A0A5K4F596_SCHMA Loading...

Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit TMEM258

Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.

AlphaFold DB , UniProt , Accession A0A5K4F596, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 81 aa.

						>A0A5K4F596_SCHMA|A0A5K4F596
MDITLDQMERYVPPINPATYPVLTSLLLIIGAFFMAWFSVYELTANKFSRVLLKELLLSFVASIFLGCGTLFLLLWVGIYV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.5	Low	77.9	Confident	226 Å²	226	154.5 Å²	154.5	100%	1.113	74%	0.741	S	S	*	*				0	87.2	0	-178.9	-175.6	-81.1	0	0	105	I3	M1-I3 PolarHBondContact O-N 3.07Å
2	D	77.2	Confident	78.3	Confident	154 Å²	154	151.1 Å²	151.1	82%	0.824	74%	0.736	S	S	*	*			trans	-73.8	112.5	178.5	-64.6	-53.9	0	0	0	107.4	T4	D2-T4 PolarHBondContact O-N 3.28Å; D2-T4 VanDerWaalsContact O-N 3.14Å
3	I	75.4	Confident	78.5	Confident	110 Å²	110	143.3 Å²	143.3	56%	0.564	71%	0.705	S	S	*	*			trans	-67	112.4	172.9	-55	172.6	0	0	0	105.5	M1 Q7 M8	M1-I3 PolarHBondContact O-N 3.07Å; I3-Q7 HydrophobicContact CG2-CB 3.95Å; I3-M8 HydrophobicContact CG2-CG 4.37Å
4	T	79.6	Confident	79.1	Confident	76 Å²	76	141.6 Å²	141.6	47%	0.466	71%	0.71	S	S	.	*			trans	-68.5	147	174.8	54.4	0	0	0	0	109	D2 D6 Q7	D2-T4 PolarHBondContact O-N 3.28Å; D2-T4 VanDerWaalsContact O-N 3.14Å; T4-D6 PolarHBondContact O-N 3.14Å; T4-D6 VanDerWaalsContact O-N 3.07Å; T4-Q7 WeakPolarHBondContact O-CB 3.43Å; T4-Q7 PolarHBondContact O-N 3.07Å
5	L	74.8	Confident	79.7	Confident	139 Å²	139	136.5 Å²	136.5	73%	0.728	69%	0.685	S	S	*	*	G	3₁₀ helix	trans	-54.2	-30.6	-179.2	-70.7	171.2	0	0	0	112.4	Q7 M8	L5-Q7 PolarHBondContact O-N 3.24Å; L5-M8 HydrophobicContact CD2-CE 4.03Å; L5-M8 HydrophobicContact CD2-SD 3.8Å; L5-M8 WeakPolarHBondContact O-CB 3.47Å; L5-M8 PolarHBondContact O-N 3.39Å; L5-M8 VanDerWaalsContact O-N 3.07Å
6	D	78.9	Confident	80.2	Confident	161 Å²	161	134.2 Å²	134.2	86%	0.861	68%	0.675	S	S	*	*	G	3₁₀ helix	trans	-65.2	-17.8	176	-60.4	-54	0	0	0	114.2	T4	T4-D6 PolarHBondContact O-N 3.14Å; T4-D6 VanDerWaalsContact O-N 3.07Å
7	Q	80.8	Confident	80.7	Confident	133 Å²	133	130.4 Å²	130.4	62%	0.621	66%	0.662	S	S	*	*	G	3₁₀ helix	trans	-94.5	-2	174.8	-64.1	-167.5	-39.1	0	0	113.2	I3 T4 L5 E9	I3-Q7 HydrophobicContact CG2-CB 3.95Å; T4-Q7 WeakPolarHBondContact O-CB 3.43Å; T4-Q7 PolarHBondContact O-N 3.07Å; L5-Q7 PolarHBondContact O-N 3.24Å; Q7-E9 PolarHBondContact O-N 2.86Å
8	M	80	Confident	81.3	Confident	117 Å²	117	127.2 Å²	127.2	58%	0.576	66%	0.658	S	S	*	*			trans	-81.2	101.7	175.3	-64.5	-171.1	-178.5	0	0	109.7	I3 L5 R10	I3-M8 HydrophobicContact CG2-CG 4.37Å; L5-M8 HydrophobicContact CD2-CE 4.03Å; L5-M8 HydrophobicContact CD2-SD 3.8Å; L5-M8 WeakPolarHBondContact O-CB 3.47Å; L5-M8 PolarHBondContact O-N 3.39Å; L5-M8 VanDerWaalsContact O-N 3.07Å; M8-R10 PolarHBondContact O-N 3.49Å
9	E	80.3	Confident	81.9	Confident	183 Å²	183	123.5 Å²	123.5	86%	0.855	64%	0.642	S	S	*	*			trans	-56.8	131.9	170.8	-75	-66.3	150.5	0	0	110.4	Q7 Y11	Q7-E9 PolarHBondContact O-N 2.86Å; E9-Y11 PolarHBondContact O-N 2.86Å
10	R	80.8	Confident	82.4	Confident	219 Å²	219	119 Å²	119	83%	0.826	62%	0.617	S	S	*	*			trans	-63	126	176.2	-178.4	180	-178.8	-168.8	1.6	108.5	M8 V12	M8-R10 PolarHBondContact O-N 3.49Å; R10-V12 PolarHBondContact O-N 3.06Å
11	Y	82.6	Confident	83	Confident	182 Å²	182	115.2 Å²	115.2	71%	0.714	60%	0.599	S	S	*	*			trans	-61.5	112.6	170.7	-178.8	-100.3	0	0	0	109.8	E9 P13	E9-Y11 PolarHBondContact O-N 2.86Å; Y11-P13 HydrophobicContact CE1-CB 4.07Å
12	V	82.3	Confident	84.3	Confident	113 Å²	113	108.5 Å²	108.5	69%	0.685	57%	0.571	S	S	*	*			trans	-97.1	116.6	170.4	-177.6	0	0	0	0	107	R10	R10-V12 PolarHBondContact O-N 3.06Å
13	P	81.4	Confident	85.1	Confident	50 Å²	50	103.8 Å²	103.8	33%	0.325	55%	0.545	S	S	.	.			trans	-63	138.2	176.8	26.1	-32.7	0	0	0	109.4	Y11 I15	Y11-P13 HydrophobicContact CE1-CB 4.07Å; P13-I15 PolarHBondContact O-N 3.23Å; P13-I15 VanDerWaalsContact O-N 3.15Å
14	P	87	Confident	86.1	Confident	120 Å²	120	98.7 Å²	98.7	78%	0.779	52%	0.52	S	S	*	.	S	Bend	trans	-63.7	-22.7	-177.1	25.1	-34.6	0	0	0	113
15	I	87.2	Confident	86.9	Confident	65 Å²	65	97.6 Å²	97.6	33%	0.333	52%	0.515	S	S	.	.	S	Bend	trans	-118.4	123.9	178	-56.7	172.4	0	0	0	108.1	P13 P17 T19 Y20 L23 F72	P13-I15 PolarHBondContact O-N 3.23Å; P13-I15 VanDerWaalsContact O-N 3.15Å; I15-P17 WeakPolarHBondContact O-CD 3.37Å; I15-T19 WeakPolarHBondContact CG2-OG1 3.45Å; I15-Y20 HydrophobicContact CB-CE1 4.15Å; I15-Y20 HydrophobicContact CG2-CD1 4.1Å; I15-Y20 HydrophobicContact CG2-CE1 3.68Å; I15-Y20 PolarHBondContact O-OH 3.4Å; I15-L23 HydrophobicContact CG2-CD1 4.02Å; I15-F72 HydrophobicContact CD1-CE1 4.1Å; I15-F72 HydrophobicContact CD1-CZ 4.19Å
16	N	88.9	Confident	87.9	Confident	99 Å²	99	95.5 Å²	95.5	53%	0.529	50%	0.504	S	S	.	.			trans	-63.2	126.2	177.2	-177.4	-12.9	0	0	0	110.3	A18 T19	N16-A18 PolarHBondContact O-N 3.02Å; N16-A18 WeakPolarHBondContact OD1-CB 3.45Å; N16-A18 PolarHBondContact OD1-N 3.11Å; N16-T19 HydrophobicContact CB-CG2 4.43Å; N16-T19 PolarHBondContact O-N 3.35Å; N16-T19 PolarHBondContact O-OG1 3.47Å
17	P	88.4	Confident	88.7	Confident	70 Å²	70	89.4 Å²	89.4	46%	0.455	47%	0.471	S	S	.	.	G	3₁₀ helix	trans	-53.4	-27	176.4	-27.9	35.4	0	0	0	115.1	I15 T19 Y20	I15-P17 WeakPolarHBondContact O-CD 3.37Å; P17-T19 PolarHBondContact O-N 3.24Å; P17-Y20 HydrophobicContact CB-CD2 4.19Å; P17-Y20 HydrophobicContact CB-CE2 3.81Å; P17-Y20 HydrophobicContact CG-CE2 4.24Å; P17-Y20 PolarHBondContact O-N 3.25Å
18	A	91.5	Very high	89.5	Confident	72 Å²	72	85.1 Å²	85.1	60%	0.595	45%	0.452	S	S	*	.	G	3₁₀ helix	trans	-62.9	-21.1	175.8	0	0	0	0	0	113.6	N16	N16-A18 PolarHBondContact O-N 3.02Å; N16-A18 WeakPolarHBondContact OD1-CB 3.45Å; N16-A18 PolarHBondContact OD1-N 3.11Å
19	T	92.2	Very high	90.3	Very high	57 Å²	57	85 Å²	85	35%	0.35	45%	0.453	S	S	.	.	G	3₁₀ helix	trans	-92.1	-9.6	-179.8	65.2	0	0	0	0	113.7	I15 N16 P17 P21 V22 L23	I15-T19 WeakPolarHBondContact CG2-OG1 3.45Å; N16-T19 HydrophobicContact CB-CG2 4.43Å; N16-T19 PolarHBondContact O-N 3.35Å; N16-T19 PolarHBondContact O-OG1 3.47Å; P17-T19 PolarHBondContact O-N 3.24Å; T19-P21 VanDerWaalsContact C-CD 3.44Å; T19-V22 PolarHBondContact O-N 3.2Å; T19-L23 WeakPolarHBondContact O-CG 3.46Å; T19-L23 PolarHBondContact O-N 3.16Å
20	Y	92.6	Very high	91.1	Very high	34 Å²	34	79.7 Å²	79.7	13%	0.133	43%	0.43	C	S	.	.	H	α-helix	trans	-56.2	-42.9	-179.8	-60.5	-16.2	0	0	0	114.1	I15 P17 V22 L23 T24 F72 L75	I15-Y20 HydrophobicContact CB-CE1 4.15Å; I15-Y20 HydrophobicContact CG2-CD1 4.1Å; I15-Y20 HydrophobicContact CG2-CE1 3.68Å; I15-Y20 PolarHBondContact O-OH 3.4Å; P17-Y20 HydrophobicContact CB-CD2 4.19Å; P17-Y20 HydrophobicContact CB-CE2 3.81Å; P17-Y20 HydrophobicContact CG-CE2 4.24Å; P17-Y20 PolarHBondContact O-N 3.25Å; Y20-V22 VanDerWaalsContact C-N 3.32Å; Y20-V22 PolarHBondContact O-N 2.99Å; Y20-L23 PolarHBondContact O-N 2.88Å; Y20-T24 VanDerWaalsContact O-CB 3.26Å; Y20-T24 WeakPolarHBondContact O-CB 3.48Å; Y20-T24 PolarHBondContact O-N 2.97Å; Y20-T24 PolarHBondContact O-OG1 3.19Å; Y20-F72 HydrophobicContact CD1-CD1 4.18Å; Y20-L75 HydrophobicContact CD2-CB 3.85Å; Y20-L75 HydrophobicContact CE2-CB 3.92Å; Y20-L75 HydrophobicContact CG-CB 4.43Å
21	P	94	Very high	91.9	Very high	39 Å²	39	69.2 Å²	69.2	25%	0.253	39%	0.39	S	S	.	.	H	α-helix	trans	-64.1	-38.2	179.3	-17.4	29.2	0	0	0	112.4	T19 S25 W76	T19-P21 VanDerWaalsContact C-CD 3.44Å; P21-S25 WeakPolarHBondContact O-CB 3.44Å; P21-S25 PolarHBondContact O-N 3.03Å; P21-S25 PolarHBondContact O-OG 3.48Å; P21-W76 HydrophobicContact CB-CD2 4.04Å; P21-W76 HydrophobicContact CB-CE3 4.49Å; P21-W76 HydrophobicContact CB-CG 4.43Å; P21-W76 HydrophobicContact CB-CZ2 4.08Å; P21-W76 HydrophobicContact CG-CD2 4.14Å; P21-W76 HydrophobicContact CG-CG 4.08Å; P21-W76 HydrophobicContact CG-CZ2 4.45Å
22	V	95.3	Very high	92.6	Very high	86 Å²	86	62.9 Å²	62.9	52%	0.521	38%	0.375	S	S	.	.	H	α-helix	trans	-70.1	-46.1	-179.9	-180	0	0	0	0	110.4	T19 Y20 S25 L26	T19-V22 PolarHBondContact O-N 3.2Å; Y20-V22 VanDerWaalsContact C-N 3.32Å; Y20-V22 PolarHBondContact O-N 2.99Å; V22-S25 PolarHBondContact O-N 2.99Å; V22-S25 PolarHBondContact O-OG 3.36Å; V22-L26 HydrophobicContact CG1-CD1 4.06Å; V22-L26 WeakPolarHBondContact O-CB 3.41Å; V22-L26 WeakPolarHBondContact O-CG 3.46Å; V22-L26 PolarHBondContact O-N 3.26Å; V22-L26 VanDerWaalsContact O-N 3.07Å
23	L	94	Very high	93.2	Very high	54 Å²	54	63.3 Å²	63.3	28%	0.283	37%	0.368	S	S	.	.	H	α-helix	trans	-61.2	-48.7	176.2	-70.2	170.2	0	0	0	110.9	I15 T19 Y20 S25 L26 L27 F72	I15-L23 HydrophobicContact CG2-CD1 4.02Å; T19-L23 WeakPolarHBondContact O-CG 3.46Å; T19-L23 PolarHBondContact O-N 3.16Å; Y20-L23 PolarHBondContact O-N 2.88Å; L23-S25 PolarHBondContact O-N 3.21Å; L23-L26 PolarHBondContact O-N 3.14Å; L23-L27 HydrophobicContact CB-CD1 4.45Å; L23-L27 WeakPolarHBondContact O-CB 3.25Å; L23-L27 WeakPolarHBondContact O-CD1 3.34Å; L23-L27 PolarHBondContact O-N 3.27Å; L23-F72 HydrophobicContact CB-CD1 4.44Å; L23-F72 HydrophobicContact CB-CG 4.35Å; L23-F72 HydrophobicContact CD1-CD1 4.31Å; L23-F72 HydrophobicContact CD1-CE1 3.99Å; L23-F72 HydrophobicContact CD1-CZ 4.33Å
24	T	95.7	Very high	93.9	Very high	4 Å²	4	64 Å²	64	3%	0.025	37%	0.366	C	S	.	.	H	α-helix	trans	-54.8	-52.5	177.7	-60.3	0	0	0	0	111.7	Y20 L26 L27 L28 F72 L73 W76	Y20-T24 VanDerWaalsContact O-CB 3.26Å; Y20-T24 WeakPolarHBondContact O-CB 3.48Å; Y20-T24 PolarHBondContact O-N 2.97Å; Y20-T24 PolarHBondContact O-OG1 3.19Å; T24-L26 PolarHBondContact O-N 3.33Å; T24-L27 PolarHBondContact O-N 3.15Å; T24-L28 HydrophobicContact CG2-CD1 3.66Å; T24-L28 HydrophobicContact CG2-CG 4.23Å; T24-L28 VanDerWaalsContact O-CB 3.26Å; T24-L28 WeakPolarHBondContact O-CB 3.39Å; T24-L28 VanDerWaalsContact O-CG 3.28Å; T24-L28 WeakPolarHBondContact O-CG 3.44Å; T24-L28 PolarHBondContact O-N 3.16Å; T24-F72 WeakPolarHBondContact OG1-CB 3.36Å; T24-F72 PolarHBondContact OG1-O 2.77Å; T24-L73 HydrophobicContact CG2-CB 3.58Å; T24-L73 HydrophobicContact CG2-CD1 4.18Å; T24-L73 HydrophobicContact CG2-CG 4.09Å; T24-L73 PolarHBondContact OG1-N 3.36Å; T24-W76 HydrophobicContact CG2-CE3 4.46Å
25	S	95.8	Very high	94.3	Very high	53 Å²	53	63.1 Å²	63.1	37%	0.371	35%	0.353	S	S	.	.	H	α-helix	trans	-62.5	-44.6	-177.3	52.9	0	0	0	0	111.9	P21 V22 L23 I29	P21-S25 WeakPolarHBondContact O-CB 3.44Å; P21-S25 PolarHBondContact O-N 3.03Å; P21-S25 PolarHBondContact O-OG 3.48Å; V22-S25 PolarHBondContact O-N 2.99Å; V22-S25 PolarHBondContact O-OG 3.36Å; L23-S25 PolarHBondContact O-N 3.21Å; S25-I29 VanDerWaalsContact O-CB 3.27Å; S25-I29 WeakPolarHBondContact O-CB 3.28Å; S25-I29 WeakPolarHBondContact O-CD1 3.4Å; S25-I29 WeakPolarHBondContact O-CG1 3.26Å; S25-I29 PolarHBondContact O-N 3Å
26	L	96.5	Very high	94.7	Very high	94 Å²	94	62.6 Å²	62.6	49%	0.492	36%	0.358	S	S	.	.	H	α-helix	trans	-62.6	-50	177.5	-71.8	174.2	0	0	0	112.3	V22 L23 T24 L28 I29 I30	V22-L26 HydrophobicContact CG1-CD1 4.06Å; V22-L26 WeakPolarHBondContact O-CB 3.41Å; V22-L26 WeakPolarHBondContact O-CG 3.46Å; V22-L26 PolarHBondContact O-N 3.26Å; V22-L26 VanDerWaalsContact O-N 3.07Å; L23-L26 PolarHBondContact O-N 3.14Å; T24-L26 PolarHBondContact O-N 3.33Å; L26-L28 PolarHBondContact O-N 3.49Å; L26-I29 PolarHBondContact O-N 3.21Å; L26-I30 WeakPolarHBondContact O-CB 3.42Å; L26-I30 WeakPolarHBondContact O-CD1 3.49Å; L26-I30 WeakPolarHBondContact O-CG1 3.44Å; L26-I30 PolarHBondContact O-N 3.44Å
27	L	96	Very high	95	Very high	34 Å²	34	65.4 Å²	65.4	18%	0.178	36%	0.361	C	S	.	.	H	α-helix	trans	-64.5	-41.1	-178.7	-85.4	81.4	0	0	0	111.7	L23 T24 G31 C68 F72	L23-L27 HydrophobicContact CB-CD1 4.45Å; L23-L27 WeakPolarHBondContact O-CB 3.25Å; L23-L27 WeakPolarHBondContact O-CD1 3.34Å; L23-L27 PolarHBondContact O-N 3.27Å; T24-L27 PolarHBondContact O-N 3.15Å; L27-G31 PolarHBondContact O-N 2.86Å; L27-C68 HydrophobicContact CD2-CB 3.51Å; L27-F72 HydrophobicContact CD2-CD2 4.29Å; L27-F72 HydrophobicContact CD2-CE2 4.45Å
28	L	96.7	Very high	95.2	Very high	42 Å²	42	64.7 Å²	64.7	22%	0.22	35%	0.351	C	S	.	.	H	α-helix	trans	-70.6	-40.2	178.4	-71.6	-177.5	0	0	0	112.7	T24 L26 G31 A32 L66 T70 L73	T24-L28 HydrophobicContact CG2-CD1 3.66Å; T24-L28 HydrophobicContact CG2-CG 4.23Å; T24-L28 VanDerWaalsContact O-CB 3.26Å; T24-L28 WeakPolarHBondContact O-CB 3.39Å; T24-L28 VanDerWaalsContact O-CG 3.28Å; T24-L28 WeakPolarHBondContact O-CG 3.44Å; T24-L28 PolarHBondContact O-N 3.16Å; L26-L28 PolarHBondContact O-N 3.49Å; L28-G31 PolarHBondContact O-N 2.85Å; L28-A32 WeakPolarHBondContact O-CB 3.18Å; L28-A32 PolarHBondContact O-N 3.48Å; L28-L66 HydrophobicContact CD2-CD2 3.94Å; L28-T70 HydrophobicContact CD2-CG2 4.03Å; L28-L73 HydrophobicContact CD1-CD1 3.73Å
29	I	97.8	Very high	95.3	Very high	115 Å²	115	63.4 Å²	63.4	59%	0.59	34%	0.338	S	S	*	.	H	α-helix	trans	-62.9	-46.7	177.6	-72	165.6	0	0	0	110.1	S25 L26 A32 F33	S25-I29 VanDerWaalsContact O-CB 3.27Å; S25-I29 WeakPolarHBondContact O-CB 3.28Å; S25-I29 WeakPolarHBondContact O-CD1 3.4Å; S25-I29 WeakPolarHBondContact O-CG1 3.26Å; S25-I29 PolarHBondContact O-N 3Å; L26-I29 PolarHBondContact O-N 3.21Å; I29-A32 PolarHBondContact O-N 2.72Å; I29-F33 WeakPolarHBondContact O-CB 3.38Å; I29-F33 PolarHBondContact O-N 2.93Å
30	I	96.7	Very high	95.3	Very high	71 Å²	71	65 Å²	65	36%	0.364	35%	0.348	S	S	.	.	H	α-helix	trans	-65.1	-45.3	177.9	-67.2	163.3	0	0	0	110.4	L26 A32 F33 F34 F65	L26-I30 WeakPolarHBondContact O-CB 3.42Å; L26-I30 WeakPolarHBondContact O-CD1 3.49Å; L26-I30 WeakPolarHBondContact O-CG1 3.44Å; L26-I30 PolarHBondContact O-N 3.44Å; I30-A32 PolarHBondContact O-N 2.86Å; I30-F33 WeakPolarHBondContact O-CB 3.41Å; I30-F33 PolarHBondContact O-N 3.37Å; I30-F34 HydrophobicContact CG2-CD2 3.86Å; I30-F34 HydrophobicContact CG2-CE2 3.73Å; I30-F34 VanDerWaalsContact O-CD2 3.27Å; I30-F34 WeakPolarHBondContact O-CD2 3.32Å; I30-F34 PolarHBondContact O-N 3.48Å; I30-F34 VanDerWaalsContact O-N 3.07Å; I30-F65 HydrophobicContact CG2-CD1 4.21Å; I30-F65 HydrophobicContact CG2-CD2 4.47Å; I30-F65 HydrophobicContact CG2-CE1 4.37Å; I30-F65 HydrophobicContact CG2-CG 4.28Å
31	G	97.4	Very high	95.3	Very high	0 Å²	0	65.4 Å²	65.4	0%	0	35%	0.349	C	S	.	.	H	α-helix	trans	-61.5	-43.1	177.5	0	0	0	0	0	112.9	L27 L28 F33 F34 M35	L27-G31 PolarHBondContact O-N 2.86Å; L28-G31 PolarHBondContact O-N 2.85Å; G31-F33 VanDerWaalsContact C-N 3.34Å; G31-F33 PolarHBondContact O-N 3.23Å; G31-F34 PolarHBondContact O-N 3Å; G31-M35 WeakPolarHBondContact O-CB 3.47Å; G31-M35 PolarHBondContact O-N 3.45Å
32	A	96.5	Very high	95.1	Very high	49 Å²	49	66.4 Å²	66.4	41%	0.405	35%	0.35	S	S	.	.	H	α-helix	trans	-65.7	-37.2	176.7	0	0	0	0	0	111.7	L28 I29 I30 M35 A36	L28-A32 WeakPolarHBondContact O-CB 3.18Å; L28-A32 PolarHBondContact O-N 3.48Å; I29-A32 PolarHBondContact O-N 2.72Å; I30-A32 PolarHBondContact O-N 2.86Å; A32-M35 PolarHBondContact O-N 2.98Å; A32-A36 WeakPolarHBondContact O-CB 3Å; A32-A36 PolarHBondContact O-N 2.87Å
33	F	96.3	Very high	94.8	Very high	122 Å²	122	69.6 Å²	69.6	54%	0.535	36%	0.364	S	S	.	.	H	α-helix	trans	-60	-48.3	172.8	177.6	-95.3	0	0	0	111.6	I29 I30 G31 M35 A36 W37	I29-F33 WeakPolarHBondContact O-CB 3.38Å; I29-F33 PolarHBondContact O-N 2.93Å; I30-F33 WeakPolarHBondContact O-CB 3.41Å; I30-F33 PolarHBondContact O-N 3.37Å; G31-F33 VanDerWaalsContact C-N 3.34Å; G31-F33 PolarHBondContact O-N 3.23Å; F33-M35 PolarHBondContact O-N 3.41Å; F33-A36 PolarHBondContact O-N 2.87Å; F33-W37 HydrophobicContact CZ-CE3 4.17Å; F33-W37 WeakPolarHBondContact O-CB 3.38Å; F33-W37 PolarHBondContact O-N 3.43Å
34	F	95.5	Very high	94.6	Very high	63 Å²	63	72 Å²	72	28%	0.276	38%	0.381	S	S	.	.	H	α-helix	trans	-65.6	-37.1	176.4	-79.6	-70	0	0	0	112.8	I30 G31 W37 F38 L58 V61 A62	I30-F34 HydrophobicContact CG2-CD2 3.86Å; I30-F34 HydrophobicContact CG2-CE2 3.73Å; I30-F34 VanDerWaalsContact O-CD2 3.27Å; I30-F34 WeakPolarHBondContact O-CD2 3.32Å; I30-F34 PolarHBondContact O-N 3.48Å; I30-F34 VanDerWaalsContact O-N 3.07Å; G31-F34 PolarHBondContact O-N 3Å; F34-W37 PolarHBondContact O-N 2.88Å; F34-F38 WeakPolarHBondContact O-CB 3.45Å; F34-F38 PolarHBondContact O-N 3.37Å; F34-L58 HydrophobicContact CD1-CD1 3.67Å; F34-L58 HydrophobicContact CE1-CD1 4.34Å; F34-V61 HydrophobicContact CD1-CG1 4.48Å; F34-V61 HydrophobicContact CD2-CG1 4.22Å; F34-V61 HydrophobicContact CE1-CG1 4.46Å; F34-V61 HydrophobicContact CE2-CG1 4.22Å; F34-V61 HydrophobicContact CG-CG1 4.37Å; F34-V61 HydrophobicContact CZ-CG1 4.33Å; F34-A62 HydrophobicContact CB-CB 3.77Å
35	M	95.7	Very high	94.1	Very high	103 Å²	103	72.4 Å²	72.4	51%	0.507	39%	0.385	S	S	.	.	H	α-helix	trans	-64	-43.2	174.6	-179.4	-176.7	174.4	0	0	111.8	G31 A32 F33 W37 F38 S39 L66	G31-M35 WeakPolarHBondContact O-CB 3.47Å; G31-M35 PolarHBondContact O-N 3.45Å; A32-M35 PolarHBondContact O-N 2.98Å; F33-M35 PolarHBondContact O-N 3.41Å; M35-W37 VanDerWaalsContact C-N 3.35Å; M35-F38 PolarHBondContact O-N 3.2Å; M35-S39 WeakPolarHBondContact O-CB 3.21Å; M35-S39 PolarHBondContact O-N 2.87Å; M35-S39 PolarHBondContact O-OG 2.9Å; M35-L66 HydrophobicContact CB-CD1 4.04Å; M35-L66 HydrophobicContact CG-CD1 4.38Å; M35-L66 HydrophobicContact SD-CD1 3.78Å
36	A	96.1	Very high	93.5	Very high	53 Å²	53	75.8 Å²	75.8	44%	0.438	40%	0.398	S	S	.	.	H	α-helix	trans	-63.6	-42.8	174.7	0	0	0	0	0	111	A32 F33 F38 S39 V40	A32-A36 WeakPolarHBondContact O-CB 3Å; A32-A36 PolarHBondContact O-N 2.87Å; F33-A36 PolarHBondContact O-N 2.87Å; A36-F38 PolarHBondContact O-N 3.44Å; A36-S39 WeakPolarHBondContact O-CB 3.12Å; A36-S39 PolarHBondContact O-N 3.43Å; A36-S39 VanDerWaalsContact O-N 3.15Å; A36-V40 WeakPolarHBondContact O-CG2 3.44Å; A36-V40 PolarHBondContact O-N 3.46Å
37	W	93.7	Very high	92.6	Very high	158 Å²	158	79.8 Å²	79.8	60%	0.598	41%	0.412	S	S	*	.	H	α-helix	trans	-60.8	-43.4	175.6	-167.6	-84.8	0	0	0	112.2	F33 F34 M35 S39 V40 Y41	F33-W37 HydrophobicContact CZ-CE3 4.17Å; F33-W37 WeakPolarHBondContact O-CB 3.38Å; F33-W37 PolarHBondContact O-N 3.43Å; F34-W37 PolarHBondContact O-N 2.88Å; M35-W37 VanDerWaalsContact C-N 3.35Å; W37-S39 VanDerWaalsContact C-N 3.31Å; W37-S39 PolarHBondContact O-N 2.92Å; W37-V40 PolarHBondContact O-N 2.78Å; W37-Y41 VanDerWaalsContact O-CB 3.31Å; W37-Y41 WeakPolarHBondContact O-CB 3.32Å; W37-Y41 PolarHBondContact O-N 3.42Å
38	F	93.3	Very high	91.8	Very high	56 Å²	56	87.4 Å²	87.4	25%	0.246	44%	0.444	C	S	.	.	H	α-helix	trans	-60.5	-42.3	173	174	-96.6	0	0	0	111.6	F34 M35 A36 Y41 E42 E55 L58	F34-F38 WeakPolarHBondContact O-CB 3.45Å; F34-F38 PolarHBondContact O-N 3.37Å; M35-F38 PolarHBondContact O-N 3.2Å; A36-F38 PolarHBondContact O-N 3.44Å; F38-Y41 WeakPolarHBondContact O-CB 3.45Å; F38-Y41 PolarHBondContact O-N 3.41Å; F38-E42 WeakPolarHBondContact O-CB 3.36Å; F38-E42 PolarHBondContact O-N 2.95Å; F38-E55 HydrophobicContact CE2-CB 4.21Å; F38-L58 VanDerWaalsContact CA-CD2 3.46Å; F38-L58 HydrophobicContact CB-CD2 3.73Å; F38-L58 HydrophobicContact CB-CG 4.03Å; F38-L58 HydrophobicContact CD2-CD2 4.12Å; F38-L58 HydrophobicContact CD2-CG 4.4Å; F38-L58 HydrophobicContact CG-CD2 4.44Å
39	S	93	Very high	91	Very high	44 Å²	44	88.6 Å²	88.6	31%	0.308	46%	0.456	S	S	.	.	H	α-helix	trans	-64.6	-46.6	179.5	-55.8	0	0	0	0	110.9	M35 A36 W37 Y41 E42 L43	M35-S39 WeakPolarHBondContact O-CB 3.21Å; M35-S39 PolarHBondContact O-N 2.87Å; M35-S39 PolarHBondContact O-OG 2.9Å; A36-S39 WeakPolarHBondContact O-CB 3.12Å; A36-S39 PolarHBondContact O-N 3.43Å; A36-S39 VanDerWaalsContact O-N 3.15Å; W37-S39 VanDerWaalsContact C-N 3.31Å; W37-S39 PolarHBondContact O-N 2.92Å; S39-Y41 VanDerWaalsContact C-N 3.29Å; S39-Y41 PolarHBondContact O-N 2.84Å; S39-E42 PolarHBondContact O-N 3.07Å; S39-L43 VanDerWaalsContact O-CB 3.24Å; S39-L43 WeakPolarHBondContact O-CB 3.33Å; S39-L43 WeakPolarHBondContact O-CD1 3.27Å; S39-L43 WeakPolarHBondContact O-CG 3.11Å; S39-L43 PolarHBondContact O-N 3.48Å
40	V	93.5	Very high	90.2	Very high	92 Å²	92	87.9 Å²	87.9	56%	0.558	45%	0.446	S	S	*	.	H	α-helix	trans	-59.7	-43.1	175.4	171.5	0	0	0	0	110.9	A36 W37 L43 T44	A36-V40 WeakPolarHBondContact O-CG2 3.44Å; A36-V40 PolarHBondContact O-N 3.46Å; W37-V40 PolarHBondContact O-N 2.78Å; V40-L43 PolarHBondContact O-N 3.37Å; V40-T44 VanDerWaalsContact O-CB 3.26Å; V40-T44 WeakPolarHBondContact O-CB 3.26Å; V40-T44 PolarHBondContact O-N 3.07Å; V40-T44 PolarHBondContact O-OG1 2.98Å
41	Y	90.9	Very high	89.8	Confident	41 Å²	41	88.3 Å²	88.3	16%	0.161	45%	0.451	C	S	.	.	H	α-helix	trans	-60.5	-48.5	177.4	172.7	-85.3	0	0	0	111.2	W37 F38 S39 L43 T44 A45 V51 K54 E55	W37-Y41 VanDerWaalsContact O-CB 3.31Å; W37-Y41 WeakPolarHBondContact O-CB 3.32Å; W37-Y41 PolarHBondContact O-N 3.42Å; F38-Y41 WeakPolarHBondContact O-CB 3.45Å; F38-Y41 PolarHBondContact O-N 3.41Å; S39-Y41 VanDerWaalsContact C-N 3.29Å; S39-Y41 PolarHBondContact O-N 2.84Å; Y41-L43 PolarHBondContact O-N 2.87Å; Y41-T44 PolarHBondContact O-N 3.48Å; Y41-A45 HydrophobicContact CE1-CB 4.21Å; Y41-A45 HydrophobicContact CE2-CB 4.49Å; Y41-A45 WeakPolarHBondContact O-CB 3.25Å; Y41-A45 PolarHBondContact O-N 2.9Å; Y41-V51 PolarHBondContact OH-N 3.18Å; Y41-K54 HydrophobicContact CE2-CD 3.59Å; Y41-K54 VanDerWaalsContact CZ-NZ 3.35Å; Y41-K54 WeakPolarHBondContact OH-CD 3.47Å; Y41-K54 WeakPolarHBondContact OH-CE 3.49Å; Y41-K54 PolarHBondContact OH-NZ 3.46Å; Y41-E55 HydrophobicContact CD1-CG 3.87Å; Y41-E55 HydrophobicContact CE1-CG 3.18Å; Y41-E55 WeakPolarHBondContact CE1-OE1 3.43Å; Y41-E55 PolarHBondContact OH-OE1 3.35Å
42	E	90	Very high	89.4	Confident	61 Å²	61	94.4 Å²	94.4	29%	0.285	48%	0.483	S	S	.	.	H	α-helix	trans	-69.2	-35.7	-178.2	-173.1	58.7	-159.7	0	0	112.6	F38 S39 R50	F38-E42 WeakPolarHBondContact O-CB 3.36Å; F38-E42 PolarHBondContact O-N 2.95Å; S39-E42 PolarHBondContact O-N 3.07Å; E42-R50 PolarHBondContact O-NH2 3.38Å; E42-R50 IonicContact OE1-CZ 3.38Å; E42-R50 IonicContact OE1-NH1 2.66Å; E42-R50 PolarHBondContact OE1-NH1 3.37Å; E42-R50 IonicContact OE1-NH2 3.61Å; E42-R50 IonicContact OE2-NH1 3.84Å
43	L	90.2	Very high	89.1	Confident	152 Å²	152	97.7 Å²	97.7	80%	0.796	49%	0.493	S	S	*	.	H	α-helix	trans	-74.4	-28.9	179.1	-67.8	172.4	0	0	0	113	S39 V40 Y41	S39-L43 VanDerWaalsContact O-CB 3.24Å; S39-L43 WeakPolarHBondContact O-CB 3.33Å; S39-L43 WeakPolarHBondContact O-CD1 3.27Å; S39-L43 WeakPolarHBondContact O-CG 3.11Å; S39-L43 PolarHBondContact O-N 3.48Å; V40-L43 PolarHBondContact O-N 3.37Å; Y41-L43 PolarHBondContact O-N 2.87Å
44	T	90.1	Very high	88.8	Confident	105 Å²	105	96 Å²	96	64%	0.644	49%	0.486	S	S	*	.	H	α-helix	trans	-99.4	-20.6	-177.7	-45.3	0	0	0	0	112.4	V40 Y41 N46	V40-T44 VanDerWaalsContact O-CB 3.26Å; V40-T44 WeakPolarHBondContact O-CB 3.26Å; V40-T44 PolarHBondContact O-N 3.07Å; V40-T44 PolarHBondContact O-OG1 2.98Å; Y41-T44 PolarHBondContact O-N 3.48Å; T44-N46 PolarHBondContact O-N 3.41Å
45	A	83.4	Confident	88.6	Confident	13 Å²	13	94.4 Å²	94.4	11%	0.107	48%	0.479	C	S	.	.			trans	-72.1	118.3	-175.6	0	0	0	0	0	112.1	Y41 R50	Y41-A45 HydrophobicContact CE1-CB 4.21Å; Y41-A45 HydrophobicContact CE2-CB 4.49Å; Y41-A45 WeakPolarHBondContact O-CB 3.25Å; Y41-A45 PolarHBondContact O-N 2.9Å; A45-R50 HydrophobicContact CB-CG 3.65Å; A45-R50 PolarHBondContact O-NE 2.83Å; A45-R50 PolarHBondContact O-NH2 3.43Å
46	N	83.3	Confident	88.5	Confident	123 Å²	123	94.6 Å²	94.6	66%	0.658	48%	0.482	S	S	*	.			trans	-65	148.6	168.6	-77.6	-12.6	0	0	0	111.2	T44 F48 S49 R50	T44-N46 PolarHBondContact O-N 3.41Å; N46-F48 PolarHBondContact O-N 3.26Å; N46-S49 PolarHBondContact O-N 3.01Å; N46-S49 PolarHBondContact O-OG 3.47Å; N46-R50 WeakPolarHBondContact O-CG 3.42Å; N46-R50 PolarHBondContact O-N 2.81Å
47	K	79.4	Confident	88.4	Confident	178 Å²	178	97 Å²	97	77%	0.774	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-47.4	-34.1	-177.2	-172.2	-177.7	178.6	-167.6	0	114.4
48	F	78.4	Confident	88.4	Confident	194 Å²	194	90.9 Å²	90.9	85%	0.851	47%	0.465	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.4	-13.7	-174.9	-56.7	-73	0	0	0	114.9	N46	N46-F48 PolarHBondContact O-N 3.26Å
49	S	79.4	Confident	88.5	Confident	67 Å²	67	90.1 Å²	90.1	47%	0.469	47%	0.467	S	S	.	.	T	Hydrogen-bonded Turn	trans	-105.2	4.2	-179.8	59.4	0	0	0	0	113.5	N46 K54	N46-S49 PolarHBondContact O-N 3.01Å; N46-S49 PolarHBondContact O-OG 3.47Å; S49-K54 PolarHBondContact O-NZ 3.5Å
50	R	82	Confident	88.6	Confident	101 Å²	101	94 Å²	94	38%	0.381	48%	0.478	S	S	.	.			trans	-74.2	133.3	175.6	-72.1	173.4	-174.6	-138.8	-8.9	110.4	E42 A45 N46 E55	E42-R50 PolarHBondContact O-NH2 3.38Å; E42-R50 IonicContact OE1-CZ 3.38Å; E42-R50 IonicContact OE1-NH1 2.66Å; E42-R50 PolarHBondContact OE1-NH1 3.37Å; E42-R50 IonicContact OE1-NH2 3.61Å; E42-R50 IonicContact OE2-NH1 3.84Å; A45-R50 HydrophobicContact CB-CG 3.65Å; A45-R50 PolarHBondContact O-NE 2.83Å; A45-R50 PolarHBondContact O-NH2 3.43Å; N46-R50 WeakPolarHBondContact O-CG 3.42Å; N46-R50 PolarHBondContact O-N 2.81Å; R50-E55 WeakPolarHBondContact CB-OE1 3.4Å
51	V	88.2	Confident	88.7	Confident	79 Å²	79	92 Å²	92	48%	0.479	47%	0.467	S	S	.	.			trans	-128.4	113	173.9	-179	0	0	0	0	106.3	Y41 L53 K54 E55	Y41-V51 PolarHBondContact OH-N 3.18Å; V51-L53 HydrophobicContact CG1-CB 4.3Å; V51-L53 PolarHBondContact O-N 2.88Å; V51-L53 VanDerWaalsContact O-N 3.15Å; V51-K54 HydrophobicContact CB-CD 4.25Å; V51-K54 HydrophobicContact CB-CG 3.97Å; V51-K54 WeakPolarHBondContact O-CG 3.27Å; V51-K54 PolarHBondContact O-N 2.77Å; V51-E55 PolarHBondContact N-OE1 2.84Å; V51-E55 PolarHBondContact O-N 3.48Å
52	L	88.1	Confident	89	Confident	129 Å²	129	90.4 Å²	90.4	68%	0.675	46%	0.462	S	S	*	.	H	α-helix	trans	-58.3	-32.6	-174	-173.4	145	0	0	0	112.7	E55 L56	L52-E55 PolarHBondContact O-N 2.91Å; L52-L56 WeakPolarHBondContact O-CB 3.46Å; L52-L56 PolarHBondContact O-N 3.38Å
53	L	90.7	Very high	89.3	Confident	117 Å²	117	91.4 Å²	91.4	61%	0.613	48%	0.475	S	S	*	.	H	α-helix	trans	-62.9	-46.1	179.2	-169.3	159.5	0	0	0	112.1	V51 E55 L56 L57	V51-L53 HydrophobicContact CG1-CB 4.3Å; V51-L53 PolarHBondContact O-N 2.88Å; V51-L53 VanDerWaalsContact O-N 3.15Å; L53-E55 VanDerWaalsContact C-N 3.33Å; L53-E55 PolarHBondContact O-N 3.49Å; L53-L56 PolarHBondContact O-N 3.35Å; L53-L57 HydrophobicContact CD2-CD1 3.46Å; L53-L57 VanDerWaalsContact CD2-CD1 3.46Å; L53-L57 HydrophobicContact CD2-CG 3.99Å; L53-L57 WeakPolarHBondContact O-CB 3.45Å; L53-L57 WeakPolarHBondContact O-CG 3.41Å; L53-L57 PolarHBondContact O-N 3.31Å
54	K	89.4	Confident	89.6	Confident	86 Å²	86	87.9 Å²	87.9	37%	0.374	46%	0.457	S	S	.	.	H	α-helix	trans	-67.3	-36.4	178	55.2	172.4	151.5	156.5	0	111.7	Y41 S49 V51 L58	Y41-K54 HydrophobicContact CE2-CD 3.59Å; Y41-K54 VanDerWaalsContact CZ-NZ 3.35Å; Y41-K54 WeakPolarHBondContact OH-CD 3.47Å; Y41-K54 WeakPolarHBondContact OH-CE 3.49Å; Y41-K54 PolarHBondContact OH-NZ 3.46Å; S49-K54 PolarHBondContact O-NZ 3.5Å; V51-K54 HydrophobicContact CB-CD 4.25Å; V51-K54 HydrophobicContact CB-CG 3.97Å; V51-K54 WeakPolarHBondContact O-CG 3.27Å; V51-K54 PolarHBondContact O-N 2.77Å; K54-L58 WeakPolarHBondContact O-CB 3.27Å; K54-L58 PolarHBondContact O-N 3.07Å
55	E	92.7	Very high	90	Very high	30 Å²	30	86.3 Å²	86.3	14%	0.14	44%	0.441	C	S	.	.	H	α-helix	trans	-62.2	-48.1	176.8	-75.5	154.3	-143.2	0	0	110.8	F38 Y41 R50 V51 L52 L53 L58 S59	F38-E55 HydrophobicContact CE2-CB 4.21Å; Y41-E55 HydrophobicContact CD1-CG 3.87Å; Y41-E55 HydrophobicContact CE1-CG 3.18Å; Y41-E55 WeakPolarHBondContact CE1-OE1 3.43Å; Y41-E55 PolarHBondContact OH-OE1 3.35Å; R50-E55 WeakPolarHBondContact CB-OE1 3.4Å; V51-E55 PolarHBondContact N-OE1 2.84Å; V51-E55 PolarHBondContact O-N 3.48Å; L52-E55 PolarHBondContact O-N 2.91Å; L53-E55 VanDerWaalsContact C-N 3.33Å; L53-E55 PolarHBondContact O-N 3.49Å; E55-L58 PolarHBondContact O-N 3.47Å; E55-S59 WeakPolarHBondContact O-CB 3.44Å; E55-S59 PolarHBondContact O-N 3.27Å; E55-S59 PolarHBondContact O-OG 2.87Å
56	L	93.3	Very high	90.6	Very high	107 Å²	107	87.7 Å²	87.7	56%	0.56	45%	0.446	S	S	*	.	H	α-helix	trans	-65.3	-43.9	178.8	-172.9	64.4	0	0	0	111.8	L52 L53 L58 S59 F60	L52-L56 WeakPolarHBondContact O-CB 3.46Å; L52-L56 PolarHBondContact O-N 3.38Å; L53-L56 PolarHBondContact O-N 3.35Å; L56-L58 PolarHBondContact O-N 2.91Å; L56-S59 PolarHBondContact O-OG 2.95Å; L56-F60 WeakPolarHBondContact O-CB 3.35Å; L56-F60 PolarHBondContact O-N 3.5Å
57	L	94	Very high	91.2	Very high	104 Å²	104	83.2 Å²	83.2	55%	0.545	43%	0.43	S	S	.	.	H	α-helix	trans	-62.3	-44.7	177.3	-74.4	-178.1	0	0	0	111.8	L53 F60 V61	L53-L57 HydrophobicContact CD2-CD1 3.46Å; L53-L57 VanDerWaalsContact CD2-CD1 3.46Å; L53-L57 HydrophobicContact CD2-CG 3.99Å; L53-L57 WeakPolarHBondContact O-CB 3.45Å; L53-L57 WeakPolarHBondContact O-CG 3.41Å; L53-L57 PolarHBondContact O-N 3.31Å; L57-F60 PolarHBondContact O-N 3.5Å; L57-V61 VanDerWaalsContact O-CG2 3.27Å; L57-V61 WeakPolarHBondContact O-CG2 3.07Å; L57-V61 PolarHBondContact O-N 2.66Å
58	L	93.4	Very high	91.9	Very high	29 Å²	29	77.3 Å²	77.3	15%	0.152	41%	0.41	C	S	.	.	H	α-helix	trans	-67.6	-45.5	-178.6	-177.4	66.3	0	0	0	111.9	F34 F38 K54 E55 L56 F60 V61 A62	F34-L58 HydrophobicContact CD1-CD1 3.67Å; F34-L58 HydrophobicContact CE1-CD1 4.34Å; F38-L58 VanDerWaalsContact CA-CD2 3.46Å; F38-L58 HydrophobicContact CB-CD2 3.73Å; F38-L58 HydrophobicContact CB-CG 4.03Å; F38-L58 HydrophobicContact CD2-CD2 4.12Å; F38-L58 HydrophobicContact CD2-CG 4.4Å; F38-L58 HydrophobicContact CG-CD2 4.44Å; K54-L58 WeakPolarHBondContact O-CB 3.27Å; K54-L58 PolarHBondContact O-N 3.07Å; E55-L58 PolarHBondContact O-N 3.47Å; L56-L58 PolarHBondContact O-N 2.91Å; L58-F60 VanDerWaalsContact C-N 3.34Å; L58-V61 PolarHBondContact O-N 3.01Å; L58-A62 WeakPolarHBondContact O-CB 3.44Å; L58-A62 PolarHBondContact O-N 3.44Å
59	S	94.9	Very high	92.8	Very high	40 Å²	40	68 Å²	68	28%	0.28	37%	0.369	S	S	.	.	H	α-helix	trans	-67.8	-35.2	177.6	68.3	0	0	0	0	111.9	E55 L56 A62 S63	E55-S59 WeakPolarHBondContact O-CB 3.44Å; E55-S59 PolarHBondContact O-N 3.27Å; E55-S59 PolarHBondContact O-OG 2.87Å; L56-S59 PolarHBondContact O-OG 2.95Å; S59-A62 PolarHBondContact O-N 3.32Å; S59-S63 VanDerWaalsContact O-CB 3.25Å; S59-S63 WeakPolarHBondContact O-CB 3.43Å; S59-S63 PolarHBondContact O-N 2.97Å
60	F	95.7	Very high	93.5	Very high	125 Å²	125	68 Å²	68	55%	0.548	37%	0.366	S	S	.	.	H	α-helix	trans	-63.3	-48	174.6	-176	-106.6	0	0	0	111.7	L56 L57 L58 S63 I64	L56-F60 WeakPolarHBondContact O-CB 3.35Å; L56-F60 PolarHBondContact O-N 3.5Å; L57-F60 PolarHBondContact O-N 3.5Å; L58-F60 VanDerWaalsContact C-N 3.34Å; F60-S63 PolarHBondContact O-N 3.21Å; F60-I64 HydrophobicContact CD1-CD1 3.77Å; F60-I64 HydrophobicContact CE1-CD1 3.37Å; F60-I64 HydrophobicContact CE2-CD1 4.26Å; F60-I64 HydrophobicContact CG-CD1 4.38Å; F60-I64 HydrophobicContact CZ-CD1 3.65Å; F60-I64 WeakPolarHBondContact O-CG1 3Å; F60-I64 PolarHBondContact O-N 2.99Å
61	V	96	Very high	94.1	Very high	52 Å²	52	67.3 Å²	67.3	32%	0.315	37%	0.37	S	S	.	.	H	α-helix	trans	-60.3	-48.4	175.1	172.3	0	0	0	0	110.4	F34 L57 L58 S63 I64 F65	F34-V61 HydrophobicContact CD1-CG1 4.48Å; F34-V61 HydrophobicContact CD2-CG1 4.22Å; F34-V61 HydrophobicContact CE1-CG1 4.46Å; F34-V61 HydrophobicContact CE2-CG1 4.22Å; F34-V61 HydrophobicContact CG-CG1 4.37Å; F34-V61 HydrophobicContact CZ-CG1 4.33Å; L57-V61 VanDerWaalsContact O-CG2 3.27Å; L57-V61 WeakPolarHBondContact O-CG2 3.07Å; L57-V61 PolarHBondContact O-N 2.66Å; L58-V61 PolarHBondContact O-N 3.01Å; V61-S63 VanDerWaalsContact C-N 3.32Å; V61-S63 PolarHBondContact O-N 3.46Å; V61-I64 PolarHBondContact O-N 3.05Å; V61-F65 HydrophobicContact CG1-CD2 3.82Å; V61-F65 HydrophobicContact CG1-CE2 3.78Å; V61-F65 VanDerWaalsContact O-CD2 3.27Å; V61-F65 WeakPolarHBondContact O-CD2 3.27Å; V61-F65 PolarHBondContact O-N 3.48Å
62	A	96.7	Very high	94.3	Very high	6 Å²	6	65.6 Å²	65.6	5%	0.05	36%	0.356	C	S	.	.	H	α-helix	trans	-57.3	-45.1	177.5	0	0	0	0	0	112.1	F34 L58 S59 I64 F65 L66	F34-A62 HydrophobicContact CB-CB 3.77Å; L58-A62 WeakPolarHBondContact O-CB 3.44Å; L58-A62 PolarHBondContact O-N 3.44Å; S59-A62 PolarHBondContact O-N 3.32Å; A62-I64 PolarHBondContact O-N 3.27Å; A62-F65 PolarHBondContact O-N 2.91Å; A62-L66 WeakPolarHBondContact O-CB 3.42Å; A62-L66 WeakPolarHBondContact O-CG 3.48Å; A62-L66 PolarHBondContact O-N 3.29Å
63	S	96.8	Very high	94.6	Very high	82 Å²	82	62.4 Å²	62.4	57%	0.573	34%	0.339	S	S	*	.	H	α-helix	trans	-65.4	-36	-179.6	-172.9	0	0	0	0	112.7	S59 F60 V61 G67	S59-S63 VanDerWaalsContact O-CB 3.25Å; S59-S63 WeakPolarHBondContact O-CB 3.43Å; S59-S63 PolarHBondContact O-N 2.97Å; F60-S63 PolarHBondContact O-N 3.21Å; V61-S63 VanDerWaalsContact C-N 3.32Å; V61-S63 PolarHBondContact O-N 3.46Å; S63-G67 WeakPolarHBondContact O-CA 3.44Å; S63-G67 PolarHBondContact O-N 3.01Å
64	I	96.7	Very high	94.8	Very high	79 Å²	79	59.4 Å²	59.4	41%	0.405	32%	0.324	S	S	.	.	H	α-helix	trans	-65.9	-48.2	176.1	-71.4	168.3	0	0	0	110.2	F60 V61 A62 G67 C68	F60-I64 HydrophobicContact CD1-CD1 3.77Å; F60-I64 HydrophobicContact CE1-CD1 3.37Å; F60-I64 HydrophobicContact CE2-CD1 4.26Å; F60-I64 HydrophobicContact CG-CD1 4.38Å; F60-I64 HydrophobicContact CZ-CD1 3.65Å; F60-I64 WeakPolarHBondContact O-CG1 3Å; F60-I64 PolarHBondContact O-N 2.99Å; V61-I64 PolarHBondContact O-N 3.05Å; A62-I64 PolarHBondContact O-N 3.27Å; I64-G67 PolarHBondContact O-N 2.87Å; I64-C68 WeakPolarHBondContact O-CB 3.24Å; I64-C68 PolarHBondContact O-N 2.97Å; I64-C68 PolarHBondContact O-SG 3.5Å; I64-C68 VanDerWaalsContact O-SG 3.41Å
65	F	96.7	Very high	94.9	Very high	72 Å²	72	57.8 Å²	57.8	32%	0.316	32%	0.319	S	S	.	.	H	α-helix	trans	-66.5	-42.4	-179	-80	-74.9	0	0	0	112.3	I30 V61 A62 G69	I30-F65 HydrophobicContact CG2-CD1 4.21Å; I30-F65 HydrophobicContact CG2-CD2 4.47Å; I30-F65 HydrophobicContact CG2-CE1 4.37Å; I30-F65 HydrophobicContact CG2-CG 4.28Å; V61-F65 HydrophobicContact CG1-CD2 3.82Å; V61-F65 HydrophobicContact CG1-CE2 3.78Å; V61-F65 VanDerWaalsContact O-CD2 3.27Å; V61-F65 WeakPolarHBondContact O-CD2 3.27Å; V61-F65 PolarHBondContact O-N 3.48Å; A62-F65 PolarHBondContact O-N 2.91Å; F65-G69 WeakPolarHBondContact O-CA 3.33Å; F65-G69 PolarHBondContact O-N 3.15Å
66	L	97	Very high	94.8	Very high	41 Å²	41	63.4 Å²	63.4	22%	0.215	34%	0.339	C	S	.	.	H	α-helix	trans	-68	-40.9	175	-71.1	176.6	0	0	0	111.9	L28 M35 A62 G69 T70	L28-L66 HydrophobicContact CD2-CD2 3.94Å; M35-L66 HydrophobicContact CB-CD1 4.04Å; M35-L66 HydrophobicContact CG-CD1 4.38Å; M35-L66 HydrophobicContact SD-CD1 3.78Å; A62-L66 WeakPolarHBondContact O-CB 3.42Å; A62-L66 WeakPolarHBondContact O-CG 3.48Å; A62-L66 PolarHBondContact O-N 3.29Å; L66-G69 PolarHBondContact O-N 3.47Å; L66-T70 WeakPolarHBondContact O-CB 3.26Å; L66-T70 VanDerWaalsContact O-CG2 3.25Å; L66-T70 WeakPolarHBondContact O-CG2 3.34Å; L66-T70 PolarHBondContact O-N 2.88Å; L66-T70 PolarHBondContact O-OG1 2.87Å
67	G	95.8	Very high	94.8	Very high	30 Å²	30	62.9 Å²	62.9	31%	0.309	34%	0.34	S	S	.	.	H	α-helix	trans	-62	-53	176.7	0	0	0	0	0	111.9	S63 I64 G69 T70 L71	S63-G67 WeakPolarHBondContact O-CA 3.44Å; S63-G67 PolarHBondContact O-N 3.01Å; I64-G67 PolarHBondContact O-N 2.87Å; G67-G69 VanDerWaalsContact C-N 3.35Å; G67-G69 PolarHBondContact O-N 2.86Å; G67-T70 PolarHBondContact O-N 3.35Å; G67-T70 PolarHBondContact O-OG1 2.78Å; G67-L71 WeakPolarHBondContact O-CG 3.5Å; G67-L71 PolarHBondContact O-N 3.44Å; G67-L71 VanDerWaalsContact O-N 3.14Å
68	C	94.5	Very high	94.6	Very high	53 Å²	53	59.5 Å²	59.5	36%	0.358	33%	0.33	S	S	.	.	H	α-helix	trans	-63	-41	175.9	-69.7	0	0	0	0	111.9	L27 I64 T70 L71 F72	L27-C68 HydrophobicContact CD2-CB 3.51Å; I64-C68 WeakPolarHBondContact O-CB 3.24Å; I64-C68 PolarHBondContact O-N 2.97Å; I64-C68 PolarHBondContact O-SG 3.5Å; I64-C68 VanDerWaalsContact O-SG 3.41Å; C68-T70 PolarHBondContact O-N 3.39Å; C68-L71 PolarHBondContact O-N 3.49Å; C68-F72 WeakPolarHBondContact O-CD2 3.42Å; C68-F72 PolarHBondContact O-N 3.37Å
69	G	96	Very high	94.5	Very high	0 Å²	0	62.5 Å²	62.5	0%	0	35%	0.345	C	S	.	.	H	α-helix	trans	-63	-39.8	178	0	0	0	0	0	113.2	F65 L66 G67 F72 L73	F65-G69 WeakPolarHBondContact O-CA 3.33Å; F65-G69 PolarHBondContact O-N 3.15Å; L66-G69 PolarHBondContact O-N 3.47Å; G67-G69 VanDerWaalsContact C-N 3.35Å; G67-G69 PolarHBondContact O-N 2.86Å; G69-F72 PolarHBondContact O-N 3.27Å; G69-L73 PolarHBondContact O-N 2.96Å
70	T	95.2	Very high	93.9	Very high	65 Å²	65	69.5 Å²	69.5	40%	0.399	37%	0.367	S	S	.	.	H	α-helix	trans	-69.4	-34.4	176.5	50.3	0	0	0	0	112.6	L28 L66 G67 C68 F72 L73 L74	L28-T70 HydrophobicContact CD2-CG2 4.03Å; L66-T70 WeakPolarHBondContact O-CB 3.26Å; L66-T70 VanDerWaalsContact O-CG2 3.25Å; L66-T70 WeakPolarHBondContact O-CG2 3.34Å; L66-T70 PolarHBondContact O-N 2.88Å; L66-T70 PolarHBondContact O-OG1 2.87Å; G67-T70 PolarHBondContact O-N 3.35Å; G67-T70 PolarHBondContact O-OG1 2.78Å; C68-T70 PolarHBondContact O-N 3.39Å; T70-F72 PolarHBondContact O-N 2.94Å; T70-L73 WeakPolarHBondContact O-CB 3.39Å; T70-L73 PolarHBondContact O-N 3.43Å; T70-L73 VanDerWaalsContact O-N 3.16Å; T70-L74 WeakPolarHBondContact O-CG 3.2Å; T70-L74 PolarHBondContact O-N 2.95Å
71	L	94.2	Very high	92.7	Very high	88 Å²	88	71 Å²	71	46%	0.461	39%	0.386	S	S	.	.	H	α-helix	trans	-60.1	-44.8	171.7	-69	176.4	0	0	0	111.8	G67 C68 L73 L74 L75 V81	G67-L71 WeakPolarHBondContact O-CG 3.5Å; G67-L71 PolarHBondContact O-N 3.44Å; G67-L71 VanDerWaalsContact O-N 3.14Å; C68-L71 PolarHBondContact O-N 3.49Å; L71-L73 VanDerWaalsContact C-N 3.29Å; L71-L73 PolarHBondContact O-N 2.96Å; L71-L74 PolarHBondContact O-N 2.9Å; L71-L75 WeakPolarHBondContact O-CG 3.2Å; L71-L75 PolarHBondContact O-N 2.75Å; L71-L75 VanDerWaalsContact O-N 3.11Å; L71-V81 HydrophobicContact CD2-CG2 4.46Å
72	F	92.5	Very high	92.6	Very high	42 Å²	42	72 Å²	72	18%	0.184	39%	0.39	C	S	.	.	H	α-helix	trans	-67.3	-30.6	175.2	-74.6	-72.1	0	0	0	112.8	I15 Y20 L23 T24 L27 C68 G69 T70 L75 W76	I15-F72 HydrophobicContact CD1-CE1 4.1Å; I15-F72 HydrophobicContact CD1-CZ 4.19Å; Y20-F72 HydrophobicContact CD1-CD1 4.18Å; L23-F72 HydrophobicContact CB-CD1 4.44Å; L23-F72 HydrophobicContact CB-CG 4.35Å; L23-F72 HydrophobicContact CD1-CD1 4.31Å; L23-F72 HydrophobicContact CD1-CE1 3.99Å; L23-F72 HydrophobicContact CD1-CZ 4.33Å; T24-F72 WeakPolarHBondContact OG1-CB 3.36Å; T24-F72 PolarHBondContact OG1-O 2.77Å; L27-F72 HydrophobicContact CD2-CD2 4.29Å; L27-F72 HydrophobicContact CD2-CE2 4.45Å; C68-F72 WeakPolarHBondContact O-CD2 3.42Å; C68-F72 PolarHBondContact O-N 3.37Å; G69-F72 PolarHBondContact O-N 3.27Å; T70-F72 PolarHBondContact O-N 2.94Å; F72-L75 HydrophobicContact CD1-CD1 4.23Å; F72-L75 PolarHBondContact O-N 2.89Å; F72-W76 WeakPolarHBondContact O-CB 3.48Å; F72-W76 PolarHBondContact O-N 3.5Å
73	L	94	Very high	92.4	Very high	63 Å²	63	75.5 Å²	75.5	33%	0.33	41%	0.408	S	S	.	.	H	α-helix	trans	-62.3	-45.9	172.6	-169.5	153.1	0	0	0	110.9	T24 L28 G69 T70 L71 L75 W76 V77	T24-L73 HydrophobicContact CG2-CB 3.58Å; T24-L73 HydrophobicContact CG2-CD1 4.18Å; T24-L73 HydrophobicContact CG2-CG 4.09Å; T24-L73 PolarHBondContact OG1-N 3.36Å; L28-L73 HydrophobicContact CD1-CD1 3.73Å; G69-L73 PolarHBondContact O-N 2.96Å; T70-L73 WeakPolarHBondContact O-CB 3.39Å; T70-L73 PolarHBondContact O-N 3.43Å; T70-L73 VanDerWaalsContact O-N 3.16Å; L71-L73 VanDerWaalsContact C-N 3.29Å; L71-L73 PolarHBondContact O-N 2.96Å; L73-L75 VanDerWaalsContact C-N 3.34Å; L73-L75 PolarHBondContact O-N 3.44Å; L73-W76 WeakPolarHBondContact O-CB 3.04Å; L73-W76 PolarHBondContact O-N 3.25Å; L73-W76 VanDerWaalsContact O-N 3.16Å; L73-V77 HydrophobicContact CD2-CG2 4.05Å; L73-V77 WeakPolarHBondContact O-CG2 2.86Å; L73-V77 PolarHBondContact O-N 3.18Å
74	L	94.8	Very high	92.1	Very high	54 Å²	54	75.1 Å²	75.1	28%	0.283	40%	0.399	S	S	.	.	H	α-helix	trans	-59.3	-46.6	177	-68	174	0	0	0	110.8	T70 L71 W76 V77 G78 I79 V81	T70-L74 WeakPolarHBondContact O-CG 3.2Å; T70-L74 PolarHBondContact O-N 2.95Å; L71-L74 PolarHBondContact O-N 2.9Å; L74-W76 VanDerWaalsContact C-N 3.3Å; L74-W76 PolarHBondContact O-N 3.15Å; L74-V77 PolarHBondContact O-N 3.37Å; L74-G78 PolarHBondContact O-N 3.48Å; L74-I79 CarbonylContact C-O 3.17Å; L74-I79 HydrophobicContact CB-CB 4.27Å; L74-I79 WeakPolarHBondContact CB-O 3Å; L74-I79 HydrophobicContact CD2-CB 4.19Å; L74-I79 HydrophobicContact CD2-CD1 4.12Å; L74-I79 HydrophobicContact CD2-CG2 4.22Å; L74-I79 PolarHBondContact O-N 2.93Å; L74-I79 VanDerWaalsContact O-O 3.1Å; L74-V81 HydrophobicContact CB-CG2 4.45Å; L74-V81 HydrophobicContact CD1-CG2 3.56Å
75	L	91.9	Very high	91.8	Very high	51 Å²	51	74.9 Å²	74.9	27%	0.267	40%	0.398	S	S	.	.	H	α-helix	trans	-61.1	-36.8	175.5	-65.9	178.4	0	0	0	112.8	Y20 L71 F72 L73 G78 Y80	Y20-L75 HydrophobicContact CD2-CB 3.85Å; Y20-L75 HydrophobicContact CE2-CB 3.92Å; Y20-L75 HydrophobicContact CG-CB 4.43Å; L71-L75 WeakPolarHBondContact O-CG 3.2Å; L71-L75 PolarHBondContact O-N 2.75Å; L71-L75 VanDerWaalsContact O-N 3.11Å; F72-L75 HydrophobicContact CD1-CD1 4.23Å; F72-L75 PolarHBondContact O-N 2.89Å; L73-L75 VanDerWaalsContact C-N 3.34Å; L73-L75 PolarHBondContact O-N 3.44Å; L75-G78 PolarHBondContact O-N 3.24Å; L75-Y80 HydrophobicContact CD2-CD1 3.99Å
76	W	91.2	Very high	91.5	Very high	148 Å²	148	75.1 Å²	75.1	56%	0.561	40%	0.403	S	S	*	.	H	α-helix	trans	-66.7	-40	176.3	177.8	26.4	0	0	0	112.3	P21 T24 F72 L73 L74 G78	P21-W76 HydrophobicContact CB-CD2 4.04Å; P21-W76 HydrophobicContact CB-CE3 4.49Å; P21-W76 HydrophobicContact CB-CG 4.43Å; P21-W76 HydrophobicContact CB-CZ2 4.08Å; P21-W76 HydrophobicContact CG-CD2 4.14Å; P21-W76 HydrophobicContact CG-CG 4.08Å; P21-W76 HydrophobicContact CG-CZ2 4.45Å; T24-W76 HydrophobicContact CG2-CE3 4.46Å; F72-W76 WeakPolarHBondContact O-CB 3.48Å; F72-W76 PolarHBondContact O-N 3.5Å; L73-W76 WeakPolarHBondContact O-CB 3.04Å; L73-W76 PolarHBondContact O-N 3.25Å; L73-W76 VanDerWaalsContact O-N 3.16Å; L74-W76 VanDerWaalsContact C-N 3.3Å; L74-W76 PolarHBondContact O-N 3.15Å; W76-G78 PolarHBondContact O-N 3Å
77	V	93	Very high	91.2	Very high	97 Å²	97	77.3 Å²	77.3	59%	0.588	42%	0.416	S	S	*	.	H	α-helix	trans	-71.7	-15.1	175.1	177.7	0	0	0	0	112	L73 L74 I79	L73-V77 HydrophobicContact CD2-CG2 4.05Å; L73-V77 WeakPolarHBondContact O-CG2 2.86Å; L73-V77 PolarHBondContact O-N 3.18Å; L74-V77 PolarHBondContact O-N 3.37Å; V77-I79 HydrophobicContact CG1-CD1 4.1Å; V77-I79 HydrophobicContact CG1-CG1 4.14Å
78	G	89.8	Confident	90.8	Very high	33 Å²	33	80.7 Å²	80.7	34%	0.34	42%	0.423	S	S	.	.	T	Hydrogen-bonded Turn	trans	88.2	15.2	-176.2	0	0	0	0	0	113.5	L74 L75 W76 Y80	L74-G78 PolarHBondContact O-N 3.48Å; L75-G78 PolarHBondContact O-N 3.24Å; W76-G78 PolarHBondContact O-N 3Å; G78-Y80 WeakPolarHBondContact O-CD2 3.44Å; G78-Y80 WeakPolarHBondContact O-CE2 3.31Å; G78-Y80 PolarHBondContact O-N 2.97Å
79	I	91.1	Very high	90.6	Very high	92 Å²	92	82.8 Å²	82.8	47%	0.472	43%	0.429	S	S	.	.			trans	-88.3	103.3	170	-57.5	173.4	0	0	0	107.1	L74 V77	L74-I79 CarbonylContact C-O 3.17Å; L74-I79 HydrophobicContact CB-CB 4.27Å; L74-I79 WeakPolarHBondContact CB-O 3Å; L74-I79 HydrophobicContact CD2-CB 4.19Å; L74-I79 HydrophobicContact CD2-CD1 4.12Å; L74-I79 HydrophobicContact CD2-CG2 4.22Å; L74-I79 PolarHBondContact O-N 2.93Å; L74-I79 VanDerWaalsContact O-O 3.1Å; V77-I79 HydrophobicContact CG1-CD1 4.1Å; V77-I79 HydrophobicContact CG1-CG1 4.14Å
80	Y	81.6	Confident	90.1	Very high	186 Å²	186	89.8 Å²	89.8	73%	0.729	46%	0.464	S	S	*	.			trans	-81.6	128.7	177.3	-51.1	-73.3	0	0	0	109.7	L75 G78	L75-Y80 HydrophobicContact CD2-CD1 3.99Å; G78-Y80 WeakPolarHBondContact O-CD2 3.44Å; G78-Y80 WeakPolarHBondContact O-CE2 3.31Å; G78-Y80 PolarHBondContact O-N 2.97Å
81	V	72	Confident	89.6	Confident	158 Å²	158	92 Å²	92	96%	0.958	47%	0.47	S	S	*	.			trans	-98.3	0	172.3	-179.9	0	0	0	0	109.3	L71 L74	L71-V81 HydrophobicContact CD2-CG2 4.46Å; L74-V81 HydrophobicContact CB-CG2 4.45Å; L74-V81 HydrophobicContact CD1-CG2 3.56Å

Retrieved 81 of 81 residues in 105.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).