A0A5K4F583_SCHMA Loading...

RNMT-activating mRNA cap methyltransferase subunit

AlphaFold DB , UniProt , Accession A0A5K4F583, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 77 aa.

						>A0A5K4F583_SCHMA|A0A5K4F583
MSETPDRLISLEELETMFKDRYTDKDVNYQKYLSNANVPPPIIPHWDEINRERFNHRSQRNNNYRFQRNNFRRNSLD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.8	Very low	70.2	Confident	234 Å²	234	141.1 Å²	141.1	100%	1.153	75%	0.749	S	S	*	*				0	104.2	0	-68.3	-61.1	-166.6	0	0	106.1	E3	M1-E3 PolarHBondContact O-N 3.12Å; M1-E3 VanDerWaalsContact O-N 3.12Å
2	S	46.9	Very low	72.3	Confident	116 Å²	116	141.4 Å²	141.4	81%	0.811	74%	0.743	S	S	*	*			trans	-76.5	97.4	-174.5	51.4	0	0	0	0	109.8	T4	S2-T4 PolarHBondContact O-N 3.21Å
3	E	53.8	Low	74.1	Confident	184 Å²	184	135.2 Å²	135.2	86%	0.86	71%	0.708	S	S	*	*			trans	-59.9	110.7	156.9	-74.4	168	175.8	0	0	107.2	M1 P5	M1-E3 PolarHBondContact O-N 3.12Å; M1-E3 VanDerWaalsContact O-N 3.12Å; E3-P5 WeakPolarHBondContact O-CD 3.41Å
4	T	63.2	Low	75.6	Confident	124 Å²	124	130.4 Å²	130.4	76%	0.761	68%	0.682	S	S	*	*			trans	-69.4	117.7	168.6	45.2	0	0	0	0	107.8	S2	S2-T4 PolarHBondContact O-N 3.21Å
5	P	57.5	Low	77	Confident	111 Å²	111	129.8 Å²	129.8	72%	0.721	68%	0.675	S	S	*	*			trans	-74.4	133.2	-173.7	31.4	-33.8	0	0	0	110.2	E3 R7	E3-P5 WeakPolarHBondContact O-CD 3.41Å; P5-R7 PolarHBondContact O-N 2.7Å
6	D	69.5	Low	78.2	Confident	172 Å²	172	127.3 Å²	127.3	92%	0.92	67%	0.667	S	S	*	*			trans	27.1	38.9	158.4	-69.6	-13.3	0	0	0	118.8	L8	D6-L8 PolarHBondContact O-N 3.12Å
7	R	80.7	Confident	79.2	Confident	179 Å²	179	127.4 Å²	127.4	68%	0.675	67%	0.665	S	S	*	*			trans	-79.6	114.2	170.4	-175.7	179.2	173.9	-173.1	-2.9	107.6	P5 I9 E13	P5-R7 PolarHBondContact O-N 2.7Å; R7-I9 PolarHBondContact O-N 2.6Å; R7-I9 VanDerWaalsContact O-N 3.12Å; R7-E13 IonicContact CZ-OE1 3.43Å; R7-E13 IonicContact NH1-OE1 3.93Å; R7-E13 IonicContact NH2-OE1 2.6Å; R7-E13 PolarHBondContact NH2-OE1 3.32Å; R7-E13 IonicContact NH2-OE2 3.68Å
8	L	85.3	Confident	80.1	Confident	164 Å²	164	125.6 Å²	125.6	86%	0.859	65%	0.652	S	S	*	*			trans	-61.1	115	164.8	-63.4	179.2	0	0	0	108.1	D6	D6-L8 PolarHBondContact O-N 3.12Å
9	I	87.7	Confident	81	Confident	91 Å²	91	126.6 Å²	126.6	47%	0.467	65%	0.65	S	S	.	*			trans	-73.4	130.9	173.7	-56	172	0	0	0	107.2	R7 E13 L14	R7-I9 PolarHBondContact O-N 2.6Å; R7-I9 VanDerWaalsContact O-N 3.12Å; I9-E13 HydrophobicContact CG2-CB 3.69Å; I9-L14 HydrophobicContact CB-CD2 4.41Å; I9-L14 HydrophobicContact CB-CG 4.45Å; I9-L14 HydrophobicContact CG2-CD2 3.73Å; I9-L14 HydrophobicContact CG2-CG 3.71Å
10	S	91.9	Very high	81.9	Confident	50 Å²	50	123 Å²	123	35%	0.35	63%	0.632	S	S	.	*			trans	-72.9	159.9	178.4	83	0	0	0	0	111.3	E12 E13 L14	S10-E12 VanDerWaalsContact C-N 3.29Å; S10-E12 PolarHBondContact O-N 3.45Å; S10-E12 PolarHBondContact OG-N 3.08Å; S10-E13 PolarHBondContact N-OE2 2.86Å; S10-E13 VanDerWaalsContact N-OE2 3.08Å; S10-E13 PolarHBondContact O-N 2.84Å; S10-E13 WeakPolarHBondContact OG-CG 3.37Å; S10-E13 PolarHBondContact OG-N 3.06Å; S10-L14 WeakPolarHBondContact O-CG 3.47Å; S10-L14 PolarHBondContact O-N 2.99Å; S10-L14 VanDerWaalsContact O-N 3.08Å
11	L	95	Very high	82.6	Confident	127 Å²	127	122.6 Å²	122.6	67%	0.665	62%	0.623	S	S	*	*	H	α-helix	trans	-58.5	-43.7	173.2	-170.8	100.1	0	0	0	111.1	E13 L14 E15	L11-E13 VanDerWaalsContact C-N 3.31Å; L11-E13 PolarHBondContact O-N 3.28Å; L11-L14 WeakPolarHBondContact O-CB 3.43Å; L11-L14 PolarHBondContact O-N 3.37Å; L11-L14 VanDerWaalsContact O-N 3.11Å; L11-E15 VanDerWaalsContact CD2-OE1 3.26Å; L11-E15 WeakPolarHBondContact CD2-OE1 3.22Å; L11-E15 HydrophobicContact CG-CG 4.47Å; L11-E15 WeakPolarHBondContact O-CG 3.34Å; L11-E15 PolarHBondContact O-N 3.5Å
12	E	95.4	Very high	85.2	Confident	145 Å²	145	119.2 Å²	119.2	68%	0.678	60%	0.598	S	S	*	*	H	α-helix	trans	-61.8	-37.8	179.5	-175.5	178.3	-167.2	0	0	112.2	S10 E15 T16	S10-E12 VanDerWaalsContact C-N 3.29Å; S10-E12 PolarHBondContact O-N 3.45Å; S10-E12 PolarHBondContact OG-N 3.08Å; E12-E15 PolarHBondContact O-N 2.82Å; E12-T16 WeakPolarHBondContact O-CB 3.47Å; E12-T16 PolarHBondContact O-N 3.11Å; E12-T16 PolarHBondContact O-OG1 3.39Å
13	E	95.1	Very high	87.6	Confident	61 Å²	61	116.3 Å²	116.3	29%	0.285	58%	0.576	S	S	.	*	H	α-helix	trans	-64.7	-44.4	173.2	-74.6	178.1	152.3	0	0	111.2	R7 I9 S10 L11 T16 M17	R7-E13 IonicContact CZ-OE1 3.43Å; R7-E13 IonicContact NH1-OE1 3.93Å; R7-E13 IonicContact NH2-OE1 2.6Å; R7-E13 PolarHBondContact NH2-OE1 3.32Å; R7-E13 IonicContact NH2-OE2 3.68Å; I9-E13 HydrophobicContact CG2-CB 3.69Å; S10-E13 PolarHBondContact N-OE2 2.86Å; S10-E13 VanDerWaalsContact N-OE2 3.08Å; S10-E13 PolarHBondContact O-N 2.84Å; S10-E13 WeakPolarHBondContact OG-CG 3.37Å; S10-E13 PolarHBondContact OG-N 3.06Å; L11-E13 VanDerWaalsContact C-N 3.31Å; L11-E13 PolarHBondContact O-N 3.28Å; E13-T16 PolarHBondContact O-N 3.31Å; E13-M17 WeakPolarHBondContact O-CB 3.26Å; E13-M17 WeakPolarHBondContact O-CG 3.4Å; E13-M17 PolarHBondContact O-N 3.31Å
14	L	95.5	Very high	89.6	Confident	67 Å²	67	114.3 Å²	114.3	35%	0.351	57%	0.571	S	S	.	*	H	α-helix	trans	-64	-43.6	176.2	-67.6	172.5	0	0	0	111.8	I9 S10 L11 T16 M17 F18	I9-L14 HydrophobicContact CB-CD2 4.41Å; I9-L14 HydrophobicContact CB-CG 4.45Å; I9-L14 HydrophobicContact CG2-CD2 3.73Å; I9-L14 HydrophobicContact CG2-CG 3.71Å; S10-L14 WeakPolarHBondContact O-CG 3.47Å; S10-L14 PolarHBondContact O-N 2.99Å; S10-L14 VanDerWaalsContact O-N 3.08Å; L11-L14 WeakPolarHBondContact O-CB 3.43Å; L11-L14 PolarHBondContact O-N 3.37Å; L11-L14 VanDerWaalsContact O-N 3.11Å; L14-T16 VanDerWaalsContact C-N 3.25Å; L14-T16 PolarHBondContact O-N 3.08Å; L14-M17 PolarHBondContact O-N 3.43Å; L14-F18 HydrophobicContact CB-CD2 4.48Å; L14-F18 HydrophobicContact CD2-CD2 4.36Å; L14-F18 HydrophobicContact CD2-CE2 3.94Å; L14-F18 WeakPolarHBondContact O-CB 3.42Å; L14-F18 VanDerWaalsContact O-CD2 3.26Å; L14-F18 WeakPolarHBondContact O-CD2 3.47Å; L14-F18 PolarHBondContact O-N 3.43Å
15	E	96.4	Very high	91.2	Very high	122 Å²	122	115.9 Å²	115.9	57%	0.57	57%	0.567	S	S	*	*	H	α-helix	trans	-58.7	-40.7	176	-74.9	176.5	170.1	0	0	111.2	L11 E12 F18 K19	L11-E15 VanDerWaalsContact CD2-OE1 3.26Å; L11-E15 WeakPolarHBondContact CD2-OE1 3.22Å; L11-E15 HydrophobicContact CG-CG 4.47Å; L11-E15 WeakPolarHBondContact O-CG 3.34Å; L11-E15 PolarHBondContact O-N 3.5Å; E12-E15 PolarHBondContact O-N 2.82Å; E15-F18 CarbonylContact O-C 3.57Å; E15-K19 VanDerWaalsContact O-CA 3.28Å; E15-K19 WeakPolarHBondContact O-CA 3.28Å; E15-K19 WeakPolarHBondContact O-CB 3.26Å; E15-K19 PolarHBondContact O-N 3.37Å
16	T	96.3	Very high	93.2	Very high	90 Å²	90	112 Å²	112	55%	0.552	54%	0.54	S	S	*	.	H	α-helix	trans	-69.9	-45.2	176.6	-57.2	0	0	0	0	112	E12 E13 L14 F18 K19	E12-T16 WeakPolarHBondContact O-CB 3.47Å; E12-T16 PolarHBondContact O-N 3.11Å; E12-T16 PolarHBondContact O-OG1 3.39Å; E13-T16 PolarHBondContact O-N 3.31Å; L14-T16 VanDerWaalsContact C-N 3.25Å; L14-T16 PolarHBondContact O-N 3.08Å; T16-F18 VanDerWaalsContact C-N 3.26Å; T16-F18 PolarHBondContact O-N 2.96Å; T16-K19 WeakPolarHBondContact O-CG 3.38Å; T16-K19 PolarHBondContact O-N 2.91Å
17	M	94.8	Very high	94.4	Very high	129 Å²	129	109.2 Å²	109.2	64%	0.635	53%	0.53	S	S	*	.	H	α-helix	trans	-62.8	-33.5	179.4	-76.2	177.4	67.1	0	0	112.5	E13 L14	E13-M17 WeakPolarHBondContact O-CB 3.26Å; E13-M17 WeakPolarHBondContact O-CG 3.4Å; E13-M17 PolarHBondContact O-N 3.31Å; L14-M17 PolarHBondContact O-N 3.43Å
18	F	96.7	Very high	95.1	Very high	95 Å²	95	106.7 Å²	106.7	42%	0.417	53%	0.529	S	S	.	.	T	Hydrogen-bonded Turn	trans	-111.5	20.3	-177	-65.3	-75.3	0	0	0	113.3	L14 E15 T16 D20 R21	L14-F18 HydrophobicContact CB-CD2 4.48Å; L14-F18 HydrophobicContact CD2-CD2 4.36Å; L14-F18 HydrophobicContact CD2-CE2 3.94Å; L14-F18 WeakPolarHBondContact O-CB 3.42Å; L14-F18 VanDerWaalsContact O-CD2 3.26Å; L14-F18 WeakPolarHBondContact O-CD2 3.47Å; L14-F18 PolarHBondContact O-N 3.43Å; E15-F18 CarbonylContact O-C 3.57Å; T16-F18 VanDerWaalsContact C-N 3.26Å; T16-F18 PolarHBondContact O-N 2.96Å; F18-D20 PolarHBondContact O-N 2.93Å; F18-R21 HydrophobicContact CB-CB 4.17Å; F18-R21 WeakPolarHBondContact O-CB 3.42Å; F18-R21 PolarHBondContact O-N 3.06Å
19	K	97.1	Very high	95.7	Very high	145 Å²	145	102.4 Å²	102.4	63%	0.63	50%	0.502	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.7	-31.3	-178.4	70	-176.8	-177.4	179.7	0	114	E15 T16	E15-K19 VanDerWaalsContact O-CA 3.28Å; E15-K19 WeakPolarHBondContact O-CA 3.28Å; E15-K19 WeakPolarHBondContact O-CB 3.26Å; E15-K19 PolarHBondContact O-N 3.37Å; T16-K19 WeakPolarHBondContact O-CG 3.38Å; T16-K19 PolarHBondContact O-N 2.91Å
20	D	97.5	Very high	96.1	Very high	53 Å²	53	101.3 Å²	101.3	28%	0.283	50%	0.495	S	S	.	.	T	Hydrogen-bonded Turn	trans	-96.9	2.1	-176.8	-66.3	-50.8	0	0	0	112.1	F18 Y22 T23 K25 D26	F18-D20 PolarHBondContact O-N 2.93Å; D20-Y22 PolarHBondContact O-N 3.04Å; D20-T23 WeakPolarHBondContact O-CB 3.28Å; D20-T23 WeakPolarHBondContact O-CG2 3.1Å; D20-T23 PolarHBondContact O-N 3.38Å; D20-T23 PolarHBondContact O-OG1 2.64Å; D20-K25 HydrophobicContact CB-CB 3.96Å; D20-K25 VanDerWaalsContact OD1-CD 3.28Å; D20-K25 WeakPolarHBondContact OD1-CD 3.47Å; D20-D26 WeakPolarHBondContact O-CB 3.48Å
21	R	97	Very high	96.2	Very high	115 Å²	115	105.5 Å²	105.5	43%	0.434	51%	0.507	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.6	130.2	-174.8	-171.4	-168	-70.7	169.2	-6.1	111.4	F18 T23 D26	F18-R21 HydrophobicContact CB-CB 4.17Å; F18-R21 WeakPolarHBondContact O-CB 3.42Å; F18-R21 PolarHBondContact O-N 3.06Å; R21-T23 PolarHBondContact O-N 3.03Å; R21-D26 WeakPolarHBondContact CA-OD2 3.35Å
22	Y	96.6	Very high	96.2	Very high	163 Å²	163	107.4 Å²	107.4	64%	0.639	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	61.4	18.4	-177.5	-45.7	-56.3	0	0	0	115.5	D20 D26 Y29	D20-Y22 PolarHBondContact O-N 3.04Å; Y22-D26 PolarHBondContact N-OD2 3.23Å; Y22-Y29 AromaticContact CD1-CD2 3.88Å; Y22-Y29 HydrophobicContact CD1-CD2 3.88Å; Y22-Y29 HydrophobicContact CD1-CE2 4.26Å; Y22-Y29 HydrophobicContact CD1-CG 4.23Å; Y22-Y29 VanDerWaalsContact O-CE1 3.32Å; Y22-Y29 WeakPolarHBondContact O-CE1 3.34Å
23	T	96.9	Very high	96.2	Very high	55 Å²	55	104.9 Å²	104.9	34%	0.337	50%	0.497	S	S	.	.	S	Bend	trans	-99.2	178.1	171.3	74.2	0	0	0	0	111.3	D20 R21 K25 D26 Q30	D20-T23 WeakPolarHBondContact O-CB 3.28Å; D20-T23 WeakPolarHBondContact O-CG2 3.1Å; D20-T23 PolarHBondContact O-N 3.38Å; D20-T23 PolarHBondContact O-OG1 2.64Å; R21-T23 PolarHBondContact O-N 3.03Å; T23-K25 PolarHBondContact O-N 3.13Å; T23-K25 VanDerWaalsContact O-N 3.14Å; T23-K25 PolarHBondContact OG1-N 3.4Å; T23-D26 WeakPolarHBondContact O-CB 3.33Å; T23-D26 PolarHBondContact O-N 2.89Å; T23-D26 VanDerWaalsContact O-N 3.08Å; T23-Q30 PolarHBondContact O-NE2 3.44Å
24	D	96.2	Very high	96.1	Very high	143 Å²	143	106.3 Å²	106.3	77%	0.765	51%	0.514	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.6	-16.8	173.6	-63	-25.3	0	0	0	113.9	Q30	D24-Q30 PolarHBondContact OD1-NE2 3.3Å
25	K	97	Very high	95.9	Very high	157 Å²	157	107.6 Å²	107.6	68%	0.683	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.9	-12.8	177	-64.3	173.1	-178.4	174.4	0	113.2	D20 T23 V27	D20-K25 HydrophobicContact CB-CB 3.96Å; D20-K25 VanDerWaalsContact OD1-CD 3.28Å; D20-K25 WeakPolarHBondContact OD1-CD 3.47Å; T23-K25 PolarHBondContact O-N 3.13Å; T23-K25 VanDerWaalsContact O-N 3.14Å; T23-K25 PolarHBondContact OG1-N 3.4Å; K25-V27 PolarHBondContact O-N 2.96Å
26	D	97.5	Very high	95.5	Very high	29 Å²	29	105.9 Å²	105.9	16%	0.155	53%	0.528	C	S	.	.			trans	-79.2	98.5	177.5	-176.6	-16.2	0	0	0	110.4	D20 R21 Y22 T23 N28 Y29 Q30	D20-D26 WeakPolarHBondContact O-CB 3.48Å; R21-D26 WeakPolarHBondContact CA-OD2 3.35Å; Y22-D26 PolarHBondContact N-OD2 3.23Å; T23-D26 WeakPolarHBondContact O-CB 3.33Å; T23-D26 PolarHBondContact O-N 2.89Å; T23-D26 VanDerWaalsContact O-N 3.08Å; D26-N28 PolarHBondContact O-N 2.87Å; D26-N28 PolarHBondContact OD1-N 3.08Å; D26-Y29 VanDerWaalsContact CG-CB 3.41Å; D26-Y29 PolarHBondContact O-N 2.94Å; D26-Y29 VanDerWaalsContact O-N 3.13Å; D26-Y29 PolarHBondContact OD1-N 3.27Å; D26-Q30 WeakPolarHBondContact O-CG 3.37Å; D26-Q30 PolarHBondContact O-N 3.04Å
27	V	95.6	Very high	95.1	Very high	114 Å²	114	109.4 Å²	109.4	69%	0.691	54%	0.544	S	S	*	.	H	α-helix	trans	-55.8	-37.5	-178.8	179.1	0	0	0	0	112.3	K25 K31	K25-V27 PolarHBondContact O-N 2.96Å; V27-K31 WeakPolarHBondContact O-CB 3.5Å; V27-K31 PolarHBondContact O-N 3.17Å
28	N	95.6	Very high	94.8	Very high	126 Å²	126	109.5 Å²	109.5	67%	0.674	55%	0.551	S	S	*	*	H	α-helix	trans	-72.5	-40.2	-179.3	-70.5	-35.6	0	0	0	110.9	D26 K31 Y32	D26-N28 PolarHBondContact O-N 2.87Å; D26-N28 PolarHBondContact OD1-N 3.08Å; N28-K31 PolarHBondContact O-N 3.14Å; N28-Y32 WeakPolarHBondContact O-CB 3.32Å; N28-Y32 PolarHBondContact O-N 3.23Å
29	Y	96.8	Very high	94.6	Very high	74 Å²	74	109.7 Å²	109.7	29%	0.29	56%	0.562	S	S	.	*	H	α-helix	trans	-65.4	-43.5	175	-178.3	-122.5	0	0	0	112	Y22 D26 K31 Y32 L33	Y22-Y29 AromaticContact CD1-CD2 3.88Å; Y22-Y29 HydrophobicContact CD1-CD2 3.88Å; Y22-Y29 HydrophobicContact CD1-CE2 4.26Å; Y22-Y29 HydrophobicContact CD1-CG 4.23Å; Y22-Y29 VanDerWaalsContact O-CE1 3.32Å; Y22-Y29 WeakPolarHBondContact O-CE1 3.34Å; D26-Y29 VanDerWaalsContact CG-CB 3.41Å; D26-Y29 PolarHBondContact O-N 2.94Å; D26-Y29 VanDerWaalsContact O-N 3.13Å; D26-Y29 PolarHBondContact OD1-N 3.27Å; Y29-K31 VanDerWaalsContact C-N 3.32Å; Y29-K31 PolarHBondContact O-N 2.92Å; Y29-Y32 WeakPolarHBondContact O-CA 3.43Å; Y29-Y32 WeakPolarHBondContact O-CB 3.36Å; Y29-Y32 PolarHBondContact O-N 3.35Å; Y29-Y32 VanDerWaalsContact O-N 3.08Å; Y29-L33 HydrophobicContact CD1-CD1 4Å; Y29-L33 HydrophobicContact CD2-CG 4.44Å; Y29-L33 HydrophobicContact CE1-CD1 3.57Å; Y29-L33 HydrophobicContact CE1-CG 4.25Å; Y29-L33 HydrophobicContact CE2-CD1 4.32Å; Y29-L33 HydrophobicContact CE2-CD2 4.14Å; Y29-L33 HydrophobicContact CE2-CG 4.1Å; Y29-L33 WeakPolarHBondContact O-CG 3.42Å; Y29-L33 PolarHBondContact O-N 3.45Å
30	Q	96.6	Very high	94.4	Very high	67 Å²	67	107.9 Å²	107.9	31%	0.313	57%	0.565	S	S	.	*	H	α-helix	trans	-63.1	-39	175.2	-66.8	-55.7	-43.8	0	0	112	T23 D24 D26 Y32 L33 S34	T23-Q30 PolarHBondContact O-NE2 3.44Å; D24-Q30 PolarHBondContact OD1-NE2 3.3Å; D26-Q30 WeakPolarHBondContact O-CG 3.37Å; D26-Q30 PolarHBondContact O-N 3.04Å; Q30-Y32 VanDerWaalsContact C-N 3.32Å; Q30-Y32 PolarHBondContact O-N 3.46Å; Q30-L33 PolarHBondContact O-N 3.38Å; Q30-S34 PolarHBondContact O-N 3.08Å; Q30-S34 PolarHBondContact O-OG 3.48Å; Q30-S34 VanDerWaalsContact O-OG 3.13Å
31	K	95.5	Very high	94.2	Very high	138 Å²	138	111.1 Å²	111.1	60%	0.6	59%	0.589	S	S	*	*	H	α-helix	trans	-62.6	-40.6	171.7	-171.9	177	-179.9	-179.1	0	111.7	V27 N28 Y29 S34 N35	V27-K31 WeakPolarHBondContact O-CB 3.5Å; V27-K31 PolarHBondContact O-N 3.17Å; N28-K31 PolarHBondContact O-N 3.14Å; Y29-K31 VanDerWaalsContact C-N 3.32Å; Y29-K31 PolarHBondContact O-N 2.92Å; K31-S34 WeakPolarHBondContact CA-OG 3.47Å; K31-S34 PolarHBondContact O-N 3.42Å; K31-S34 PolarHBondContact O-OG 3.42Å; K31-N35 VanDerWaalsContact O-CG 3.31Å; K31-N35 PolarHBondContact O-N 3.13Å; K31-N35 PolarHBondContact O-ND2 3.23Å; K31-N35 PolarHBondContact O-OD1 2.99Å
32	Y	95	Very high	94	Very high	167 Å²	167	113 Å²	113	66%	0.655	61%	0.606	S	S	*	*	H	α-helix	trans	-62.8	-45.2	175.3	176.5	-95	0	0	0	112	N28 Y29 Q30 S34 N35	N28-Y32 WeakPolarHBondContact O-CB 3.32Å; N28-Y32 PolarHBondContact O-N 3.23Å; Y29-Y32 WeakPolarHBondContact O-CA 3.43Å; Y29-Y32 WeakPolarHBondContact O-CB 3.36Å; Y29-Y32 PolarHBondContact O-N 3.35Å; Y29-Y32 VanDerWaalsContact O-N 3.08Å; Q30-Y32 VanDerWaalsContact C-N 3.32Å; Q30-Y32 PolarHBondContact O-N 3.46Å; Y32-S34 VanDerWaalsContact C-N 3.31Å; Y32-S34 PolarHBondContact O-N 2.86Å; Y32-N35 WeakPolarHBondContact O-CB 3.45Å; Y32-N35 PolarHBondContact O-N 3.48Å
33	L	93.9	Very high	93.6	Very high	92 Å²	92	109.8 Å²	109.8	48%	0.482	60%	0.599	S	S	.	*	H	α-helix	trans	-64.7	-31.7	178	-70.2	177.3	0	0	0	113.5	Y29 Q30 N35	Y29-L33 HydrophobicContact CD1-CD1 4Å; Y29-L33 HydrophobicContact CD2-CG 4.44Å; Y29-L33 HydrophobicContact CE1-CD1 3.57Å; Y29-L33 HydrophobicContact CE1-CG 4.25Å; Y29-L33 HydrophobicContact CE2-CD1 4.32Å; Y29-L33 HydrophobicContact CE2-CD2 4.14Å; Y29-L33 HydrophobicContact CE2-CG 4.1Å; Y29-L33 WeakPolarHBondContact O-CG 3.42Å; Y29-L33 PolarHBondContact O-N 3.45Å; Q30-L33 PolarHBondContact O-N 3.38Å; L33-N35 VanDerWaalsContact C-N 3.33Å
34	S	93.1	Very high	93.2	Very high	91 Å²	91	111.4 Å²	111.4	64%	0.636	61%	0.61	S	S	*	*	H	α-helix	trans	-78.9	-13.9	177.4	59.2	0	0	0	0	114	Q30 K31 Y32 A36	Q30-S34 PolarHBondContact O-N 3.08Å; Q30-S34 PolarHBondContact O-OG 3.48Å; Q30-S34 VanDerWaalsContact O-OG 3.13Å; K31-S34 WeakPolarHBondContact CA-OG 3.47Å; K31-S34 PolarHBondContact O-N 3.42Å; K31-S34 PolarHBondContact O-OG 3.42Å; Y32-S34 VanDerWaalsContact C-N 3.31Å; Y32-S34 PolarHBondContact O-N 2.86Å; S34-A36 PolarHBondContact O-N 3.41Å
35	N	91.2	Very high	92.9	Very high	95 Å²	95	110.3 Å²	110.3	51%	0.508	60%	0.6	S	S	.	*	S	Bend	trans	-69.4	132.9	175.2	-69.9	-31.3	0	0	0	110	K31 Y32 L33	K31-N35 VanDerWaalsContact O-CG 3.31Å; K31-N35 PolarHBondContact O-N 3.13Å; K31-N35 PolarHBondContact O-ND2 3.23Å; K31-N35 PolarHBondContact O-OD1 2.99Å; Y32-N35 WeakPolarHBondContact O-CB 3.45Å; Y32-N35 PolarHBondContact O-N 3.48Å; L33-N35 VanDerWaalsContact C-N 3.33Å
36	A	88.1	Confident	92.3	Very high	86 Å²	86	109.8 Å²	109.8	71%	0.711	59%	0.594	S	S	*	*			trans	-60.7	145.4	167.7	0	0	0	0	0	109.9	S34 V38	S34-A36 PolarHBondContact O-N 3.41Å; A36-V38 PolarHBondContact O-N 3.02Å
37	N	87.6	Confident	91.6	Very high	164 Å²	164	113 Å²	113	88%	0.877	61%	0.611	S	S	*	*			trans	-55.4	115	174.3	-69.9	-33.2	0	0	0	109.5	P39	N37-P39 WeakPolarHBondContact O-CD 3.32Å
38	V	89.4	Confident	90.9	Very high	131 Å²	131	113 Å²	113	79%	0.794	60%	0.604	S	S	*	*	P	Polyproline II helix	trans	-71.8	120.3	177.7	-178.6	0	0	0	0	107.7	A36	A36-V38 PolarHBondContact O-N 3.02Å
39	P	91.7	Very high	89.8	Confident	98 Å²	98	111 Å²	111	64%	0.636	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-64	150.5	176.3	27.9	-34	0	0	0	109.9	N37	N37-P39 WeakPolarHBondContact O-CD 3.32Å
40	P	93.8	Very high	88.4	Confident	107 Å²	107	109.8 Å²	109.8	70%	0.695	59%	0.591	S	S	*	*	P	Polyproline II helix	trans	-59	152.3	175.8	26.6	-34.6	0	0	0	110.8	I42	P40-I42 PolarHBondContact O-N 3.37Å
41	P	93.4	Very high	86.8	Confident	122 Å²	122	114 Å²	114	79%	0.792	60%	0.604	S	S	*	*	P	Polyproline II helix	trans	-63	130.9	-179.8	26.6	-34.1	0	0	0	110.8
42	I	91.7	Very high	85.1	Confident	153 Å²	153	114.4 Å²	114.4	79%	0.785	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-98.7	120.9	172.1	-60.2	173.4	0	0	0	107.5	P40 P44	P40-I42 PolarHBondContact O-N 3.37Å; I42-P44 WeakPolarHBondContact O-CD 3.44Å
43	I	89.3	Confident	83.4	Confident	96 Å²	96	115.6 Å²	115.6	49%	0.492	61%	0.611	S	S	.	*			trans	-95.1	106.8	174.9	-55.6	172.2	0	0	0	107.9	W46 I49	I43-W46 HydrophobicContact CB-CE3 4.3Å; I43-W46 HydrophobicContact CD1-CE3 3.91Å; I43-W46 HydrophobicContact CD1-CZ3 3.82Å; I43-W46 HydrophobicContact CG2-CE3 3.94Å; I43-I49 HydrophobicContact CG2-CD1 4.15Å
44	P	88.6	Confident	81.8	Confident	90 Å²	90	118.4 Å²	118.4	58%	0.584	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.3	147.8	175.5	31.1	-35.4	0	0	0	109.6	I42 W46	I42-P44 WeakPolarHBondContact O-CD 3.44Å; P44-W46 VanDerWaalsContact C-N 3.28Å; P44-W46 PolarHBondContact O-N 3.47Å
45	H	88.7	Confident	80.2	Confident	120 Å²	120	118.6 Å²	118.6	56%	0.556	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	58.3	32.3	175.3	-50.7	-78.3	0	0	0	115.2	D47 E48 I49	H45-D47 PolarHBondContact O-N 3.46Å; H45-E48 HydrophobicContact CB-CB 4.09Å; H45-E48 HydrophobicContact CB-CG 4.07Å; H45-E48 IonicContact CE1-OE1 3.71Å; H45-E48 IonicContact CG-OE1 3.55Å; H45-E48 IonicContact CG-OE2 3.78Å; H45-E48 IonicContact ND1-OE1 2.76Å; H45-E48 PolarHBondContact ND1-OE1 3.34Å; H45-E48 IonicContact ND1-OE2 3.68Å; H45-E48 WeakPolarHBondContact O-CB 3.14Å; H45-E48 PolarHBondContact O-N 3.42Å; H45-I49 PolarHBondContact O-N 3.21Å
46	W	85.5	Confident	78.5	Confident	145 Å²	145	121 Å²	121	55%	0.549	62%	0.622	S	S	.	*	H	α-helix	trans	-50	-36.1	176.7	-178.6	-107.4	0	0	0	113.4	I43 P44 I49 N50	I43-W46 HydrophobicContact CB-CE3 4.3Å; I43-W46 HydrophobicContact CD1-CE3 3.91Å; I43-W46 HydrophobicContact CD1-CZ3 3.82Å; I43-W46 HydrophobicContact CG2-CE3 3.94Å; P44-W46 VanDerWaalsContact C-N 3.28Å; P44-W46 PolarHBondContact O-N 3.47Å; W46-I49 HydrophobicContact CE3-CD1 4.5Å; W46-N50 PolarHBondContact NE1-ND2 2.76Å; W46-N50 PolarHBondContact O-N 2.88Å; W46-N50 PolarHBondContact O-ND2 3.25Å
47	D	83.3	Confident	77	Confident	97 Å²	97	127.4 Å²	127.4	52%	0.519	63%	0.627	S	S	.	*	H	α-helix	trans	-68.1	-34.1	177.2	-74.9	-5	0	0	0	113.3	H45 N50 R51	H45-D47 PolarHBondContact O-N 3.46Å; D47-N50 PolarHBondContact O-N 3.29Å; D47-R51 WeakPolarHBondContact O-CB 3.18Å; D47-R51 WeakPolarHBondContact O-CG 3.49Å; D47-R51 PolarHBondContact O-N 3.24Å; D47-R51 IonicContact OD2-NH2 3.66Å
48	E	79.6	Confident	75.6	Confident	115 Å²	115	122.6 Å²	122.6	54%	0.537	61%	0.607	S	S	.	*	H	α-helix	trans	-69.8	-41.5	-178.8	-65.3	173.3	-154.6	0	0	110.7	H45 N50 R51	H45-E48 HydrophobicContact CB-CB 4.09Å; H45-E48 HydrophobicContact CB-CG 4.07Å; H45-E48 IonicContact CE1-OE1 3.71Å; H45-E48 IonicContact CG-OE1 3.55Å; H45-E48 IonicContact CG-OE2 3.78Å; H45-E48 IonicContact ND1-OE1 2.76Å; H45-E48 PolarHBondContact ND1-OE1 3.34Å; H45-E48 IonicContact ND1-OE2 3.68Å; H45-E48 WeakPolarHBondContact O-CB 3.14Å; H45-E48 PolarHBondContact O-N 3.42Å; E48-N50 PolarHBondContact O-N 3.38Å; E48-R51 PolarHBondContact O-N 3.06Å
49	I	72.4	Confident	74	Confident	83 Å²	83	123 Å²	123	43%	0.426	60%	0.6	S	S	.	*	H	α-helix	trans	-56.6	-35.6	174.8	-61.7	169.8	0	0	0	111.2	I43 H45 W46	I43-I49 HydrophobicContact CG2-CD1 4.15Å; H45-I49 PolarHBondContact O-N 3.21Å; W46-I49 HydrophobicContact CE3-CD1 4.5Å
50	N	68.7	Low	72.3	Confident	49 Å²	49	127.7 Å²	127.7	26%	0.262	61%	0.605	S	S	.	*	H	α-helix	trans	-86.3	-29.2	-179.1	-72.1	-58.7	0	0	0	113.2	W46 D47 E48 E52 R53 F54	W46-N50 PolarHBondContact NE1-ND2 2.76Å; W46-N50 PolarHBondContact O-N 2.88Å; W46-N50 PolarHBondContact O-ND2 3.25Å; D47-N50 PolarHBondContact O-N 3.29Å; E48-N50 PolarHBondContact O-N 3.38Å; N50-E52 VanDerWaalsContact C-N 3.33Å; N50-E52 PolarHBondContact O-N 3.46Å; N50-R53 PolarHBondContact O-N 3.24Å; N50-F54 WeakPolarHBondContact O-CD2 3.49Å
51	R	63.4	Low	70.6	Confident	154 Å²	154	127.8 Å²	127.8	58%	0.581	60%	0.599	S	S	*	*	H	α-helix	trans	-66	-31.7	-178.9	-78.8	170.8	-156.1	-115.6	5.7	113.2	D47 E48 R53 F54 N55	D47-R51 WeakPolarHBondContact O-CB 3.18Å; D47-R51 WeakPolarHBondContact O-CG 3.49Å; D47-R51 PolarHBondContact O-N 3.24Å; D47-R51 IonicContact OD2-NH2 3.66Å; E48-R51 PolarHBondContact O-N 3.06Å; R51-R53 PolarHBondContact O-N 2.89Å; R51-F54 PolarHBondContact O-N 3.35Å; R51-N55 PolarHBondContact O-N 3.28Å; R51-N55 PolarHBondContact O-ND2 3.28Å
52	E	59.4	Low	69	Low	147 Å²	147	125.9 Å²	125.9	69%	0.687	58%	0.583	S	S	*	*	H	α-helix	trans	-59.6	-32.2	176.3	-70.5	-171.2	162	0	0	112.5	N50 F54	N50-E52 VanDerWaalsContact C-N 3.33Å; N50-E52 PolarHBondContact O-N 3.46Å; E52-F54 PolarHBondContact O-N 3.21Å
53	R	59.5	Low	67.5	Low	193 Å²	193	123.3 Å²	123.3	73%	0.728	57%	0.57	S	S	*	*	H	α-helix	trans	-73.4	-26.7	-179.1	-60.9	-172.5	-176	-165.2	1.5	113.5	N50 R51	N50-R53 PolarHBondContact O-N 3.24Å; R51-R53 PolarHBondContact O-N 2.89Å
54	F	59.8	Low	66.1	Low	151 Å²	151	126.3 Å²	126.3	66%	0.662	58%	0.576	S	S	*	*	H	α-helix	trans	-90.2	-20.8	-175.8	-66.2	-73.6	0	0	0	113.7	N50 R51 E52 H56 R57	N50-F54 WeakPolarHBondContact O-CD2 3.49Å; R51-F54 PolarHBondContact O-N 3.35Å; E52-F54 PolarHBondContact O-N 3.21Å; F54-H56 VanDerWaalsContact C-N 3.33Å; F54-H56 PolarHBondContact O-N 3.4Å; F54-R57 PolarHBondContact O-N 3.17Å
55	N	58.3	Low	64.7	Low	94 Å²	94	130.6 Å²	130.6	50%	0.503	58%	0.581	S	S	.	*	H	α-helix	trans	-73.4	-19.9	-175.8	-72.1	-29.1	0	0	0	114.1	R51 R57 S58	R51-N55 PolarHBondContact O-N 3.28Å; R51-N55 PolarHBondContact O-ND2 3.28Å; N55-R57 VanDerWaalsContact C-N 3.3Å; N55-R57 PolarHBondContact O-N 2.98Å; N55-S58 PolarHBondContact O-OG 3.41Å
56	H	57.1	Low	63.3	Low	146 Å²	146	131.2 Å²	131.2	68%	0.676	58%	0.582	S	S	*	*	H	α-helix	trans	-72.9	-20.4	177.1	-68.2	-51.9	0	0	0	114	F54	F54-H56 VanDerWaalsContact C-N 3.33Å; F54-H56 PolarHBondContact O-N 3.4Å
57	R	55.1	Low	62	Low	221 Å²	221	129.2 Å²	129.2	83%	0.834	58%	0.579	S	S	*	*	H	α-helix	trans	-84.9	-31.1	-178	-156.5	173.3	-169.7	-174.7	2.8	112.7	F54 N55	F54-R57 PolarHBondContact O-N 3.17Å; N55-R57 VanDerWaalsContact C-N 3.3Å; N55-R57 PolarHBondContact O-N 2.98Å
58	S	58.2	Low	60.9	Low	63 Å²	63	132.2 Å²	132.2	44%	0.441	58%	0.583	S	S	.	*	H	α-helix	trans	-75	-31.6	-179.3	64.8	0	0	0	0	112.7	N55 N61	N55-S58 PolarHBondContact O-OG 3.41Å; S58-N61 PolarHBondContact O-N 3.04Å
59	Q	57.8	Low	60	Low	138 Å²	138	131.5 Å²	131.5	65%	0.645	58%	0.583	S	S	*	*	H	α-helix	trans	-69.7	-34.1	180	-70.8	-163.8	-7.9	0	0	113.3	N61	Q59-N61 VanDerWaalsContact C-N 3.31Å; Q59-N61 PolarHBondContact O-N 3.05Å
60	R	55.8	Low	59.4	Low	198 Å²	198	132.5 Å²	132.5	75%	0.747	59%	0.589	S	S	*	*	H	α-helix	trans	-65.5	-33.8	176.5	-83.9	-171.5	-178.8	178.9	-0.9	112.7	Y64	R60-Y64 WeakPolarHBondContact O-CD2 3.24Å
61	N	57.4	Low	59.1	Low	108 Å²	108	137.8 Å²	137.8	58%	0.578	61%	0.61	S	S	*	*	H	α-helix	trans	-80.8	-24	-172.3	-133.3	-3.9	0	0	0	113.4	S58 Q59	S58-N61 PolarHBondContact O-N 3.04Å; Q59-N61 VanDerWaalsContact C-N 3.31Å; Q59-N61 PolarHBondContact O-N 3.05Å
62	N	59.7	Low	58.9	Low	83 Å²	83	137.9 Å²	137.9	44%	0.444	61%	0.611	S	S	.	*	H	α-helix	trans	-73.9	-37.5	176.3	-77.8	-19	0	0	0	112	Y64 R65 F66	N62-Y64 VanDerWaalsContact C-N 3.31Å; N62-Y64 PolarHBondContact O-N 3.1Å; N62-R65 PolarHBondContact O-N 3.31Å; N62-R65 VanDerWaalsContact O-N 3.1Å; N62-F66 HydrophobicContact CB-CD2 4.27Å; N62-F66 HydrophobicContact CB-CE2 4.08Å; N62-F66 WeakPolarHBondContact O-CD2 3.43Å; N62-F66 PolarHBondContact O-N 3.4Å
63	N	60.3	Low	58.9	Low	98 Å²	98	140.6 Å²	140.6	52%	0.524	61%	0.614	S	S	.	*	H	α-helix	trans	-62	-36.5	-178.7	-73.5	-9.3	0	0	0	113	Q67	N63-Q67 WeakPolarHBondContact O-CB 3.09Å; N63-Q67 VanDerWaalsContact O-CG 3.24Å; N63-Q67 WeakPolarHBondContact O-CG 3.16Å; N63-Q67 PolarHBondContact O-N 3.36Å
64	Y	59.7	Low	59	Low	159 Å²	159	137.9 Å²	137.9	62%	0.624	61%	0.614	S	S	*	*	H	α-helix	trans	-69.3	-32.7	175.8	-69.1	-73.7	0	0	0	113.3	R60 N62 R68	R60-Y64 WeakPolarHBondContact O-CD2 3.24Å; N62-Y64 VanDerWaalsContact C-N 3.31Å; N62-Y64 PolarHBondContact O-N 3.1Å; Y64-R68 WeakPolarHBondContact O-CB 3.16Å; Y64-R68 PolarHBondContact O-N 3.48Å
65	R	58.6	Low	59	Low	181 Å²	181	134.9 Å²	134.9	68%	0.683	61%	0.612	S	S	*	*	H	α-helix	trans	-72.6	-40.9	176.6	-74.6	-173.9	176.6	-173.8	-0.8	112.1	N62 R68 N69	N62-R65 PolarHBondContact O-N 3.31Å; N62-R65 VanDerWaalsContact O-N 3.1Å; R65-R68 PolarHBondContact O-N 3.24Å; R65-N69 PolarHBondContact O-N 3.37Å
66	F	59.4	Low	59	Low	132 Å²	132	137.4 Å²	137.4	58%	0.579	63%	0.625	S	S	*	*	H	α-helix	trans	-67.3	-40.6	176.6	-73.7	-69.2	0	0	0	112.2	N62 R68 N69 N70	N62-F66 HydrophobicContact CB-CD2 4.27Å; N62-F66 HydrophobicContact CB-CE2 4.08Å; N62-F66 WeakPolarHBondContact O-CD2 3.43Å; N62-F66 PolarHBondContact O-N 3.4Å; F66-R68 PolarHBondContact O-N 3.38Å; F66-N69 PolarHBondContact O-N 3.46Å; F66-N70 PolarHBondContact O-N 3.17Å
67	Q	59.7	Low	58.7	Low	103 Å²	103	140.9 Å²	140.9	48%	0.481	65%	0.649	S	S	.	*	H	α-helix	trans	-61.7	-44.1	175.2	-73.5	174.7	16.2	0	0	111.7	N63 N69 N70 F71	N63-Q67 WeakPolarHBondContact O-CB 3.09Å; N63-Q67 VanDerWaalsContact O-CG 3.24Å; N63-Q67 WeakPolarHBondContact O-CG 3.16Å; N63-Q67 PolarHBondContact O-N 3.36Å; Q67-N69 VanDerWaalsContact C-N 3.32Å; Q67-N69 PolarHBondContact O-N 3.17Å; Q67-N70 PolarHBondContact O-N 3.2Å; Q67-F71 WeakPolarHBondContact O-CD2 3.44Å; Q67-F71 PolarHBondContact O-N 3.39Å
68	R	58.4	Low	58.9	Low	160 Å²	160	136.9 Å²	136.9	60%	0.604	64%	0.639	S	S	*	*	H	α-helix	trans	-63.7	-35.2	-179.9	-165.5	-178.4	-175.7	-151.7	4.2	113.4	Y64 R65 F66 R72	Y64-R68 WeakPolarHBondContact O-CB 3.16Å; Y64-R68 PolarHBondContact O-N 3.48Å; R65-R68 PolarHBondContact O-N 3.24Å; F66-R68 PolarHBondContact O-N 3.38Å; R68-R72 PolarHBondContact O-N 3.45Å
69	N	60.9	Low	59	Low	101 Å²	101	140.8 Å²	140.8	54%	0.54	65%	0.65	S	S	.	*	H	α-helix	trans	-72	-31	177.7	-76.5	-12.9	0	0	0	112.4	R65 F66 Q67 R73	R65-N69 PolarHBondContact O-N 3.37Å; F66-N69 PolarHBondContact O-N 3.46Å; Q67-N69 VanDerWaalsContact C-N 3.32Å; Q67-N69 PolarHBondContact O-N 3.17Å; N69-R73 PolarHBondContact O-N 3.41Å
70	N	61.1	Low	59	Low	103 Å²	103	140.9 Å²	140.9	55%	0.551	65%	0.65	S	S	*	*	H	α-helix	trans	-71.5	-38.3	175.5	-71.7	-15.1	0	0	0	112.2	F66 Q67 R72 R73 N74	F66-N70 PolarHBondContact O-N 3.17Å; Q67-N70 PolarHBondContact O-N 3.2Å; N70-R72 VanDerWaalsContact C-N 3.32Å; N70-R72 PolarHBondContact O-N 3.38Å; N70-R73 PolarHBondContact O-N 3.23Å; N70-N74 PolarHBondContact O-N 3.37Å
71	F	61.2	Low	59.2	Low	161 Å²	161	137.6 Å²	137.6	71%	0.706	64%	0.644	S	S	*	*	H	α-helix	trans	-65.7	-31.6	175.7	-77.7	-71	0	0	0	113.6	Q67	Q67-F71 WeakPolarHBondContact O-CD2 3.44Å; Q67-F71 PolarHBondContact O-N 3.39Å
72	R	59.3	Low	59.3	Low	156 Å²	156	139.4 Å²	139.4	59%	0.589	65%	0.649	S	S	*	*	H	α-helix	trans	-76.1	-25.9	177.8	-77.1	-174.4	171.6	-166	-5.6	114.1	R68 N70	R68-R72 PolarHBondContact O-N 3.45Å; N70-R72 VanDerWaalsContact C-N 3.32Å; N70-R72 PolarHBondContact O-N 3.38Å
73	R	59.5	Low	59.3	Low	203 Å²	203	143.2 Å²	143.2	77%	0.766	66%	0.662	S	S	*	*	H	α-helix	trans	-75.9	-30.9	176.8	-97.7	-174	172.9	-175.3	-2.5	112.6	N69 N70	N69-R73 PolarHBondContact O-N 3.41Å; N70-R73 PolarHBondContact O-N 3.23Å
74	N	61	Low	59.3	Low	136 Å²	136	146.4 Å²	146.4	73%	0.727	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92	7.6	-175.2	-65.4	1.5	0	0	0	113.9	N70	N70-N74 PolarHBondContact O-N 3.37Å
75	S	60.8	Low	59.2	Low	88 Å²	88	145.5 Å²	145.5	62%	0.615	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.7	17.6	179.2	89.7	0	0	0	0	113.6
76	L	59.3	Low	59.3	Low	148 Å²	148	142.5 Å²	142.5	78%	0.775	68%	0.675	S	S	*	*			trans	-122.8	10.5	-175.9	-85.7	163.4	0	0	0	113.7
77	D	50.8	Low	59.3	Low	219 Å²	219	143.5 Å²	143.5	100%	1.171	68%	0.684	S	S	*	*			trans	-119.1	0	166.3	-66.6	-40	0	0	0	108.8

Retrieved 77 of 77 residues in 28.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).