Å; F16-F20 HydrophobicContact CE2-CE2 3.23Å; F16-F20 AromaticContact CE2-CZ 3.98Å; F16-F20 HydrophobicContact CE2-CZ 3.98Å; F16-F20 HydrophobicContact CG-CD2 4.16Å; F16-F20 HydrophobicContact CG-CE2 4.2Å; F16-F20 AromaticContact CZ-CD2 3.71Å; F16-F20 HydrophobicContact CZ-CD2 3.71Å; F16-F20 HydrophobicContact CZ-CE1 4.48Å; F16-F20 AromaticContact CZ-CE2 2.99Å; F16-F20 HydrophobicContact CZ-CE2 2.99Å; F16-F20 AromaticContact CZ-CZ 3.45Å; F16-F20 HydrophobicContact CZ-CZ 3.45Å; F16-F20 VanDerWaalsContact CZ-CZ 3.45Å; F16-F20 VanDerWaalsContact O-CD2 3.3Å; F16-F20 WeakPolarHBondContact O-CD2 3.3Å; F16-F20 PolarHBondContact O-N 3.45Å; N17-F20 PolarHBondContact O-N 3Å; I18-F20 VanDerWaalsContact C-N 3.34Å; I18-F20 PolarHBondContact O-N 3.43Å; F20-I22 VanDerWaalsContact C-N 3.35Å; F20-L23 PolarHBondContact O-N 3.36Å; F20-T24 WeakPolarHBondContact O-CB 3.46Å; F20-T24 PolarHBondContact O-N 3.44Å; F20-T24 PolarHBondContact O-OG1 2.88Å
21	I	97.6	Very high	94.6	Very high	104 Å²	104	95 Å²	95	53%	0.533	49%	0.489	S	S	.	.	H	α-helix	trans	-62.8	-43.8	175.2	-68.6	164.1	0	0	0	110.3	N17 I18 F19 T24 N25	N17-I21 WeakPolarHBondContact O-CG1 3.33Å; N17-I21 PolarHBondContact O-N 2.97Å; I18-I21 PolarHBondContact O-N 2.97Å; F19-I21 PolarHBondContact O-N 3.41Å; I21-T24 PolarHBondContact O-N 3.02Å; I21-N25 PolarHBondContact O-N 3.44Å; I21-N25 PolarHBondContact O-ND2 3.18Å
22	I	97.2	Very high	94.2	Very high	86 Å²	86	98.6 Å²	98.6	44%	0.441	50%	0.498	S	S	.	.	H	α-helix	trans	-63.5	-48	177.7	-65.4	166.1	0	0	0	110.5	I18 F19 F20 T24 N25 Q26	I18-I22 HydrophobicContact CG2-CD1 3.89Å; I18-I22 WeakPolarHBondContact O-CG1 3.48Å; I18-I22 PolarHBondContact O-N 3.28Å; F19-I22 PolarHBondContact O-N 3.39Å; F20-I22 VanDerWaalsContact C-N 3.35Å; I22-T24 VanDerWaalsContact C-N 3.29Å; I22-T24 PolarHBondContact O-N 3.42Å; I22-N25 PolarHBondContact O-N 3.19Å; I22-Q26 WeakPolarHBondContact O-CG 3.29Å; I22-Q26 PolarHBondContact O-N 2.95Å
23	L	96.1	Very high	93.8	Very high	85 Å²	85	99.2 Å²	99.2	45%	0.445	50%	0.498	S	S	.	.	H	α-helix	trans	-57.9	-42.4	178	-170.4	79.1	0	0	0	111.7	F19 F20 Q26 S27	F19-L23 WeakPolarHBondContact O-CB 3.49Å; F19-L23 PolarHBondContact O-N 2.95Å; F20-L23 PolarHBondContact O-N 3.36Å; L23-Q26 PolarHBondContact O-N 2.97Å; L23-S27 WeakPolarHBondContact O-CB 3.37Å; L23-S27 PolarHBondContact O-N 3.42Å; L23-S27 PolarHBondContact O-OG 2.91Å
24	T	96.2	Very high	93.2	Very high	77 Å²	77	99 Å²	99	47%	0.472	50%	0.497	S	S	.	.	H	α-helix	trans	-64.1	-45.2	177.5	-57.1	0	0	0	0	111	F20 I21 I22 Q26 S27 V28	F20-T24 WeakPolarHBondContact O-CB 3.46Å; F20-T24 PolarHBondContact O-N 3.44Å; F20-T24 PolarHBondContact O-OG1 2.88Å; I21-T24 PolarHBondContact O-N 3.02Å; I22-T24 VanDerWaalsContact C-N 3.29Å; I22-T24 PolarHBondContact O-N 3.42Å; T24-Q26 PolarHBondContact O-N 3.39Å; T24-S27 PolarHBondContact O-N 2.77Å; T24-S27 PolarHBondContact O-OG 3.01Å; T24-V28 WeakPolarHBondContact O-CG2 3.49Å; T24-V28 PolarHBondContact O-N 3.45Å
25	N	93.3	Very high	92.8	Very high	97 Å²	97	97.8 Å²	97.8	52%	0.519	50%	0.495	S	S	.	.	H	α-helix	trans	-62.1	-43.2	177.2	-80.2	-62.7	0	0	0	112.2	I21 I22 V28 I29	I21-N25 PolarHBondContact O-N 3.44Å; I21-N25 PolarHBondContact O-ND2 3.18Å; I22-N25 PolarHBondContact O-N 3.19Å; N25-V28 PolarHBondContact O-N 3.01Å; N25-I29 WeakPolarHBondContact O-CD1 3.3Å; N25-I29 VanDerWaalsContact O-CG1 3.29Å; N25-I29 WeakPolarHBondContact O-CG1 3.34Å; N25-I29 PolarHBondContact O-N 3.1Å; N25-I29 VanDerWaalsContact O-N 3.1Å
26	Q	92	Very high	92.3	Very high	126 Å²	126	99.6 Å²	99.6	59%	0.589	50%	0.501	S	S	*	.	H	α-helix	trans	-63.3	-43.3	177.2	-72	-174.6	-4.6	0	0	112.2	I22 L23 T24 I29 L30	I22-Q26 WeakPolarHBondContact O-CG 3.29Å; I22-Q26 PolarHBondContact O-N 2.95Å; L23-Q26 PolarHBondContact O-N 2.97Å; T24-Q26 PolarHBondContact O-N 3.39Å; Q26-I29 PolarHBondContact O-N 3.24Å; Q26-L30 WeakPolarHBondContact O-CB 3.48Å; Q26-L30 PolarHBondContact O-N 3.34Å
27	S	93	Very high	91.6	Very high	50 Å²	50	102.3 Å²	102.3	35%	0.35	51%	0.508	S	S	.	.	H	α-helix	trans	-65.8	-38.4	178.9	62.5	0	0	0	0	112.6	L23 T24 L30 M31	L23-S27 WeakPolarHBondContact O-CB 3.37Å; L23-S27 PolarHBondContact O-N 3.42Å; L23-S27 PolarHBondContact O-OG 2.91Å; T24-S27 PolarHBondContact O-N 2.77Å; T24-S27 PolarHBondContact O-OG 3.01Å; S27-L30 PolarHBondContact O-N 2.94Å; S27-M31 WeakPolarHBondContact O-CG 3.46Å; S27-M31 PolarHBondContact O-N 3.47Å
28	V	92.4	Very high	91.1	Very high	61 Å²	61	103.5 Å²	103.5	37%	0.37	51%	0.514	S	S	.	.	H	α-helix	trans	-64.5	-41.7	174.8	171.8	0	0	0	0	112	T24 N25 M31 K32	T24-V28 WeakPolarHBondContact O-CG2 3.49Å; T24-V28 PolarHBondContact O-N 3.45Å; N25-V28 PolarHBondContact O-N 3.01Å; V28-M31 PolarHBondContact O-N 3.36Å; V28-K32 WeakPolarHBondContact O-CG 3.49Å; V28-K32 PolarHBondContact O-N 3.21Å
29	I	92.7	Very high	90.5	Very high	114 Å²	114	103.9 Å²	103.9	59%	0.585	52%	0.52	S	S	*	.	H	α-helix	trans	-64.2	-44.4	176.7	-67	164.6	0	0	0	110.4	N25 Q26 M31 K32 Y33	N25-I29 WeakPolarHBondContact O-CD1 3.3Å; N25-I29 VanDerWaalsContact O-CG1 3.29Å; N25-I29 WeakPolarHBondContact O-CG1 3.34Å; N25-I29 PolarHBondContact O-N 3.1Å; N25-I29 VanDerWaalsContact O-N 3.1Å; Q26-I29 PolarHBondContact O-N 3.24Å; I29-M31 VanDerWaalsContact C-N 3.33Å; I29-M31 PolarHBondContact O-N 3.44Å; I29-K32 PolarHBondContact O-N 3.03Å; I29-Y33 PolarHBondContact O-N 2.89Å
30	L	87	Confident	89.6	Confident	109 Å²	109	102.7 Å²	102.7	57%	0.571	52%	0.519	S	S	*	.	H	α-helix	trans	-60.1	-44.2	176.9	-174.4	64.9	0	0	0	111.1	Q26 S27 K32 Y33 V34	Q26-L30 WeakPolarHBondContact O-CB 3.48Å; Q26-L30 PolarHBondContact O-N 3.34Å; S27-L30 PolarHBondContact O-N 2.94Å; L30-K32 PolarHBondContact O-N 3.1Å; L30-Y33 PolarHBondContact O-N 3.44Å; L30-V34 HydrophobicContact CD1-CG2 4.41Å; L30-V34 HydrophobicContact CG-CG2 4.39Å; L30-V34 VanDerWaalsContact O-CG2 3.3Å; L30-V34 WeakPolarHBondContact O-CG2 3.36Å; L30-V34 PolarHBondContact O-N 2.87Å
31	M	83.5	Confident	88.9	Confident	126 Å²	126	101.9 Å²	101.9	62%	0.621	52%	0.522	S	S	*	.	H	α-helix	trans	-60.2	-42.6	176	-77.1	-164.2	-111.3	0	0	112.5	S27 V28 I29 Y33 V34 A35	S27-M31 WeakPolarHBondContact O-CG 3.46Å; S27-M31 PolarHBondContact O-N 3.47Å; V28-M31 PolarHBondContact O-N 3.36Å; I29-M31 VanDerWaalsContact C-N 3.33Å; I29-M31 PolarHBondContact O-N 3.44Å; M31-Y33 VanDerWaalsContact C-N 3.34Å; M31-Y33 PolarHBondContact O-N 3.39Å; M31-V34 PolarHBondContact O-N 2.96Å; M31-A35 VanDerWaalsContact O-CB 3.32Å; M31-A35 WeakPolarHBondContact O-CB 3.42Å; M31-A35 PolarHBondContact O-N 2.86Å
32	K	86.7	Confident	88.1	Confident	150 Å²	150	104.2 Å²	104.2	65%	0.652	53%	0.528	S	S	*	.	H	α-helix	trans	-62	-41.2	175.3	-72.9	178.4	-179.7	178.7	0	112.1	V28 I29 L30 K36	V28-K32 WeakPolarHBondContact O-CG 3.49Å; V28-K32 PolarHBondContact O-N 3.21Å; I29-K32 PolarHBondContact O-N 3.03Å; L30-K32 PolarHBondContact O-N 3.1Å; K32-K36 WeakPolarHBondContact O-CB 3.32Å; K32-K36 PolarHBondContact O-N 3.06Å; K32-K36 VanDerWaalsContact O-N 3.1Å
33	Y	87.7	Confident	87.4	Confident	140 Å²	140	105.1 Å²	105.1	55%	0.549	53%	0.534	S	S	.	.	H	α-helix	trans	-65.9	-45.5	177.1	-178.6	-103.1	0	0	0	112	I29 L30 M31 K36 R37	I29-Y33 PolarHBondContact O-N 2.89Å; L30-Y33 PolarHBondContact O-N 3.44Å; M31-Y33 VanDerWaalsContact C-N 3.34Å; M31-Y33 PolarHBondContact O-N 3.39Å; Y33-K36 PolarHBondContact O-N 3.15Å; Y33-R37 PolarHBondContact O-N 3.4Å
34	V	85.3	Confident	86.7	Confident	66 Å²	66	105.7 Å²	105.7	40%	0.4	54%	0.536	S	S	.	.	H	α-helix	trans	-63.1	-45.5	177.5	172.7	0	0	0	0	110.9	L30 M31 K36 R37 L38	L30-V34 HydrophobicContact CD1-CG2 4.41Å; L30-V34 HydrophobicContact CG-CG2 4.39Å; L30-V34 VanDerWaalsContact O-CG2 3.3Å; L30-V34 WeakPolarHBondContact O-CG2 3.36Å; L30-V34 PolarHBondContact O-N 2.87Å; M31-V34 PolarHBondContact O-N 2.96Å; V34-K36 VanDerWaalsContact C-N 3.33Å; V34-K36 PolarHBondContact O-N 3.5Å; V34-R37 PolarHBondContact O-N 3.36Å; V34-R37 VanDerWaalsContact O-N 3.15Å; V34-L38 HydrophobicContact CG1-CD1 3.94Å; V34-L38 HydrophobicContact CG1-CG 4.25Å; V34-L38 WeakPolarHBondContact O-CG 3.49Å; V34-L38 PolarHBondContact O-N 2.88Å
35	A	87.6	Confident	86	Confident	52 Å²	52	109 Å²	109	43%	0.43	54%	0.544	S	S	.	.	H	α-helix	trans	-59.5	-43.1	177.2	0	0	0	0	0	112.1	M31 R37 L38 T39	M31-A35 VanDerWaalsContact O-CB 3.32Å; M31-A35 WeakPolarHBondContact O-CB 3.42Å; M31-A35 PolarHBondContact O-N 2.86Å; A35-R37 PolarHBondContact O-N 2.97Å; A35-L38 PolarHBondContact O-N 2.92Å; A35-T39 PolarHBondContact O-N 3.33Å; A35-T39 PolarHBondContact O-OG1 3.15Å; A35-T39 VanDerWaalsContact O-OG1 3.13Å
36	K	86.1	Confident	85.7	Confident	162 Å²	162	107.4 Å²	107.4	70%	0.704	54%	0.538	S	S	*	.	H	α-helix	trans	-62.5	-42.9	175.1	-173.3	176.3	-178.1	179	0	111.7	K32 Y33 V34 T39 L40	K32-K36 WeakPolarHBondContact O-CB 3.32Å; K32-K36 PolarHBondContact O-N 3.06Å; K32-K36 VanDerWaalsContact O-N 3.1Å; Y33-K36 PolarHBondContact O-N 3.15Å; V34-K36 VanDerWaalsContact C-N 3.33Å; V34-K36 PolarHBondContact O-N 3.5Å; K36-T39 PolarHBondContact O-N 3.4Å; K36-L40 WeakPolarHBondContact O-CB 3.39Å; K36-L40 PolarHBondContact O-N 3.46Å
37	R	82.7	Confident	85.1	Confident	153 Å²	153	104.5 Å²	104.5	58%	0.577	53%	0.531	S	S	*	.	H	α-helix	trans	-63.1	-44.7	177.2	-179.6	178	-94	-140	-3.8	111.4	Y33 V34 A35 L40 T41	Y33-R37 PolarHBondContact O-N 3.4Å; V34-R37 PolarHBondContact O-N 3.36Å; V34-R37 VanDerWaalsContact O-N 3.15Å; A35-R37 PolarHBondContact O-N 2.97Å; R37-L40 PolarHBondContact O-N 3.13Å; R37-T41 WeakPolarHBondContact O-CG2 3.29Å; R37-T41 PolarHBondContact O-N 2.92Å; R37-T41 PolarHBondContact O-OG1 3.35Å
38	L	84	Confident	84.7	Confident	108 Å²	108	105.4 Å²	105.4	57%	0.565	54%	0.537	S	S	*	.	H	α-helix	trans	-63.3	-41.5	177.8	-70.6	174.1	0	0	0	112.3	V34 A35 T41 K42	V34-L38 HydrophobicContact CG1-CD1 3.94Å; V34-L38 HydrophobicContact CG1-CG 4.25Å; V34-L38 WeakPolarHBondContact O-CG 3.49Å; V34-L38 PolarHBondContact O-N 2.88Å; A35-L38 PolarHBondContact O-N 2.92Å; L38-T41 WeakPolarHBondContact CA-OG1 3.5Å; L38-T41 PolarHBondContact O-OG1 2.99Å; L38-K42 VanDerWaalsContact O-CB 3.27Å; L38-K42 WeakPolarHBondContact O-CB 3.34Å; L38-K42 PolarHBondContact O-N 3.24Å
39	T	84	Confident	84.4	Confident	98 Å²	98	109.3 Å²	109.3	60%	0.601	55%	0.546	S	S	*	.	H	α-helix	trans	-66	-42.8	175.4	-60.9	0	0	0	0	111.3	A35 K36 K42 L43	A35-T39 PolarHBondContact O-N 3.33Å; A35-T39 PolarHBondContact O-OG1 3.15Å; A35-T39 VanDerWaalsContact O-OG1 3.13Å; K36-T39 PolarHBondContact O-N 3.4Å; T39-K42 PolarHBondContact O-N 2.94Å; T39-L43 VanDerWaalsContact O-CB 3.31Å; T39-L43 WeakPolarHBondContact O-CB 3.48Å; T39-L43 PolarHBondContact O-N 2.89Å
40	L	80.7	Confident	84.1	Confident	99 Å²	99	108.6 Å²	108.6	52%	0.518	54%	0.543	S	S	.	.	H	α-helix	trans	-62.6	-45.1	177.9	-175.8	66.7	0	0	0	111.6	K36 R37 L43 I44	K36-L40 WeakPolarHBondContact O-CB 3.39Å; K36-L40 PolarHBondContact O-N 3.46Å; R37-L40 PolarHBondContact O-N 3.13Å; L40-L43 PolarHBondContact O-N 2.99Å; L40-I44 HydrophobicContact CD1-CD1 4.37Å; L40-I44 HydrophobicContact CG-CD1 4.07Å; L40-I44 VanDerWaalsContact O-CG1 3.29Å; L40-I44 WeakPolarHBondContact O-CG1 3.31Å; L40-I44 PolarHBondContact O-N 3.39Å
41	T	81.7	Confident	83.9	Confident	76 Å²	76	107.9 Å²	107.9	47%	0.466	54%	0.543	S	S	.	.	H	α-helix	trans	-66.3	-39.7	177.5	54.2	0	0	0	0	111.9	R37 L38 I44 F45	R37-T41 WeakPolarHBondContact O-CG2 3.29Å; R37-T41 PolarHBondContact O-N 2.92Å; R37-T41 PolarHBondContact O-OG1 3.35Å; L38-T41 WeakPolarHBondContact CA-OG1 3.5Å; L38-T41 PolarHBondContact O-OG1 2.99Å; T41-I44 PolarHBondContact O-N 3.39Å; T41-F45 WeakPolarHBondContact O-CB 3.33Å; T41-F45 PolarHBondContact O-N 2.97Å
42	K	81	Confident	83.8	Confident	153 Å²	153	105 Å²	105	67%	0.665	54%	0.535	S	S	*	.	H	α-helix	trans	-63.5	-41.1	174.6	-173.7	175.8	-178.7	179.6	0	111.9	L38 T39 F45 T46	L38-K42 VanDerWaalsContact O-CB 3.27Å; L38-K42 WeakPolarHBondContact O-CB 3.34Å; L38-K42 PolarHBondContact O-N 3.24Å; T39-K42 PolarHBondContact O-N 2.94Å; K42-F45 PolarHBondContact O-N 3.42Å; K42-T46 WeakPolarHBondContact O-CB 3.27Å; K42-T46 PolarHBondContact O-N 3.4Å; K42-T46 PolarHBondContact O-OG1 3.46Å
43	L	82	Confident	83.7	Confident	106 Å²	106	102.3 Å²	102.3	56%	0.555	52%	0.524	S	S	*	.	H	α-helix	trans	-62	-51.1	176.3	-175.5	68.2	0	0	0	110.7	T39 L40 F45 T46 C47	T39-L43 VanDerWaalsContact O-CB 3.31Å; T39-L43 WeakPolarHBondContact O-CB 3.48Å; T39-L43 PolarHBondContact O-N 2.89Å; L40-L43 PolarHBondContact O-N 2.99Å; L43-F45 VanDerWaalsContact C-N 3.34Å; L43-F45 PolarHBondContact O-N 3.19Å; L43-T46 PolarHBondContact O-N 3.41Å; L43-C47 WeakPolarHBondContact O-CB 3.38Å; L43-C47 PolarHBondContact O-N 2.85Å; L43-C47 PolarHBondContact O-SG 2.91Å
44	I	81.4	Confident	83.4	Confident	97 Å²	97	101.3 Å²	101.3	50%	0.497	53%	0.528	S	S	.	.	H	α-helix	trans	-57.6	-47.8	177.5	-67.1	166.3	0	0	0	110.5	L40 T41 T46 C47 S48	L40-I44 HydrophobicContact CD1-CD1 4.37Å; L40-I44 HydrophobicContact CG-CD1 4.07Å; L40-I44 VanDerWaalsContact O-CG1 3.29Å; L40-I44 WeakPolarHBondContact O-CG1 3.31Å; L40-I44 PolarHBondContact O-N 3.39Å; T41-I44 PolarHBondContact O-N 3.39Å; I44-T46 VanDerWaalsContact C-N 3.33Å; I44-T46 PolarHBondContact O-N 3.19Å; I44-C47 PolarHBondContact O-N 2.91Å; I44-S48 PolarHBondContact O-N 2.88Å; I44-S48 PolarHBondContact O-OG 3.34Å
45	F	82.3	Confident	83.2	Confident	147 Å²	147	104.6 Å²	104.6	65%	0.645	54%	0.539	S	S	*	.	H	α-helix	trans	-60.1	-42.6	178.5	-174.8	-94.7	0	0	0	112.3	T41 K42 L43 S48 Y49	T41-F45 WeakPolarHBondContact O-CB 3.33Å; T41-F45 PolarHBondContact O-N 2.97Å; K42-F45 PolarHBondContact O-N 3.42Å; L43-F45 VanDerWaalsContact C-N 3.34Å; L43-F45 PolarHBondContact O-N 3.19Å; F45-S48 PolarHBondContact O-N 3.48Å; F45-Y49 WeakPolarHBondContact O-CB 3.35Å; F45-Y49 PolarHBondContact O-N 3.3Å
46	T	85.1	Confident	82.9	Confident	62 Å²	62	106.4 Å²	106.4	38%	0.38	55%	0.545	S	S	.	.	H	α-helix	trans	-66.7	-42.5	179	-53.9	0	0	0	0	111.1	K42 L43 I44 Y49 L50	K42-T46 WeakPolarHBondContact O-CB 3.27Å; K42-T46 PolarHBondContact O-N 3.4Å; K42-T46 PolarHBondContact O-OG1 3.46Å; L43-T46 PolarHBondContact O-N 3.41Å; I44-T46 VanDerWaalsContact C-N 3.33Å; I44-T46 PolarHBondContact O-N 3.19Å; T46-Y49 PolarHBondContact O-N 3.43Å; T46-L50 HydrophobicContact CG2-CD1 4.26Å; T46-L50 WeakPolarHBondContact O-CG 3.46Å; T46-L50 PolarHBondContact O-N 3.04Å
47	C	80.5	Confident	82.4	Confident	66 Å²	66	102.3 Å²	102.3	45%	0.446	53%	0.533	S	S	.	.	H	α-helix	trans	-59.9	-48.7	174.5	-68.5	0	0	0	0	111.4	L43 I44 Y49 L50 V51	L43-C47 WeakPolarHBondContact O-CB 3.38Å; L43-C47 PolarHBondContact O-N 2.85Å; L43-C47 PolarHBondContact O-SG 2.91Å; I44-C47 PolarHBondContact O-N 2.91Å; C47-Y49 VanDerWaalsContact C-N 3.35Å; C47-Y49 PolarHBondContact O-N 3.44Å; C47-L50 PolarHBondContact O-N 3.37Å; C47-V51 WeakPolarHBondContact O-CG2 3.37Å; C47-V51 PolarHBondContact O-N 3.35Å
48	S	85.1	Confident	81.8	Confident	68 Å²	68	101.8 Å²	101.8	48%	0.476	54%	0.542	S	S	.	.	H	α-helix	trans	-61.6	-40.7	176.6	-62.5	0	0	0	0	112.4	I44 F45 V51 S52	I44-S48 PolarHBondContact O-N 2.88Å; I44-S48 PolarHBondContact O-OG 3.34Å; F45-S48 PolarHBondContact O-N 3.48Å; S48-V51 PolarHBondContact O-N 3.13Å; S48-S52 WeakPolarHBondContact O-CB 3.32Å; S48-S52 PolarHBondContact O-N 2.72Å; S48-S52 PolarHBondContact O-OG 2.95Å; S48-S52 VanDerWaalsContact O-OG 3.13Å
49	Y	85.6	Confident	81.1	Confident	144 Å²	144	101.1 Å²	101.1	57%	0.565	55%	0.546	S	S	*	.	H	α-helix	trans	-62.7	-45.5	177.3	179.2	-96	0	0	0	112.1	F45 T46 C47 S52 H53	F45-Y49 WeakPolarHBondContact O-CB 3.35Å; F45-Y49 PolarHBondContact O-N 3.3Å; T46-Y49 PolarHBondContact O-N 3.43Å; C47-Y49 VanDerWaalsContact C-N 3.35Å; C47-Y49 PolarHBondContact O-N 3.44Å; Y49-S52 PolarHBondContact O-N 2.86Å; Y49-H53 WeakPolarHBondContact O-CB 3.5Å; Y49-H53 PolarHBondContact O-N 3.34Å
50	L	85.9	Confident	80.1	Confident	98 Å²	98	98.6 Å²	98.6	51%	0.513	54%	0.539	S	S	.	.	H	α-helix	trans	-63.9	-41.6	178.1	-72.5	172.9	0	0	0	111.9	T46 C47 H53 L54	T46-L50 HydrophobicContact CG2-CD1 4.26Å; T46-L50 WeakPolarHBondContact O-CG 3.46Å; T46-L50 PolarHBondContact O-N 3.04Å; C47-L50 PolarHBondContact O-N 3.37Å; L50-H53 PolarHBondContact O-N 2.97Å; L50-L54 WeakPolarHBondContact O-CB 3.47Å; L50-L54 VanDerWaalsContact O-CG 3.3Å; L50-L54 WeakPolarHBondContact O-CG 3.32Å; L50-L54 PolarHBondContact O-N 3.45Å
51	V	82.7	Confident	79.1	Confident	94 Å²	94	96.5 Å²	96.5	57%	0.57	54%	0.541	S	S	*	.	H	α-helix	trans	-63.2	-46.5	176.1	172.6	0	0	0	0	110.8	C47 S48 H53 L54 Q55	C47-V51 WeakPolarHBondContact O-CG2 3.37Å; C47-V51 PolarHBondContact O-N 3.35Å; S48-V51 PolarHBondContact O-N 3.13Å; V51-H53 VanDerWaalsContact C-N 3.33Å; V51-H53 PolarHBondContact O-N 2.95Å; V51-L54 PolarHBondContact O-N 2.85Å; V51-Q55 WeakPolarHBondContact O-CB 3.37Å; V51-Q55 PolarHBondContact O-N 3.21Å
52	S	82.8	Confident	77.8	Confident	65 Å²	65	100.6 Å²	100.6	46%	0.455	56%	0.557	S	S	.	*	H	α-helix	trans	-60.9	-41.2	175.4	-66.8	0	0	0	0	112.2	S48 Y49 Q55 T56	S48-S52 WeakPolarHBondContact O-CB 3.32Å; S48-S52 PolarHBondContact O-N 2.72Å; S48-S52 PolarHBondContact O-OG 2.95Å; S48-S52 VanDerWaalsContact O-OG 3.13Å; Y49-S52 PolarHBondContact O-N 2.86Å; S52-Q55 PolarHBondContact O-N 3.3Å; S52-T56 WeakPolarHBondContact O-CG2 3.35Å; S52-T56 PolarHBondContact O-N 3.37Å; S52-T56 PolarHBondContact O-OG1 2.9Å
53	H	83.7	Confident	76.5	Confident	94 Å²	94	102.3 Å²	102.3	44%	0.435	57%	0.565	S	S	.	*	H	α-helix	trans	-67.6	-38.9	178.9	-170.8	-83.1	0	0	0	112.4	Y49 L50 V51 Q55 T56 T57	Y49-H53 WeakPolarHBondContact O-CB 3.5Å; Y49-H53 PolarHBondContact O-N 3.34Å; L50-H53 PolarHBondContact O-N 2.97Å; V51-H53 VanDerWaalsContact C-N 3.33Å; V51-H53 PolarHBondContact O-N 2.95Å; H53-Q55 VanDerWaalsContact C-N 3.35Å; H53-T56 WeakPolarHBondContact CA-OG1 3.38Å; H53-T56 PolarHBondContact O-N 3.33Å; H53-T56 PolarHBondContact O-OG1 2.86Å; H53-T57 PolarHBondContact CE1-OG1 2.86Å; H53-T57 PolarHBondContact ND1-OG1 3.43Å; H53-T57 VanDerWaalsContact O-CB 3.3Å; H53-T57 WeakPolarHBondContact O-CB 3.3Å; H53-T57 PolarHBondContact O-N 2.96Å; H53-T57 PolarHBondContact O-OG1 2.9Å
54	L	81.8	Confident	74.8	Confident	119 Å²	119	108.6 Å²	108.6	62%	0.623	59%	0.594	S	S	*	*	H	α-helix	trans	-64.9	-41.2	173.4	-72.9	171.2	0	0	0	111	L50 V51 T57 L58	L50-L54 WeakPolarHBondContact O-CB 3.47Å; L50-L54 VanDerWaalsContact O-CG 3.3Å; L50-L54 WeakPolarHBondContact O-CG 3.32Å; L50-L54 PolarHBondContact O-N 3.45Å; V51-L54 PolarHBondContact O-N 2.85Å; L54-T57 PolarHBondContact O-N 3.49Å; L54-L58 WeakPolarHBondContact O-CB 3.3Å; L54-L58 PolarHBondContact O-N 3.44Å
55	Q	81	Confident	74.5	Confident	136 Å²	136	109.2 Å²	109.2	64%	0.636	60%	0.599	S	S	*	*	H	α-helix	trans	-64.8	-42.6	176.5	-172.2	176.4	-2.1	0	0	112	V51 S52 H53 L58 S59	V51-Q55 WeakPolarHBondContact O-CB 3.37Å; V51-Q55 PolarHBondContact O-N 3.21Å; S52-Q55 PolarHBondContact O-N 3.3Å; H53-Q55 VanDerWaalsContact C-N 3.35Å; Q55-L58 PolarHBondContact O-N 2.82Å; Q55-S59 VanDerWaalsContact O-CB 3.32Å; Q55-S59 WeakPolarHBondContact O-CB 3.46Å; Q55-S59 PolarHBondContact O-N 2.82Å
56	T	79.9	Confident	74.1	Confident	89 Å²	89	107.2 Å²	107.2	55%	0.546	60%	0.597	S	S	.	*	H	α-helix	trans	-67.7	-36	175.3	56.2	0	0	0	0	111.8	S52 H53 G60	S52-T56 WeakPolarHBondContact O-CG2 3.35Å; S52-T56 PolarHBondContact O-N 3.37Å; S52-T56 PolarHBondContact O-OG1 2.9Å; H53-T56 WeakPolarHBondContact CA-OG1 3.38Å; H53-T56 PolarHBondContact O-N 3.33Å; H53-T56 PolarHBondContact O-OG1 2.86Å; T56-G60 PolarHBondContact O-N 3.49Å
57	T	76.6	Confident	73.5	Confident	76 Å²	76	109.7 Å²	109.7	47%	0.466	61%	0.609	S	S	.	*	H	α-helix	trans	-66.5	-42.2	175.3	-55.3	0	0	0	0	111	H53 L54 G60 G61	H53-T57 PolarHBondContact CE1-OG1 2.86Å; H53-T57 PolarHBondContact ND1-OG1 3.43Å; H53-T57 VanDerWaalsContact O-CB 3.3Å; H53-T57 WeakPolarHBondContact O-CB 3.3Å; H53-T57 PolarHBondContact O-N 2.96Å; H53-T57 PolarHBondContact O-OG1 2.9Å; L54-T57 PolarHBondContact O-N 3.49Å; T57-G60 PolarHBondContact O-N 2.68Å; T57-G61 WeakPolarHBondContact O-CA 3.36Å; T57-G61 PolarHBondContact O-N 3.48Å
58	L	70.6	Confident	73.1	Confident	143 Å²	143	112.3 Å²	112.3	75%	0.749	62%	0.618	S	S	*	*	H	α-helix	trans	-67.2	-43.6	177.5	-161.8	109.2	0	0	0	111.4	L54 Q55 M62	L54-L58 WeakPolarHBondContact O-CB 3.3Å; L54-L58 PolarHBondContact O-N 3.44Å; Q55-L58 PolarHBondContact O-N 2.82Å; L58-M62 PolarHBondContact O-N 3.42Å
59	S	69.6	Low	72.3	Confident	93 Å²	93	115.1 Å²	115.1	65%	0.65	63%	0.627	S	S	*	*	H	α-helix	trans	-71.6	-28.1	178.3	-172	0	0	0	0	113.3	Q55	Q55-S59 VanDerWaalsContact O-CB 3.32Å; Q55-S59 WeakPolarHBondContact O-CB 3.46Å; Q55-S59 PolarHBondContact O-N 2.82Å
60	G	63.2	Low	71.4	Confident	45 Å²	45	113.1 Å²	113.1	46%	0.464	63%	0.631	S	S	.	*	H	α-helix	trans	-85.1	-29.6	175.8	0	0	0	0	0	113.4	T56 T57 M62	T56-G60 PolarHBondContact O-N 3.49Å; T57-G60 PolarHBondContact O-N 2.68Å; G60-M62 VanDerWaalsContact C-N 3.34Å
61	G	59.1	Low	70.4	Confident	55 Å²	55	114.2 Å²	114.2	57%	0.567	64%	0.64	S	S	*	*	H	α-helix	trans	-76.9	-14.9	179.5	0	0	0	0	0	114.5	T57 K63	T57-G61 WeakPolarHBondContact O-CA 3.36Å; T57-G61 PolarHBondContact O-N 3.48Å; G61-K63 PolarHBondContact O-N 3.29Å
62	M	54.5	Low	69.4	Low	162 Å²	162	115.8 Å²	115.8	80%	0.798	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.2	25.7	173.3	-140	170.4	86	0	0	113.2	L58 G60	L58-M62 PolarHBondContact O-N 3.42Å; G60-M62 VanDerWaalsContact C-N 3.34Å
63	K	52.3	Low	68.3	Low	189 Å²	189	120 Å²	120	82%	0.822	66%	0.661	S	S	*	*			trans	-102.4	23.2	167.9	-74.6	-168.9	174.5	-177.5	0	112.9	G61	G61-K63 PolarHBondContact O-N 3.29Å
64	M	47.7	Very low	66.9	Low	239 Å²	239	122.4 Å²	122.4	100%	1.177	68%	0.682	S	S	*	*			trans	-93.6	0	157.2	-66	-174.4	93.2	0	0	108.2

Retrieved 64 of 64 residues in 37.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).