A0A5K4F5B7_SCHMA Loading...

Mediator of RNA polymerase II transcription subunit 28

AlphaFold DB , UniProt , Accession A0A5K4F5B7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 121 aa.

						>A0A5K4F5B7_SCHMA|A0A5K4F5B7
MDPDAKVLSDLETQLDNIFMVLSSTGLHDSDISESQHGLNDKHMASLLDACRQMDSWFIKKRLALSTYYQEYALKEEIDALNAECIRKEKLAQELKGRIEDYSKSIQVIIDQFSKDLPYFA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.7	Low	89.2	Confident	179 Å²	179	71.2 Å²	71.2	88%	0.882	39%	0.392	S	S	*	.				0	137.2	0	-125.1	-179.5	176.5	0	0	107.5
2	D	86.5	Confident	89.8	Confident	92 Å²	92	73.4 Å²	73.4	49%	0.492	40%	0.397	S	S	.	.			trans	-55.7	126.4	170.4	176	-0.7	0	0	0	108.9	D4 A5 K6	D2-D4 PolarHBondContact O-N 3.44Å; D2-D4 VanDerWaalsContact O-N 3.14Å; D2-D4 PolarHBondContact OD1-N 3.07Å; D2-A5 HydrophobicContact CB-CB 3.95Å; D2-A5 PolarHBondContact O-N 3.48Å; D2-A5 VanDerWaalsContact O-N 3.11Å; D2-K6 PolarHBondContact O-N 2.89Å
3	P	85.1	Confident	90.2	Very high	97 Å²	97	72.3 Å²	72.3	63%	0.63	40%	0.395	S	S	*	.	H	α-helix	trans	-51.5	-33.1	177.3	-26.5	34	0	0	0	113.3
4	D	88.7	Confident	90.5	Very high	53 Å²	53	69.9 Å²	69.9	28%	0.283	38%	0.379	S	S	.	.	H	α-helix	trans	-70.4	-46.1	178.8	-66	-21	0	0	0	111.3	D2 K6 V7 W57 K61	D2-D4 PolarHBondContact O-N 3.44Å; D2-D4 VanDerWaalsContact O-N 3.14Å; D2-D4 PolarHBondContact OD1-N 3.07Å; D4-K6 PolarHBondContact O-N 3.25Å; D4-V7 PolarHBondContact O-N 3.33Å; D4-W57 HydrophobicContact CB-CZ2 4.02Å; D4-W57 VanDerWaalsContact CG-NE1 3.32Å; D4-W57 PolarHBondContact OD1-NE1 2.85Å; D4-K61 WeakPolarHBondContact OD1-CE 3.34Å; D4-K61 IonicContact OD1-NZ 3.08Å; D4-K61 PolarHBondContact OD1-NZ 3.25Å; D4-K61 VanDerWaalsContact OD1-NZ 3.08Å; D4-K61 VanDerWaalsContact OD2-CE 3.24Å; D4-K61 WeakPolarHBondContact OD2-CE 3.5Å; D4-K61 IonicContact OD2-NZ 2.61Å; D4-K61 PolarHBondContact OD2-NZ 3.09Å
5	A	92	Very high	90.7	Very high	47 Å²	47	69.4 Å²	69.4	39%	0.388	38%	0.376	S	S	.	.	H	α-helix	trans	-64.3	-30.6	176.8	0	0	0	0	0	112.1	D2 S9	D2-A5 HydrophobicContact CB-CB 3.95Å; D2-A5 PolarHBondContact O-N 3.48Å; D2-A5 VanDerWaalsContact O-N 3.11Å; A5-S9 WeakPolarHBondContact O-CB 3.49Å; A5-S9 PolarHBondContact O-N 3.37Å
6	K	93.8	Very high	90.9	Very high	107 Å²	107	71.2 Å²	71.2	47%	0.465	39%	0.385	S	S	.	.	H	α-helix	trans	-63.1	-41.6	178.1	-171.2	-174.4	173.5	-166.4	0	112	D2 D4 L8 S9 D10	D2-K6 PolarHBondContact O-N 2.89Å; D4-K6 PolarHBondContact O-N 3.25Å; K6-L8 VanDerWaalsContact C-N 3.32Å; K6-L8 PolarHBondContact O-N 3.22Å; K6-S9 PolarHBondContact O-N 2.84Å; K6-D10 VanDerWaalsContact CE-OD2 3.32Å; K6-D10 WeakPolarHBondContact CE-OD2 3.42Å; K6-D10 WeakPolarHBondContact O-CB 3.19Å; K6-D10 VanDerWaalsContact O-CG 3.27Å; K6-D10 PolarHBondContact O-N 3.01Å
7	V	94.6	Very high	90.8	Very high	22 Å²	22	71 Å²	71	13%	0.133	38%	0.384	C	S	.	.	H	α-helix	trans	-61.7	-42	-177.9	176	0	0	0	0	111.6	D4 L11 M54 W57	D4-V7 PolarHBondContact O-N 3.33Å; V7-L11 PolarHBondContact O-N 3.2Å; V7-M54 HydrophobicContact CG1-CB 3.98Å; V7-M54 HydrophobicContact CG1-CG 4.47Å; V7-W57 HydrophobicContact CG1-CB 4.1Å; V7-W57 HydrophobicContact CG1-CG 4.45Å; V7-W57 HydrophobicContact CG2-CB 4.39Å; V7-W57 HydrophobicContact CG2-CG 4.39Å
8	L	94.2	Very high	90.8	Very high	88 Å²	88	67.8 Å²	67.8	46%	0.461	37%	0.366	S	S	.	.	H	α-helix	trans	-67.6	-47	175.2	179.6	61.3	0	0	0	111.2	K6 D10 L11 E12	K6-L8 VanDerWaalsContact C-N 3.32Å; K6-L8 PolarHBondContact O-N 3.22Å; L8-D10 VanDerWaalsContact C-N 3.28Å; L8-D10 PolarHBondContact O-N 3.17Å; L8-L11 WeakPolarHBondContact O-CB 3.26Å; L8-L11 PolarHBondContact O-N 3.16Å; L8-L11 VanDerWaalsContact O-N 3.12Å; L8-E12 HydrophobicContact CD1-CG 4.28Å; L8-E12 HydrophobicContact CG-CG 4.39Å; L8-E12 WeakPolarHBondContact O-CG 3.35Å; L8-E12 PolarHBondContact O-N 2.85Å
9	S	95.6	Very high	90.7	Very high	32 Å²	32	70.3 Å²	70.3	22%	0.224	37%	0.373	C	S	.	.	H	α-helix	trans	-59.6	-38	178.9	-179	0	0	0	0	112.4	A5 K6 T13	A5-S9 WeakPolarHBondContact O-CB 3.49Å; A5-S9 PolarHBondContact O-N 3.37Å; K6-S9 PolarHBondContact O-N 2.84Å; S9-T13 WeakPolarHBondContact O-CB 3.38Å; S9-T13 PolarHBondContact O-N 3.35Å; S9-T13 PolarHBondContact O-OG1 3.24Å
10	D	95.3	Very high	90.5	Very high	48 Å²	48	73.5 Å²	73.5	26%	0.257	39%	0.388	S	S	.	.	H	α-helix	trans	-65.9	-40.8	177.1	-74.9	-16.9	0	0	0	110.6	K6 L8 Q14	K6-D10 VanDerWaalsContact CE-OD2 3.32Å; K6-D10 WeakPolarHBondContact CE-OD2 3.42Å; K6-D10 WeakPolarHBondContact O-CB 3.19Å; K6-D10 VanDerWaalsContact O-CG 3.27Å; K6-D10 PolarHBondContact O-N 3.01Å; L8-D10 VanDerWaalsContact C-N 3.28Å; L8-D10 PolarHBondContact O-N 3.17Å; D10-Q14 WeakPolarHBondContact O-CG 3.36Å; D10-Q14 PolarHBondContact O-N 3.4Å; D10-Q14 VanDerWaalsContact O-N 3.09Å
11	L	96	Very high	90.2	Very high	18 Å²	18	71.2 Å²	71.2	9%	0.094	38%	0.377	C	S	.	.	H	α-helix	trans	-64.9	-49.3	174.6	-179.5	72.8	0	0	0	112.2	V7 L8 T13 Q14 L15 L47 A50 M54	V7-L11 PolarHBondContact O-N 3.2Å; L8-L11 WeakPolarHBondContact O-CB 3.26Å; L8-L11 PolarHBondContact O-N 3.16Å; L8-L11 VanDerWaalsContact O-N 3.12Å; L11-T13 VanDerWaalsContact C-N 3.26Å; L11-T13 PolarHBondContact O-N 3.5Å; L11-Q14 PolarHBondContact O-N 3.17Å; L11-Q14 VanDerWaalsContact O-N 3.08Å; L11-L15 HydrophobicContact CG-CD1 4.17Å; L11-L15 WeakPolarHBondContact O-CG 3.34Å; L11-L15 PolarHBondContact O-N 3.45Å; L11-L47 HydrophobicContact CD1-CD1 3.95Å; L11-A50 HydrophobicContact CB-CB 4.36Å; L11-A50 HydrophobicContact CD1-CB 3.98Å; L11-M54 HydrophobicContact CD2-CE 3.31Å; L11-M54 HydrophobicContact CD2-SD 3.48Å; L11-M54 WeakPolarHBondContact CD2-SD 3.42Å
12	E	95.7	Very high	91.3	Very high	98 Å²	98	66.7 Å²	66.7	46%	0.458	36%	0.356	S	S	.	.	H	α-helix	trans	-55.7	-45.2	177.2	-71.8	173.9	160.5	0	0	110.4	L8 Q14 L15 D16	L8-E12 HydrophobicContact CD1-CG 4.28Å; L8-E12 HydrophobicContact CG-CG 4.39Å; L8-E12 WeakPolarHBondContact O-CG 3.35Å; L8-E12 PolarHBondContact O-N 2.85Å; E12-Q14 VanDerWaalsContact C-N 3.33Å; E12-Q14 PolarHBondContact O-N 3.15Å; E12-L15 PolarHBondContact O-N 3.44Å; E12-L15 VanDerWaalsContact O-N 3.17Å; E12-D16 PolarHBondContact O-N 2.95Å
13	T	95.6	Very high	91	Very high	59 Å²	59	66.1 Å²	66.1	36%	0.362	36%	0.359	S	S	.	.	H	α-helix	trans	-59.2	-41.4	176.1	-58.2	0	0	0	0	112.2	S9 L11 N17	S9-T13 WeakPolarHBondContact O-CB 3.38Å; S9-T13 PolarHBondContact O-N 3.35Å; S9-T13 PolarHBondContact O-OG1 3.24Å; L11-T13 VanDerWaalsContact C-N 3.26Å; L11-T13 PolarHBondContact O-N 3.5Å; T13-N17 WeakPolarHBondContact O-CB 3.46Å; T13-N17 PolarHBondContact O-N 2.91Å; T13-N17 PolarHBondContact O-ND2 3.02Å; T13-N17 VanDerWaalsContact O-ND2 3.15Å
14	Q	94	Very high	90.4	Very high	39 Å²	39	65.1 Å²	65.1	18%	0.182	36%	0.355	C	S	.	.	H	α-helix	trans	-69.9	-36.3	177.4	-63.4	-38.1	-52.8	0	0	112.7	D10 L11 E12 N17 I18 L47 A50	D10-Q14 WeakPolarHBondContact O-CG 3.36Å; D10-Q14 PolarHBondContact O-N 3.4Å; D10-Q14 VanDerWaalsContact O-N 3.09Å; L11-Q14 PolarHBondContact O-N 3.17Å; L11-Q14 VanDerWaalsContact O-N 3.08Å; E12-Q14 VanDerWaalsContact C-N 3.33Å; E12-Q14 PolarHBondContact O-N 3.15Å; Q14-N17 PolarHBondContact O-N 3.46Å; Q14-N17 PolarHBondContact OE1-ND2 3Å; Q14-I18 VanDerWaalsContact O-CG1 3.28Å; Q14-I18 WeakPolarHBondContact O-CG1 3.47Å; Q14-I18 PolarHBondContact O-N 3.48Å; Q14-I18 VanDerWaalsContact O-N 3.14Å; Q14-L47 HydrophobicContact CB-CB 4.42Å; Q14-L47 HydrophobicContact CB-CD1 4.21Å; Q14-A50 HydrophobicContact CB-CB 4.47Å; Q14-A50 HydrophobicContact CG-CB 3.93Å
15	L	94.3	Very high	89.2	Confident	62 Å²	62	66.1 Å²	66.1	33%	0.325	36%	0.362	S	S	.	.	H	α-helix	trans	-63.9	-45.8	173.9	-70.5	171	0	0	0	110.9	L11 E12 N17 I18 F19 L47	L11-L15 HydrophobicContact CG-CD1 4.17Å; L11-L15 WeakPolarHBondContact O-CG 3.34Å; L11-L15 PolarHBondContact O-N 3.45Å; E12-L15 PolarHBondContact O-N 3.44Å; E12-L15 VanDerWaalsContact O-N 3.17Å; L15-N17 VanDerWaalsContact C-N 3.34Å; L15-N17 PolarHBondContact O-N 2.83Å; L15-I18 WeakPolarHBondContact O-CB 3.47Å; L15-I18 PolarHBondContact O-N 3.4Å; L15-I18 VanDerWaalsContact O-N 3.15Å; L15-F19 HydrophobicContact CB-CD2 4.38Å; L15-F19 HydrophobicContact CB-CE2 4.02Å; L15-F19 WeakPolarHBondContact O-CD2 3.31Å; L15-F19 WeakPolarHBondContact O-CG 3.34Å; L15-F19 PolarHBondContact O-N 3.22Å; L15-L47 HydrophobicContact CD2-CD1 3.87Å; L15-L47 HydrophobicContact CG-CD1 4.24Å
16	D	93.2	Very high	87.5	Confident	98 Å²	98	67.1 Å²	67.1	52%	0.524	38%	0.377	S	S	.	.	H	α-helix	trans	-59.9	-44	177	-74.3	-17.9	0	0	0	111.6	E12 I18 F19 M20	E12-D16 PolarHBondContact O-N 2.95Å; D16-I18 VanDerWaalsContact C-N 3.3Å; D16-I18 PolarHBondContact O-N 2.9Å; D16-F19 PolarHBondContact O-N 3.23Å; D16-M20 WeakPolarHBondContact O-CB 3.19Å; D16-M20 VanDerWaalsContact O-CG 3.28Å; D16-M20 WeakPolarHBondContact O-CG 3.42Å; D16-M20 PolarHBondContact O-N 3.48Å
17	N	89.9	Confident	85.6	Confident	68 Å²	68	69.1 Å²	69.1	36%	0.364	39%	0.393	S	S	.	.	H	α-helix	trans	-57.6	-43.2	175.6	-71.8	-26.7	0	0	0	111.9	T13 Q14 L15 V21	T13-N17 WeakPolarHBondContact O-CB 3.46Å; T13-N17 PolarHBondContact O-N 2.91Å; T13-N17 PolarHBondContact O-ND2 3.02Å; T13-N17 VanDerWaalsContact O-ND2 3.15Å; Q14-N17 PolarHBondContact O-N 3.46Å; Q14-N17 PolarHBondContact OE1-ND2 3Å; L15-N17 VanDerWaalsContact C-N 3.34Å; L15-N17 PolarHBondContact O-N 2.83Å; N17-V21 WeakPolarHBondContact O-CG2 3.16Å; N17-V21 PolarHBondContact O-N 3Å
18	I	89.6	Confident	83.3	Confident	14 Å²	14	75.1 Å²	75.1	7%	0.072	42%	0.419	C	S	.	.	H	α-helix	trans	-66.3	-46.5	178.1	-70.2	169.1	0	0	0	110.6	Q14 L15 D16 M20 V21 L22 L39 H43 M44 L47	Q14-I18 VanDerWaalsContact O-CG1 3.28Å; Q14-I18 WeakPolarHBondContact O-CG1 3.47Å; Q14-I18 PolarHBondContact O-N 3.48Å; Q14-I18 VanDerWaalsContact O-N 3.14Å; L15-I18 WeakPolarHBondContact O-CB 3.47Å; L15-I18 PolarHBondContact O-N 3.4Å; L15-I18 VanDerWaalsContact O-N 3.15Å; D16-I18 VanDerWaalsContact C-N 3.3Å; D16-I18 PolarHBondContact O-N 2.9Å; I18-M20 VanDerWaalsContact C-N 3.3Å; I18-M20 PolarHBondContact O-N 3.35Å; I18-V21 PolarHBondContact O-N 3.37Å; I18-L22 HydrophobicContact CG2-CD1 3.87Å; I18-L22 HydrophobicContact CG2-CG 4.4Å; I18-L22 WeakPolarHBondContact O-CG 3.47Å; I18-L22 PolarHBondContact O-N 3.44Å; I18-L39 HydrophobicContact CB-CD2 4.09Å; I18-L39 HydrophobicContact CG1-CD2 3.83Å; I18-L39 HydrophobicContact CG2-CD1 4.01Å; I18-L39 HydrophobicContact CG2-CD2 3.82Å; I18-H43 HydrophobicContact CG1-CB 4.36Å; I18-M44 HydrophobicContact CD1-CE 3.37Å; I18-M44 HydrophobicContact CG1-CE 3.73Å; I18-L47 HydrophobicContact CD1-CB 3.68Å; I18-L47 HydrophobicContact CD1-CD1 4.23Å; I18-L47 HydrophobicContact CD1-CD2 3.4Å; I18-L47 VanDerWaalsContact CD1-CD2 3.4Å; I18-L47 HydrophobicContact CD1-CG 3.94Å
19	F	88.5	Confident	80.8	Confident	114 Å²	114	79.3 Å²	79.3	50%	0.5	44%	0.442	S	S	.	.	H	α-helix	trans	-63.5	-36.7	179.6	-68	-43.7	0	0	0	112.4	L15 D16 L22 S23	L15-F19 HydrophobicContact CB-CD2 4.38Å; L15-F19 HydrophobicContact CB-CE2 4.02Å; L15-F19 WeakPolarHBondContact O-CD2 3.31Å; L15-F19 WeakPolarHBondContact O-CG 3.34Å; L15-F19 PolarHBondContact O-N 3.22Å; D16-F19 PolarHBondContact O-N 3.23Å; F19-L22 PolarHBondContact O-N 2.99Å; F19-S23 VanDerWaalsContact O-CB 3.26Å; F19-S23 WeakPolarHBondContact O-CB 3.5Å; F19-S23 PolarHBondContact O-N 3.48Å; F19-S23 PolarHBondContact O-OG 3.41Å
20	M	87.2	Confident	78.3	Confident	135 Å²	135	80.9 Å²	80.9	67%	0.665	45%	0.452	S	S	*	.	H	α-helix	trans	-62.2	-45.3	173.9	-75.7	-61.1	-59.4	0	0	112.1	D16 I18 S23 S24	D16-M20 WeakPolarHBondContact O-CB 3.19Å; D16-M20 VanDerWaalsContact O-CG 3.28Å; D16-M20 WeakPolarHBondContact O-CG 3.42Å; D16-M20 PolarHBondContact O-N 3.48Å; I18-M20 VanDerWaalsContact C-N 3.3Å; I18-M20 PolarHBondContact O-N 3.35Å; M20-S23 PolarHBondContact O-N 2.88Å; M20-S24 PolarHBondContact O-N 3.31Å; M20-S24 VanDerWaalsContact O-N 3.07Å
21	V	84.5	Confident	75.9	Confident	25 Å²	25	87 Å²	87	15%	0.152	49%	0.485	C	S	.	.	H	α-helix	trans	-63.2	-48.1	177	173.6	0	0	0	0	110.6	N17 I18 S23 S24 T25 L39	N17-V21 WeakPolarHBondContact O-CG2 3.16Å; N17-V21 PolarHBondContact O-N 3Å; I18-V21 PolarHBondContact O-N 3.37Å; V21-S23 VanDerWaalsContact C-N 3.33Å; V21-S23 PolarHBondContact O-N 3.4Å; V21-S24 PolarHBondContact O-N 3.1Å; V21-S24 PolarHBondContact O-OG 3.5Å; V21-T25 PolarHBondContact O-N 3.39Å; V21-T25 PolarHBondContact O-OG1 3.33Å; V21-L39 HydrophobicContact CB-CD2 4.4Å; V21-L39 HydrophobicContact CG1-CD2 4.32Å; V21-L39 HydrophobicContact CG1-CG 4.13Å
22	L	81.9	Confident	73.5	Confident	84 Å²	84	91.2 Å²	91.2	44%	0.44	51%	0.507	S	S	.	.	H	α-helix	trans	-61.1	-39.9	178.2	-73.2	174.7	0	0	0	112.7	I18 F19 S24 T25 L39	I18-L22 HydrophobicContact CG2-CD1 3.87Å; I18-L22 HydrophobicContact CG2-CG 4.4Å; I18-L22 WeakPolarHBondContact O-CG 3.47Å; I18-L22 PolarHBondContact O-N 3.44Å; F19-L22 PolarHBondContact O-N 2.99Å; L22-S24 VanDerWaalsContact C-N 3.3Å; L22-S24 PolarHBondContact O-N 3.19Å; L22-T25 WeakPolarHBondContact CA-OG1 3.15Å; L22-T25 PolarHBondContact O-N 2.99Å; L22-T25 PolarHBondContact O-OG1 2.9Å; L22-L39 HydrophobicContact CD1-CD1 4.14Å; L22-L39 HydrophobicContact CD2-CD1 3.54Å; L22-L39 HydrophobicContact CD2-CG 4.28Å; L22-L39 HydrophobicContact CG-CD1 3.78Å; L22-L39 HydrophobicContact CG-CG 4.4Å
23	S	80.7	Confident	71	Confident	81 Å²	81	92.1 Å²	92.1	57%	0.566	52%	0.524	S	S	*	.	H	α-helix	trans	-66.8	-33.8	178.1	-58.8	0	0	0	0	111.9	F19 M20 V21 T25 G26	F19-S23 VanDerWaalsContact O-CB 3.26Å; F19-S23 WeakPolarHBondContact O-CB 3.5Å; F19-S23 PolarHBondContact O-N 3.48Å; F19-S23 PolarHBondContact O-OG 3.41Å; M20-S23 PolarHBondContact O-N 2.88Å; V21-S23 VanDerWaalsContact C-N 3.33Å; V21-S23 PolarHBondContact O-N 3.4Å; S23-T25 VanDerWaalsContact C-N 3.35Å; S23-G26 PolarHBondContact O-N 2.98Å
24	S	73.2	Confident	68.3	Low	76 Å²	76	98.1 Å²	98.1	53%	0.531	55%	0.548	S	S	.	.	H	α-helix	trans	-71.4	-28.2	176.9	73.2	0	0	0	0	113.3	M20 V21 L22 G26	M20-S24 PolarHBondContact O-N 3.31Å; M20-S24 VanDerWaalsContact O-N 3.07Å; V21-S24 PolarHBondContact O-N 3.1Å; V21-S24 PolarHBondContact O-OG 3.5Å; L22-S24 VanDerWaalsContact C-N 3.3Å; L22-S24 PolarHBondContact O-N 3.19Å; S24-G26 VanDerWaalsContact C-N 3.31Å; S24-G26 PolarHBondContact O-N 3.4Å
25	T	63.8	Low	65.7	Low	73 Å²	73	100 Å²	100	45%	0.448	57%	0.565	S	S	.	*	H	α-helix	trans	-75.4	-16.1	178.3	47.9	0	0	0	0	114.1	V21 L22 S23 L27	V21-T25 PolarHBondContact O-N 3.39Å; V21-T25 PolarHBondContact O-OG1 3.33Å; L22-T25 WeakPolarHBondContact CA-OG1 3.15Å; L22-T25 PolarHBondContact O-N 2.99Å; L22-T25 PolarHBondContact O-OG1 2.9Å; S23-T25 VanDerWaalsContact C-N 3.35Å; T25-L27 PolarHBondContact O-N 3.02Å
26	G	55.5	Low	63.4	Low	68 Å²	68	106 Å²	106	70%	0.701	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.6	0.9	-177.8	0	0	0	0	0	116.2	S23 S24	S23-G26 PolarHBondContact O-N 2.98Å; S24-G26 VanDerWaalsContact C-N 3.31Å; S24-G26 PolarHBondContact O-N 3.4Å
27	L	53.2	Low	61.3	Low	150 Å²	150	109.3 Å²	109.3	79%	0.785	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.9	2.8	-175.9	-81.7	162.9	0	0	0	114.6	T25	T25-L27 PolarHBondContact O-N 3.02Å
28	H	47.2	Very low	59.7	Low	148 Å²	148	107.4 Å²	107.4	69%	0.685	60%	0.6	S	S	*	*			trans	-120.9	70.7	175.8	-85.7	-72.8	0	0	0	111.7	S30	H28-S30 PolarHBondContact O-N 3.18Å
29	D	41.9	Very low	58.7	Low	176 Å²	176	109.7 Å²	109.7	94%	0.941	61%	0.612	S	S	*	*			trans	-69.6	82.1	150.8	-93.4	-24	0	0	0	108.1
30	S	42.4	Very low	58.3	Low	64 Å²	64	107.9 Å²	107.9	45%	0.448	61%	0.607	S	S	.	*	S	Bend	trans	-166.5	102.4	166.1	53.6	0	0	0	0	110.1	H28 I32	H28-S30 PolarHBondContact O-N 3.18Å; S30-I32 WeakPolarHBondContact O-CG1 3.43Å; S30-I32 PolarHBondContact O-N 3.01Å
31	D	46	Very low	58.2	Low	177 Å²	177	108.3 Å²	108.3	95%	0.947	61%	0.613	S	S	*	*			trans	25	58.5	147.5	-71.4	-24	0	0	0	118.6
32	I	45.4	Very low	58.4	Low	107 Å²	107	114.5 Å²	114.5	55%	0.549	64%	0.637	S	S	.	*			trans	-126.8	85.3	168.7	-58.7	170.3	0	0	0	109.1	S30 E34	S30-I32 WeakPolarHBondContact O-CG1 3.43Å; S30-I32 PolarHBondContact O-N 3.01Å; I32-E34 PolarHBondContact O-N 2.99Å
33	S	42.2	Very low	58.7	Low	117 Å²	117	112.7 Å²	112.7	82%	0.818	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-47.1	120.2	140	-54.9	0	0	0	0	107.3
34	E	40.1	Very low	59.1	Low	185 Å²	185	112 Å²	112	86%	0.864	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	107.4	1.2	174.4	-57.4	-170.8	147.9	0	0	120.2	I32 Q36	I32-E34 PolarHBondContact O-N 2.99Å; E34-Q36 VanDerWaalsContact C-N 3.33Å; E34-Q36 PolarHBondContact O-N 3.39Å; E34-Q36 VanDerWaalsContact O-N 3.14Å
35	S	38.6	Very low	60	Low	78 Å²	78	111 Å²	111	55%	0.545	61%	0.611	S	S	.	*			trans	-88.3	67.3	165.3	68.5	0	0	0	0	111.9	H37	S35-H37 PolarHBondContact O-N 3.3Å
36	Q	45.5	Very low	61.5	Low	188 Å²	188	109.5 Å²	109.5	88%	0.879	60%	0.604	S	S	*	*			trans	-67.6	28.1	171.6	-78.5	-172.1	-12.5	0	0	113.9	E34 G38	E34-Q36 VanDerWaalsContact C-N 3.33Å; E34-Q36 PolarHBondContact O-N 3.39Å; E34-Q36 VanDerWaalsContact O-N 3.14Å; Q36-G38 VanDerWaalsContact C-N 3.27Å; Q36-G38 PolarHBondContact O-N 3.2Å
37	H	49.3	Very low	63.3	Low	168 Å²	168	107.9 Å²	107.9	78%	0.778	58%	0.579	S	S	*	*			trans	-95	29.4	176.7	-62.4	92.2	0	0	0	112	S35	S35-H37 PolarHBondContact O-N 3.3Å
38	G	57.4	Low	65.4	Low	28 Å²	28	105.2 Å²	105.2	29%	0.289	57%	0.565	S	S	.	*	S	Bend	trans	-71	-175.5	161.8	0	0	0	0	0	111	Q36 N40	Q36-G38 VanDerWaalsContact C-N 3.27Å; Q36-G38 PolarHBondContact O-N 3.2Å; G38-N40 PolarHBondContact O-N 3.03Å
39	L	68.7	Low	67.7	Low	62 Å²	62	101.9 Å²	101.9	33%	0.325	55%	0.553	S	S	.	*	S	Bend	trans	-43.8	106.9	174.6	-83.1	166	0	0	0	111.7	I18 V21 L22 H43 M44	I18-L39 HydrophobicContact CB-CD2 4.09Å; I18-L39 HydrophobicContact CG1-CD2 3.83Å; I18-L39 HydrophobicContact CG2-CD1 4.01Å; I18-L39 HydrophobicContact CG2-CD2 3.82Å; V21-L39 HydrophobicContact CB-CD2 4.4Å; V21-L39 HydrophobicContact CG1-CD2 4.32Å; V21-L39 HydrophobicContact CG1-CG 4.13Å; L22-L39 HydrophobicContact CD1-CD1 4.14Å; L22-L39 HydrophobicContact CD2-CD1 3.54Å; L22-L39 HydrophobicContact CD2-CG 4.28Å; L22-L39 HydrophobicContact CG-CD1 3.78Å; L22-L39 HydrophobicContact CG-CG 4.4Å; L39-H43 HydrophobicContact CD2-CB 3.85Å; L39-M44 HydrophobicContact CD1-CE 4.4Å; L39-M44 HydrophobicContact CD2-CE 3.66Å; L39-M44 HydrophobicContact CG-CE 4.5Å
40	N	79.4	Confident	70.3	Confident	75 Å²	75	93.7 Å²	93.7	40%	0.401	51%	0.51	S	S	.	.			trans	-85.9	165	177.5	67.4	22	0	0	0	112	G38 K42 H43 M44	G38-N40 PolarHBondContact O-N 3.03Å; N40-K42 PolarHBondContact O-N 3.23Å; N40-K42 WeakPolarHBondContact OD1-CB 3.43Å; N40-K42 PolarHBondContact OD1-N 3.39Å; N40-H43 PolarHBondContact O-N 2.93Å; N40-H43 PolarHBondContact OD1-N 3.44Å; N40-H43 VanDerWaalsContact OD1-N 3.07Å; N40-H43 PolarHBondContact OD1-ND1 3.47Å; N40-M44 PolarHBondContact O-N 3.4Å
41	D	85.6	Confident	72.9	Confident	145 Å²	145	92.8 Å²	92.8	78%	0.775	50%	0.502	S	S	*	.	H	α-helix	trans	-54.8	-27.9	179.3	-68.5	-22.9	0	0	0	113.1	M44 A45	D41-M44 PolarHBondContact O-N 2.9Å; D41-A45 VanDerWaalsContact O-CB 3.23Å; D41-A45 WeakPolarHBondContact O-CB 3.34Å; D41-A45 PolarHBondContact O-N 2.87Å
42	K	87.8	Confident	75.3	Confident	154 Å²	154	91.7 Å²	91.7	67%	0.67	49%	0.485	S	S	*	.	H	α-helix	trans	-66.6	-45.6	177.5	-176.8	-175.7	175.4	-174.7	0	111.8	N40 M44 A45 S46	N40-K42 PolarHBondContact O-N 3.23Å; N40-K42 WeakPolarHBondContact OD1-CB 3.43Å; N40-K42 PolarHBondContact OD1-N 3.39Å; K42-M44 VanDerWaalsContact C-N 3.3Å; K42-M44 PolarHBondContact O-N 3.31Å; K42-A45 PolarHBondContact O-N 3.48Å; K42-S46 WeakPolarHBondContact O-CB 3.49Å; K42-S46 PolarHBondContact O-N 3.37Å; K42-S46 PolarHBondContact O-OG 2.93Å
43	H	88.2	Confident	77.7	Confident	47 Å²	47	90.4 Å²	90.4	22%	0.218	48%	0.477	C	S	.	.	H	α-helix	trans	-61.8	-41.6	176.7	-63.6	114.5	0	0	0	111.2	I18 L39 N40 S46 L47	I18-H43 HydrophobicContact CG1-CB 4.36Å; L39-H43 HydrophobicContact CD2-CB 3.85Å; N40-H43 PolarHBondContact O-N 2.93Å; N40-H43 PolarHBondContact OD1-N 3.44Å; N40-H43 VanDerWaalsContact OD1-N 3.07Å; N40-H43 PolarHBondContact OD1-ND1 3.47Å; H43-S46 PolarHBondContact O-N 2.95Å; H43-L47 PolarHBondContact O-N 3.02Å
44	M	89.3	Confident	80.3	Confident	65 Å²	65	87 Å²	87	32%	0.32	45%	0.448	S	S	.	.	H	α-helix	trans	-67	-42.7	177.4	-65.2	-55.5	84.6	0	0	112	I18 L39 N40 D41 K42 S46 L47 L48	I18-M44 HydrophobicContact CD1-CE 3.37Å; I18-M44 HydrophobicContact CG1-CE 3.73Å; L39-M44 HydrophobicContact CD1-CE 4.4Å; L39-M44 HydrophobicContact CD2-CE 3.66Å; L39-M44 HydrophobicContact CG-CE 4.5Å; N40-M44 PolarHBondContact O-N 3.4Å; D41-M44 PolarHBondContact O-N 2.9Å; K42-M44 VanDerWaalsContact C-N 3.3Å; K42-M44 PolarHBondContact O-N 3.31Å; M44-S46 VanDerWaalsContact C-N 3.34Å; M44-S46 PolarHBondContact O-N 3.07Å; M44-L47 PolarHBondContact O-N 3.14Å; M44-L48 WeakPolarHBondContact O-CB 3.45Å; M44-L48 VanDerWaalsContact O-CG 3.24Å; M44-L48 WeakPolarHBondContact O-CG 3.36Å; M44-L48 PolarHBondContact O-N 3.48Å
45	A	92.9	Very high	83	Confident	55 Å²	55	82.7 Å²	82.7	46%	0.455	43%	0.431	S	S	.	.	H	α-helix	trans	-60.7	-43.3	175.2	0	0	0	0	0	111.8	D41 K42 L48 D49	D41-A45 VanDerWaalsContact O-CB 3.23Å; D41-A45 WeakPolarHBondContact O-CB 3.34Å; D41-A45 PolarHBondContact O-N 2.87Å; K42-A45 PolarHBondContact O-N 3.48Å; A45-L48 PolarHBondContact O-N 3.04Å; A45-D49 WeakPolarHBondContact O-CB 3.47Å; A45-D49 PolarHBondContact O-N 3.01Å
46	S	94.1	Very high	85.7	Confident	43 Å²	43	81.8 Å²	81.8	30%	0.301	43%	0.425	S	S	.	.	H	α-helix	trans	-66	-42.2	178	-68	0	0	0	0	112.7	K42 H43 M44 D49 A50	K42-S46 WeakPolarHBondContact O-CB 3.49Å; K42-S46 PolarHBondContact O-N 3.37Å; K42-S46 PolarHBondContact O-OG 2.93Å; H43-S46 PolarHBondContact O-N 2.95Å; M44-S46 VanDerWaalsContact C-N 3.34Å; M44-S46 PolarHBondContact O-N 3.07Å; S46-D49 PolarHBondContact O-N 3.01Å; S46-A50 PolarHBondContact O-N 3.43Å
47	L	94.4	Very high	88.1	Confident	34 Å²	34	76.1 Å²	76.1	18%	0.178	40%	0.396	C	S	.	.	H	α-helix	trans	-63.6	-46.9	174.2	175.7	66.9	0	0	0	111.5	L11 Q14 L15 I18 H43 M44 D49 A50 C51	L11-L47 HydrophobicContact CD1-CD1 3.95Å; Q14-L47 HydrophobicContact CB-CB 4.42Å; Q14-L47 HydrophobicContact CB-CD1 4.21Å; L15-L47 HydrophobicContact CD2-CD1 3.87Å; L15-L47 HydrophobicContact CG-CD1 4.24Å; I18-L47 HydrophobicContact CD1-CB 3.68Å; I18-L47 HydrophobicContact CD1-CD1 4.23Å; I18-L47 HydrophobicContact CD1-CD2 3.4Å; I18-L47 VanDerWaalsContact CD1-CD2 3.4Å; I18-L47 HydrophobicContact CD1-CG 3.94Å; H43-L47 PolarHBondContact O-N 3.02Å; M44-L47 PolarHBondContact O-N 3.14Å; L47-D49 PolarHBondContact O-N 3.35Å; L47-A50 PolarHBondContact O-N 3.26Å; L47-C51 PolarHBondContact O-N 3.02Å; L47-C51 PolarHBondContact O-SG 3.32Å; L47-C51 VanDerWaalsContact O-SG 3.33Å
48	L	96.2	Very high	90.3	Very high	93 Å²	93	73.7 Å²	73.7	49%	0.487	38%	0.383	S	S	.	.	H	α-helix	trans	-60.3	-37.2	178.1	-73.6	173	0	0	0	111.7	M44 A45 R52	M44-L48 WeakPolarHBondContact O-CB 3.45Å; M44-L48 VanDerWaalsContact O-CG 3.24Å; M44-L48 WeakPolarHBondContact O-CG 3.36Å; M44-L48 PolarHBondContact O-N 3.48Å; A45-L48 PolarHBondContact O-N 3.04Å; L48-R52 VanDerWaalsContact O-CG 3.29Å; L48-R52 WeakPolarHBondContact O-CG 3.4Å; L48-R52 PolarHBondContact O-N 3.18Å
49	D	96.6	Very high	92	Very high	79 Å²	79	76.9 Å²	76.9	42%	0.422	39%	0.393	S	S	.	.	H	α-helix	trans	-65.9	-46.6	174.3	-168.2	67.1	0	0	0	111.8	A45 S46 L47 C51 R52 Q53	A45-D49 WeakPolarHBondContact O-CB 3.47Å; A45-D49 PolarHBondContact O-N 3.01Å; S46-D49 PolarHBondContact O-N 3.01Å; L47-D49 PolarHBondContact O-N 3.35Å; D49-C51 VanDerWaalsContact C-N 3.33Å; D49-C51 PolarHBondContact O-N 3.4Å; D49-R52 WeakPolarHBondContact O-CB 3.34Å; D49-R52 PolarHBondContact O-N 3.3Å; D49-R52 VanDerWaalsContact O-N 3.13Å; D49-Q53 WeakPolarHBondContact O-CG 3.46Å; D49-Q53 PolarHBondContact O-N 2.89Å; D49-Q53 PolarHBondContact OD2-NE2 2.95Å
50	A	96.3	Very high	93.2	Very high	4 Å²	4	81.1 Å²	81.1	3%	0.033	41%	0.408	C	S	.	.	H	α-helix	trans	-59.5	-42	175.7	0	0	0	0	0	112.2	L11 Q14 S46 L47 R52 Q53 M54	L11-A50 HydrophobicContact CB-CB 4.36Å; L11-A50 HydrophobicContact CD1-CB 3.98Å; Q14-A50 HydrophobicContact CB-CB 4.47Å; Q14-A50 HydrophobicContact CG-CB 3.93Å; S46-A50 PolarHBondContact O-N 3.43Å; L47-A50 PolarHBondContact O-N 3.26Å; A50-R52 PolarHBondContact O-N 3.35Å; A50-Q53 PolarHBondContact O-N 2.67Å; A50-M54 PolarHBondContact O-N 3.43Å
51	C	97	Very high	93.8	Very high	44 Å²	44	81.2 Å²	81.2	30%	0.297	41%	0.405	S	S	.	.	H	α-helix	trans	-59.6	-45.5	173.2	-69.8	0	0	0	0	112	L47 D49 Q53 M54 D55	L47-C51 PolarHBondContact O-N 3.02Å; L47-C51 PolarHBondContact O-SG 3.32Å; L47-C51 VanDerWaalsContact O-SG 3.33Å; D49-C51 VanDerWaalsContact C-N 3.33Å; D49-C51 PolarHBondContact O-N 3.4Å; C51-Q53 VanDerWaalsContact C-N 3.34Å; C51-Q53 PolarHBondContact O-N 2.77Å; C51-M54 PolarHBondContact O-N 2.88Å; C51-D55 PolarHBondContact O-N 2.88Å
52	R	97	Very high	94.1	Very high	154 Å²	154	82.7 Å²	82.7	58%	0.581	40%	0.4	S	S	*	.	H	α-helix	trans	-64.2	-37.4	177.4	-74.4	172.6	-175.7	138.1	1.4	112.8	L48 D49 A50 S56	L48-R52 VanDerWaalsContact O-CG 3.29Å; L48-R52 WeakPolarHBondContact O-CG 3.4Å; L48-R52 PolarHBondContact O-N 3.18Å; D49-R52 WeakPolarHBondContact O-CB 3.34Å; D49-R52 PolarHBondContact O-N 3.3Å; D49-R52 VanDerWaalsContact O-N 3.13Å; A50-R52 PolarHBondContact O-N 3.35Å; R52-S56 WeakPolarHBondContact O-CB 3.42Å; R52-S56 PolarHBondContact O-N 2.9Å; R52-S56 PolarHBondContact O-OG 3.46Å
53	Q	95.7	Very high	94.2	Very high	80 Å²	80	80.9 Å²	80.9	37%	0.374	40%	0.397	S	S	.	.	H	α-helix	trans	-65.1	-43	175.2	-70.5	-173.1	47.5	0	0	110.7	D49 A50 C51 S56 W57	D49-Q53 WeakPolarHBondContact O-CG 3.46Å; D49-Q53 PolarHBondContact O-N 2.89Å; D49-Q53 PolarHBondContact OD2-NE2 2.95Å; A50-Q53 PolarHBondContact O-N 2.67Å; C51-Q53 VanDerWaalsContact C-N 3.34Å; C51-Q53 PolarHBondContact O-N 2.77Å; Q53-S56 PolarHBondContact O-N 3.33Å; Q53-W57 WeakPolarHBondContact O-CB 3.46Å; Q53-W57 PolarHBondContact O-N 3.49Å
54	M	95.9	Very high	94.2	Very high	46 Å²	46	80.2 Å²	80.2	23%	0.227	40%	0.4	C	S	.	.	H	α-helix	trans	-62	-46.1	174.5	-174.8	168.8	62	0	0	112.4	V7 L11 A50 C51 S56 W57 F58	V7-M54 HydrophobicContact CG1-CB 3.98Å; V7-M54 HydrophobicContact CG1-CG 4.47Å; L11-M54 HydrophobicContact CD2-CE 3.31Å; L11-M54 HydrophobicContact CD2-SD 3.48Å; L11-M54 WeakPolarHBondContact CD2-SD 3.42Å; A50-M54 PolarHBondContact O-N 3.43Å; C51-M54 PolarHBondContact O-N 2.88Å; M54-S56 VanDerWaalsContact C-N 3.33Å; M54-S56 PolarHBondContact O-N 3.42Å; M54-W57 WeakPolarHBondContact O-CB 3.07Å; M54-W57 PolarHBondContact O-N 2.91Å; M54-W57 VanDerWaalsContact O-N 3.15Å; M54-F58 HydrophobicContact CG-CD2 3.82Å; M54-F58 HydrophobicContact CG-CE2 3.63Å; M54-F58 WeakPolarHBondContact O-CD2 3.33Å; M54-F58 PolarHBondContact O-N 2.89Å; M54-F58 HydrophobicContact SD-CE2 4.02Å
55	D	96.5	Very high	94.2	Very high	94 Å²	94	83 Å²	83	50%	0.503	42%	0.415	S	S	.	.	H	α-helix	trans	-59.7	-44.4	175.6	-76	-22.3	0	0	0	111.7	C51 W57 F58 I59	C51-D55 PolarHBondContact O-N 2.88Å; D55-W57 VanDerWaalsContact C-N 3.28Å; D55-W57 PolarHBondContact O-N 3.15Å; D55-F58 PolarHBondContact O-N 3.44Å; D55-I59 WeakPolarHBondContact O-CG1 3.5Å; D55-I59 PolarHBondContact O-N 3.31Å
56	S	95.6	Very high	93.9	Very high	59 Å²	59	83.6 Å²	83.6	41%	0.413	42%	0.416	S	S	.	.	H	α-helix	trans	-61.2	-38.8	176.6	-63.1	0	0	0	0	111.9	R52 Q53 M54 K60	R52-S56 WeakPolarHBondContact O-CB 3.42Å; R52-S56 PolarHBondContact O-N 2.9Å; R52-S56 PolarHBondContact O-OG 3.46Å; Q53-S56 PolarHBondContact O-N 3.33Å; M54-S56 VanDerWaalsContact C-N 3.33Å; M54-S56 PolarHBondContact O-N 3.42Å; S56-K60 WeakPolarHBondContact O-CG 3.49Å; S56-K60 PolarHBondContact O-N 2.98Å; S56-K60 VanDerWaalsContact O-N 3.11Å
57	W	95.8	Very high	93.5	Very high	70 Å²	70	84.3 Å²	84.3	27%	0.265	42%	0.419	S	S	.	.	H	α-helix	trans	-63.9	-47.7	175	-179	92.3	0	0	0	111.5	D4 V7 Q53 M54 D55 I59 K60 K61	D4-W57 HydrophobicContact CB-CZ2 4.02Å; D4-W57 VanDerWaalsContact CG-NE1 3.32Å; D4-W57 PolarHBondContact OD1-NE1 2.85Å; V7-W57 HydrophobicContact CG1-CB 4.1Å; V7-W57 HydrophobicContact CG1-CG 4.45Å; V7-W57 HydrophobicContact CG2-CB 4.39Å; V7-W57 HydrophobicContact CG2-CG 4.39Å; Q53-W57 WeakPolarHBondContact O-CB 3.46Å; Q53-W57 PolarHBondContact O-N 3.49Å; M54-W57 WeakPolarHBondContact O-CB 3.07Å; M54-W57 PolarHBondContact O-N 2.91Å; M54-W57 VanDerWaalsContact O-N 3.15Å; D55-W57 VanDerWaalsContact C-N 3.28Å; D55-W57 PolarHBondContact O-N 3.15Å; W57-I59 VanDerWaalsContact C-N 3.34Å; W57-I59 PolarHBondContact O-N 3.45Å; W57-K60 PolarHBondContact O-N 2.9Å; W57-K61 HydrophobicContact CD2-CG 3.9Å; W57-K61 VanDerWaalsContact CE2-CE 3.47Å; W57-K61 HydrophobicContact CE3-CG 4.15Å; W57-K61 HydrophobicContact CH2-CG 3.92Å; W57-K61 HydrophobicContact CZ2-CD 4.1Å; W57-K61 VanDerWaalsContact CZ2-CE 3.49Å; W57-K61 HydrophobicContact CZ2-CG 3.65Å; W57-K61 HydrophobicContact CZ3-CG 4.16Å; W57-K61 VanDerWaalsContact NE1-CE 3.34Å; W57-K61 WeakPolarHBondContact O-CG 3.41Å; W57-K61 PolarHBondContact O-N 3.27Å
58	F	95.3	Very high	92.9	Very high	117 Å²	117	88.7 Å²	88.7	51%	0.513	43%	0.434	S	S	.	.	H	α-helix	trans	-58.4	-43.7	176.4	-87.1	-67.4	0	0	0	112.4	M54 D55 K60 K61 R62	M54-F58 HydrophobicContact CG-CD2 3.82Å; M54-F58 HydrophobicContact CG-CE2 3.63Å; M54-F58 WeakPolarHBondContact O-CD2 3.33Å; M54-F58 PolarHBondContact O-N 2.89Å; M54-F58 HydrophobicContact SD-CE2 4.02Å; D55-F58 PolarHBondContact O-N 3.44Å; F58-K60 PolarHBondContact O-N 3.34Å; F58-K61 PolarHBondContact O-N 3.46Å; F58-R62 VanDerWaalsContact O-CB 3.29Å; F58-R62 WeakPolarHBondContact O-CB 3.48Å; F58-R62 PolarHBondContact O-N 2.91Å
59	I	94.7	Very high	92.1	Very high	95 Å²	95	92.6 Å²	92.6	49%	0.487	44%	0.443	S	S	.	.	H	α-helix	trans	-60.9	-45.4	177.5	-68.7	166.8	0	0	0	110.8	D55 W57 R62 L63	D55-I59 WeakPolarHBondContact O-CG1 3.5Å; D55-I59 PolarHBondContact O-N 3.31Å; W57-I59 VanDerWaalsContact C-N 3.34Å; W57-I59 PolarHBondContact O-N 3.45Å; I59-R62 PolarHBondContact O-N 3.34Å; I59-L63 WeakPolarHBondContact O-CB 3.47Å; I59-L63 PolarHBondContact O-N 3.34Å
60	K	92.2	Very high	91.6	Very high	151 Å²	151	94.6 Å²	94.6	66%	0.657	45%	0.45	S	S	*	.	H	α-helix	trans	-62.5	-45.9	178	-73.7	173.1	-176.7	176.8	0	111.9	S56 W57 F58 L63 A64	S56-K60 WeakPolarHBondContact O-CG 3.49Å; S56-K60 PolarHBondContact O-N 2.98Å; S56-K60 VanDerWaalsContact O-N 3.11Å; W57-K60 PolarHBondContact O-N 2.9Å; F58-K60 PolarHBondContact O-N 3.34Å; K60-L63 PolarHBondContact O-N 3.47Å; K60-A64 WeakPolarHBondContact O-CB 3.4Å; K60-A64 PolarHBondContact O-N 2.88Å
61	K	92.2	Very high	91.1	Very high	76 Å²	76	99.5 Å²	99.5	33%	0.33	47%	0.472	S	S	.	.	H	α-helix	trans	-64.5	-41.1	178	-67.4	-61.8	-177.7	179.8	0	111.9	D4 W57 F58 L63 A64 L65	D4-K61 WeakPolarHBondContact OD1-CE 3.34Å; D4-K61 IonicContact OD1-NZ 3.08Å; D4-K61 PolarHBondContact OD1-NZ 3.25Å; D4-K61 VanDerWaalsContact OD1-NZ 3.08Å; D4-K61 VanDerWaalsContact OD2-CE 3.24Å; D4-K61 WeakPolarHBondContact OD2-CE 3.5Å; D4-K61 IonicContact OD2-NZ 2.61Å; D4-K61 PolarHBondContact OD2-NZ 3.09Å; W57-K61 HydrophobicContact CD2-CG 3.9Å; W57-K61 VanDerWaalsContact CE2-CE 3.47Å; W57-K61 HydrophobicContact CE3-CG 4.15Å; W57-K61 HydrophobicContact CH2-CG 3.92Å; W57-K61 HydrophobicContact CZ2-CD 4.1Å; W57-K61 VanDerWaalsContact CZ2-CE 3.49Å; W57-K61 HydrophobicContact CZ2-CG 3.65Å; W57-K61 HydrophobicContact CZ3-CG 4.16Å; W57-K61 VanDerWaalsContact NE1-CE 3.34Å; W57-K61 WeakPolarHBondContact O-CG 3.41Å; W57-K61 PolarHBondContact O-N 3.27Å; F58-K61 PolarHBondContact O-N 3.46Å; K61-L63 PolarHBondContact O-N 2.81Å; K61-A64 PolarHBondContact O-N 3.36Å; K61-L65 WeakPolarHBondContact O-CB 3.26Å; K61-L65 WeakPolarHBondContact O-CG 3.13Å; K61-L65 PolarHBondContact O-N 3.07Å
62	R	92.5	Very high	90.5	Very high	177 Å²	177	104.5 Å²	104.5	67%	0.668	49%	0.486	S	S	*	.	H	α-helix	trans	-61.3	-43.8	174.6	-174.9	176.5	65.1	-178.8	-0.8	112	F58 I59 L65 S66	F58-R62 VanDerWaalsContact O-CB 3.29Å; F58-R62 WeakPolarHBondContact O-CB 3.48Å; F58-R62 PolarHBondContact O-N 2.91Å; I59-R62 PolarHBondContact O-N 3.34Å; R62-L65 PolarHBondContact O-N 3.02Å; R62-S66 PolarHBondContact O-N 2.9Å
63	L	90.1	Very high	90	Very high	115 Å²	115	99.1 Å²	99.1	60%	0.602	47%	0.474	S	S	*	.	H	α-helix	trans	-62.3	-46.8	175.7	-178.5	65.4	0	0	0	111.1	I59 K60 K61 L65 S66 T67	I59-L63 WeakPolarHBondContact O-CB 3.47Å; I59-L63 PolarHBondContact O-N 3.34Å; K60-L63 PolarHBondContact O-N 3.47Å; K61-L63 PolarHBondContact O-N 2.81Å; L63-L65 PolarHBondContact O-N 3.11Å; L63-S66 WeakPolarHBondContact O-CB 3.42Å; L63-S66 PolarHBondContact O-N 3.31Å; L63-S66 VanDerWaalsContact O-N 3.14Å; L63-T67 PolarHBondContact O-N 3.14Å; L63-T67 PolarHBondContact O-OG1 3.11Å
64	A	87.9	Confident	89.7	Confident	34 Å²	34	100 Å²	100	28%	0.281	48%	0.481	S	S	.	.	H	α-helix	trans	-58.7	-47.1	177.6	0	0	0	0	0	111.5	K60 K61 S66 T67 Y68	K60-A64 WeakPolarHBondContact O-CB 3.4Å; K60-A64 PolarHBondContact O-N 2.88Å; K61-A64 PolarHBondContact O-N 3.36Å; A64-S66 VanDerWaalsContact C-N 3.3Å; A64-S66 PolarHBondContact O-N 2.97Å; A64-T67 PolarHBondContact O-N 2.74Å; A64-T67 VanDerWaalsContact O-N 3.15Å; A64-Y68 HydrophobicContact CB-CD2 4.2Å; A64-Y68 HydrophobicContact CB-CE2 3.92Å; A64-Y68 WeakPolarHBondContact O-CB 3.35Å; A64-Y68 WeakPolarHBondContact O-CD2 3.46Å; A64-Y68 PolarHBondContact O-N 2.98Å
65	L	88.5	Confident	89.6	Confident	124 Å²	124	103.8 Å²	103.8	65%	0.649	50%	0.496	S	S	*	.	H	α-helix	trans	-60.3	-39	175.3	-72.8	171	0	0	0	112.4	K61 R62 L63 T67 Y69	K61-L65 WeakPolarHBondContact O-CB 3.26Å; K61-L65 WeakPolarHBondContact O-CG 3.13Å; K61-L65 PolarHBondContact O-N 3.07Å; R62-L65 PolarHBondContact O-N 3.02Å; L63-L65 PolarHBondContact O-N 3.11Å; L65-T67 VanDerWaalsContact C-N 3.34Å; L65-T67 PolarHBondContact O-N 2.61Å; L65-Y69 VanDerWaalsContact O-CB 3.3Å; L65-Y69 WeakPolarHBondContact O-CB 3.42Å; L65-Y69 PolarHBondContact O-N 3.5Å
66	S	86.8	Confident	89.4	Confident	66 Å²	66	106 Å²	106	46%	0.462	50%	0.503	S	S	.	.	H	α-helix	trans	-62.9	-39.8	175	-177.2	0	0	0	0	112.2	R62 L63 A64	R62-S66 PolarHBondContact O-N 2.9Å; L63-S66 WeakPolarHBondContact O-CB 3.42Å; L63-S66 PolarHBondContact O-N 3.31Å; L63-S66 VanDerWaalsContact O-N 3.14Å; A64-S66 VanDerWaalsContact C-N 3.3Å; A64-S66 PolarHBondContact O-N 2.97Å
67	T	86.2	Confident	89.4	Confident	59 Å²	59	109 Å²	109	36%	0.362	51%	0.511	S	S	.	.	H	α-helix	trans	-71.5	-47.9	176.8	-58.6	0	0	0	0	111.1	L63 A64 L65 Y69 Q70 E71	L63-T67 PolarHBondContact O-N 3.14Å; L63-T67 PolarHBondContact O-OG1 3.11Å; A64-T67 PolarHBondContact O-N 2.74Å; A64-T67 VanDerWaalsContact O-N 3.15Å; L65-T67 VanDerWaalsContact C-N 3.34Å; L65-T67 PolarHBondContact O-N 2.61Å; T67-Y69 VanDerWaalsContact C-N 3.27Å; T67-Y69 PolarHBondContact O-N 2.96Å; T67-Q70 WeakPolarHBondContact O-CB 3.49Å; T67-Q70 PolarHBondContact O-N 3.08Å; T67-E71 PolarHBondContact O-N 3.14Å
68	Y	82.9	Confident	89.4	Confident	126 Å²	126	110.1 Å²	110.1	49%	0.494	52%	0.521	S	S	.	.	H	α-helix	trans	-60.1	-38	177.9	-71.2	-55.9	0	0	0	111.9	A64 Q70 E71 Y72	A64-Y68 HydrophobicContact CB-CD2 4.2Å; A64-Y68 HydrophobicContact CB-CE2 3.92Å; A64-Y68 WeakPolarHBondContact O-CB 3.35Å; A64-Y68 WeakPolarHBondContact O-CD2 3.46Å; A64-Y68 PolarHBondContact O-N 2.98Å; Y68-Q70 VanDerWaalsContact C-N 3.26Å; Y68-Q70 PolarHBondContact O-N 2.81Å; Y68-E71 WeakPolarHBondContact CD1-OE2 3.38Å; Y68-E71 PolarHBondContact O-N 3.15Å; Y68-E71 VanDerWaalsContact O-N 3.11Å; Y68-Y72 WeakPolarHBondContact O-CD2 3.28Å; Y68-Y72 PolarHBondContact O-N 3.46Å
69	Y	79.2	Confident	89.5	Confident	175 Å²	175	108.7 Å²	108.7	69%	0.686	52%	0.519	S	S	*	.	H	α-helix	trans	-57.1	-40.7	174.2	179.8	-96.5	0	0	0	112.1	L65 T67 Y72 A73	L65-Y69 VanDerWaalsContact O-CB 3.3Å; L65-Y69 WeakPolarHBondContact O-CB 3.42Å; L65-Y69 PolarHBondContact O-N 3.5Å; T67-Y69 VanDerWaalsContact C-N 3.27Å; T67-Y69 PolarHBondContact O-N 2.96Å; Y69-Y72 PolarHBondContact O-N 2.89Å; Y69-A73 WeakPolarHBondContact O-CB 2.97Å; Y69-A73 PolarHBondContact O-N 3.39Å
70	Q	84.3	Confident	89.6	Confident	120 Å²	120	107.2 Å²	107.2	56%	0.561	52%	0.521	S	S	*	.	H	α-helix	trans	-66.5	-41.8	175	-66.3	177.6	-23.3	0	0	111.6	T67 Y68 A73 L74	T67-Q70 WeakPolarHBondContact O-CB 3.49Å; T67-Q70 PolarHBondContact O-N 3.08Å; Y68-Q70 VanDerWaalsContact C-N 3.26Å; Y68-Q70 PolarHBondContact O-N 2.81Å; Q70-A73 PolarHBondContact O-N 3.02Å; Q70-L74 WeakPolarHBondContact O-CB 3.24Å; Q70-L74 VanDerWaalsContact O-CG 3.28Å; Q70-L74 WeakPolarHBondContact O-CG 3.3Å; Q70-L74 PolarHBondContact O-N 3.24Å
71	E	86.6	Confident	89.8	Confident	107 Å²	107	104.8 Å²	104.8	50%	0.5	52%	0.515	S	S	.	.	H	α-helix	trans	-63.5	-40.7	176	-66.9	-179.7	176.3	0	0	112.3	T67 Y68 L74 K75	T67-E71 PolarHBondContact O-N 3.14Å; Y68-E71 WeakPolarHBondContact CD1-OE2 3.38Å; Y68-E71 PolarHBondContact O-N 3.15Å; Y68-E71 VanDerWaalsContact O-N 3.11Å; E71-L74 PolarHBondContact O-N 2.96Å; E71-K75 WeakPolarHBondContact O-CB 3.49Å; E71-K75 PolarHBondContact O-N 3.45Å
72	Y	83.9	Confident	90.1	Very high	150 Å²	150	105.2 Å²	105.2	59%	0.588	52%	0.52	S	S	*	.	H	α-helix	trans	-64.8	-44.4	174.2	-82.4	-71.5	0	0	0	111.7	Y68 Y69 L74 K75 E76	Y68-Y72 WeakPolarHBondContact O-CD2 3.28Å; Y68-Y72 PolarHBondContact O-N 3.46Å; Y69-Y72 PolarHBondContact O-N 2.89Å; Y72-L74 VanDerWaalsContact C-N 3.34Å; Y72-L74 PolarHBondContact O-N 3.32Å; Y72-K75 WeakPolarHBondContact O-CB 3.19Å; Y72-K75 PolarHBondContact O-N 2.92Å; Y72-K75 VanDerWaalsContact O-N 3.15Å; Y72-E76 WeakPolarHBondContact O-CG 3.37Å; Y72-E76 PolarHBondContact O-N 3.25Å
73	A	86.2	Confident	90.4	Very high	41 Å²	41	99.7 Å²	99.7	34%	0.339	51%	0.512	S	S	.	.	H	α-helix	trans	-61.1	-42.6	175.8	0	0	0	0	0	111.8	Y69 Q70 K75 E76 E77	Y69-A73 WeakPolarHBondContact O-CB 2.97Å; Y69-A73 PolarHBondContact O-N 3.39Å; Q70-A73 PolarHBondContact O-N 3.02Å; A73-K75 VanDerWaalsContact C-N 3.32Å; A73-K75 PolarHBondContact O-N 3.4Å; A73-E76 PolarHBondContact O-N 3.32Å; A73-E77 PolarHBondContact O-N 2.81Å
74	L	90.9	Very high	90.7	Very high	99 Å²	99	97.3 Å²	97.3	52%	0.518	50%	0.498	S	S	.	.	H	α-helix	trans	-63.1	-38.8	174	-74.8	171	0	0	0	111.8	Q70 E71 Y72 E77 I78	Q70-L74 WeakPolarHBondContact O-CB 3.24Å; Q70-L74 VanDerWaalsContact O-CG 3.28Å; Q70-L74 WeakPolarHBondContact O-CG 3.3Å; Q70-L74 PolarHBondContact O-N 3.24Å; E71-L74 PolarHBondContact O-N 2.96Å; Y72-L74 VanDerWaalsContact C-N 3.34Å; Y72-L74 PolarHBondContact O-N 3.32Å; L74-E77 PolarHBondContact O-N 3.38Å; L74-I78 WeakPolarHBondContact O-CB 3.36Å; L74-I78 VanDerWaalsContact O-CG1 3.26Å; L74-I78 WeakPolarHBondContact O-CG1 3.35Å; L74-I78 PolarHBondContact O-N 3.19Å
75	K	93.6	Very high	91.2	Very high	125 Å²	125	98.9 Å²	98.9	54%	0.543	51%	0.506	S	S	.	.	H	α-helix	trans	-63.7	-44.8	175.8	-175.8	176.9	179.3	176.9	0	111.7	E71 Y72 A73 E77 I78 D79	E71-K75 WeakPolarHBondContact O-CB 3.49Å; E71-K75 PolarHBondContact O-N 3.45Å; Y72-K75 WeakPolarHBondContact O-CB 3.19Å; Y72-K75 PolarHBondContact O-N 2.92Å; Y72-K75 VanDerWaalsContact O-N 3.15Å; A73-K75 VanDerWaalsContact C-N 3.32Å; A73-K75 PolarHBondContact O-N 3.4Å; K75-E77 VanDerWaalsContact C-N 3.3Å; K75-E77 PolarHBondContact O-N 2.93Å; K75-I78 PolarHBondContact O-N 3.42Å; K75-D79 WeakPolarHBondContact O-CB 3.38Å; K75-D79 VanDerWaalsContact O-CG 3.3Å; K75-D79 PolarHBondContact O-N 2.88Å
76	E	92.5	Very high	91.7	Very high	140 Å²	140	98.3 Å²	98.3	65%	0.654	50%	0.503	S	S	*	.	H	α-helix	trans	-60.3	-40.4	174.7	-72.2	179	177.5	0	0	111.7	Y72 A73 D79 A80	Y72-E76 WeakPolarHBondContact O-CG 3.37Å; Y72-E76 PolarHBondContact O-N 3.25Å; A73-E76 PolarHBondContact O-N 3.32Å; E76-D79 PolarHBondContact O-N 3.33Å; E76-A80 WeakPolarHBondContact O-CB 3.45Å; E76-A80 PolarHBondContact O-N 3.39Å
77	E	94.6	Very high	92.2	Very high	121 Å²	121	101.3 Å²	101.3	57%	0.565	50%	0.504	S	S	*	.	H	α-helix	trans	-65.1	-43.5	175.4	-172.3	174.8	-174.6	0	0	112.1	A73 L74 K75 A80 L81	A73-E77 PolarHBondContact O-N 2.81Å; L74-E77 PolarHBondContact O-N 3.38Å; K75-E77 VanDerWaalsContact C-N 3.3Å; K75-E77 PolarHBondContact O-N 2.93Å; E77-A80 PolarHBondContact O-N 3.33Å; E77-L81 HydrophobicContact CG-CD1 4.32Å; E77-L81 WeakPolarHBondContact O-CB 3.44Å; E77-L81 WeakPolarHBondContact O-CG 3.38Å; E77-L81 PolarHBondContact O-N 3.11Å
78	I	96.4	Very high	92.8	Very high	94 Å²	94	104.2 Å²	104.2	48%	0.482	51%	0.512	S	S	.	.	H	α-helix	trans	-61.3	-44.5	174.9	-72.3	165.4	0	0	0	110.9	L74 K75 A80 L81 N82	L74-I78 WeakPolarHBondContact O-CB 3.36Å; L74-I78 VanDerWaalsContact O-CG1 3.26Å; L74-I78 WeakPolarHBondContact O-CG1 3.35Å; L74-I78 PolarHBondContact O-N 3.19Å; K75-I78 PolarHBondContact O-N 3.42Å; I78-A80 VanDerWaalsContact C-N 3.34Å; I78-A80 PolarHBondContact O-N 3.47Å; I78-L81 PolarHBondContact O-N 2.95Å; I78-N82 WeakPolarHBondContact CG2-ND2 3.48Å; I78-N82 WeakPolarHBondContact O-CB 3.44Å; I78-N82 VanDerWaalsContact O-CG 3.3Å; I78-N82 PolarHBondContact O-N 3.37Å; I78-N82 PolarHBondContact O-ND2 3.12Å
79	D	96.6	Very high	93.5	Very high	88 Å²	88	104.3 Å²	104.3	47%	0.471	52%	0.517	S	S	.	.	H	α-helix	trans	-63.8	-40.6	178.7	-72.4	-19.1	0	0	0	111.2	K75 E76 N82 A83	K75-D79 WeakPolarHBondContact O-CB 3.38Å; K75-D79 VanDerWaalsContact O-CG 3.3Å; K75-D79 PolarHBondContact O-N 2.88Å; E76-D79 PolarHBondContact O-N 3.33Å; D79-N82 PolarHBondContact O-N 3.5Å; D79-A83 PolarHBondContact O-N 3.26Å
80	A	96.6	Very high	94.4	Very high	63 Å²	63	102.6 Å²	102.6	52%	0.521	51%	0.512	S	S	.	.	H	α-helix	trans	-64.6	-43.1	174.2	0	0	0	0	0	112.6	E76 E77 I78 A83 E84	E76-A80 WeakPolarHBondContact O-CB 3.45Å; E76-A80 PolarHBondContact O-N 3.39Å; E77-A80 PolarHBondContact O-N 3.33Å; I78-A80 VanDerWaalsContact C-N 3.34Å; I78-A80 PolarHBondContact O-N 3.47Å; A80-A83 PolarHBondContact O-N 3.33Å; A80-E84 PolarHBondContact O-N 3.24Å
81	L	97.7	Very high	95.1	Very high	101 Å²	101	100.5 Å²	100.5	53%	0.529	51%	0.505	S	S	.	.	H	α-helix	trans	-63.5	-41.7	175.7	-74.6	171.8	0	0	0	111.7	E77 I78 E84 C85	E77-L81 HydrophobicContact CG-CD1 4.32Å; E77-L81 WeakPolarHBondContact O-CB 3.44Å; E77-L81 WeakPolarHBondContact O-CG 3.38Å; E77-L81 PolarHBondContact O-N 3.11Å; I78-L81 PolarHBondContact O-N 2.95Å; L81-E84 PolarHBondContact O-N 2.94Å; L81-C85 PolarHBondContact O-N 2.71Å; L81-C85 PolarHBondContact O-SG 2.93Å; L81-C85 VanDerWaalsContact O-SG 3.35Å
82	N	98.1	Very high	95.7	Very high	85 Å²	85	98 Å²	98	46%	0.455	50%	0.502	S	S	.	.	H	α-helix	trans	-62	-44.1	175.7	-76.8	-34.4	0	0	0	111.8	I78 D79 E84 C85 I86	I78-N82 WeakPolarHBondContact CG2-ND2 3.48Å; I78-N82 WeakPolarHBondContact O-CB 3.44Å; I78-N82 VanDerWaalsContact O-CG 3.3Å; I78-N82 PolarHBondContact O-N 3.37Å; I78-N82 PolarHBondContact O-ND2 3.12Å; D79-N82 PolarHBondContact O-N 3.5Å; N82-E84 VanDerWaalsContact C-N 3.31Å; N82-E84 PolarHBondContact O-N 2.92Å; N82-C85 PolarHBondContact O-N 2.91Å; N82-I86 WeakPolarHBondContact O-CG1 3.42Å; N82-I86 PolarHBondContact O-N 3.36Å
83	A	97.9	Very high	96.3	Very high	60 Å²	60	96.9 Å²	96.9	50%	0.496	50%	0.502	S	S	.	.	H	α-helix	trans	-60.7	-40.9	175.4	0	0	0	0	0	111.9	D79 A80 I86 R87	D79-A83 PolarHBondContact O-N 3.26Å; A80-A83 PolarHBondContact O-N 3.33Å; A83-I86 PolarHBondContact O-N 3.24Å; A83-R87 WeakPolarHBondContact O-CB 3.33Å; A83-R87 PolarHBondContact O-N 3.38Å
84	E	97.9	Very high	96.9	Very high	66 Å²	66	99.7 Å²	99.7	31%	0.308	51%	0.509	S	S	.	.	H	α-helix	trans	-67.7	-38.4	177.1	-179.3	60.1	-169.3	0	0	112.5	A80 L81 N82 R87 K88	A80-E84 PolarHBondContact O-N 3.24Å; L81-E84 PolarHBondContact O-N 2.94Å; N82-E84 VanDerWaalsContact C-N 3.31Å; N82-E84 PolarHBondContact O-N 2.92Å; E84-R87 PolarHBondContact O-N 3.15Å; E84-R87 IonicContact OE1-CZ 3.53Å; E84-R87 IonicContact OE1-NE 3.57Å; E84-R87 IonicContact OE1-NH2 2.67Å; E84-R87 PolarHBondContact OE1-NH2 2.97Å; E84-R87 IonicContact OE2-CZ 3.51Å; E84-R87 IonicContact OE2-NE 2.77Å; E84-R87 PolarHBondContact OE2-NE 2.96Å; E84-R87 IonicContact OE2-NH2 3.4Å; E84-R87 PolarHBondContact OE2-NH2 2.88Å; E84-K88 WeakPolarHBondContact O-CG 3.29Å; E84-K88 PolarHBondContact O-N 2.74Å; E84-K88 WeakPolarHBondContact OE1-CE 3.32Å; E84-K88 IonicContact OE1-NZ 3.92Å
85	C	97.8	Very high	97.3	Very high	66 Å²	66	98.7 Å²	98.7	45%	0.446	50%	0.503	S	S	.	.	H	α-helix	trans	-59.8	-50.4	173.2	-75.3	0	0	0	0	111.3	L81 N82 R87 K88 E89	L81-C85 PolarHBondContact O-N 2.71Å; L81-C85 PolarHBondContact O-SG 2.93Å; L81-C85 VanDerWaalsContact O-SG 3.35Å; N82-C85 PolarHBondContact O-N 2.91Å; C85-R87 VanDerWaalsContact C-N 3.28Å; C85-R87 PolarHBondContact O-N 3.42Å; C85-K88 PolarHBondContact O-N 2.83Å; C85-K88 VanDerWaalsContact O-N 3.14Å; C85-E89 WeakPolarHBondContact O-CG 3.48Å; C85-E89 PolarHBondContact O-N 3.43Å
86	I	98.2	Very high	97.5	Very high	113 Å²	113	98.1 Å²	98.1	58%	0.579	50%	0.501	S	S	*	.	H	α-helix	trans	-57.4	-43.3	177	-67.6	165.7	0	0	0	110.8	N82 A83 E89 K90	N82-I86 WeakPolarHBondContact O-CG1 3.42Å; N82-I86 PolarHBondContact O-N 3.36Å; A83-I86 PolarHBondContact O-N 3.24Å; I86-E89 PolarHBondContact O-N 2.93Å; I86-K90 PolarHBondContact O-N 2.86Å
87	R	98.3	Very high	97.8	Very high	129 Å²	129	92.7 Å²	92.7	49%	0.487	48%	0.482	S	S	.	.	H	α-helix	trans	-62	-44.1	177.9	-167.9	-167.9	69.7	76.6	-0.8	111.8	A83 E84 C85 K90 L91	A83-R87 WeakPolarHBondContact O-CB 3.33Å; A83-R87 PolarHBondContact O-N 3.38Å; E84-R87 PolarHBondContact O-N 3.15Å; E84-R87 IonicContact OE1-CZ 3.53Å; E84-R87 IonicContact OE1-NE 3.57Å; E84-R87 IonicContact OE1-NH2 2.67Å; E84-R87 PolarHBondContact OE1-NH2 2.97Å; E84-R87 IonicContact OE2-CZ 3.51Å; E84-R87 IonicContact OE2-NE 2.77Å; E84-R87 PolarHBondContact OE2-NE 2.96Å; E84-R87 IonicContact OE2-NH2 3.4Å; E84-R87 PolarHBondContact OE2-NH2 2.88Å; C85-R87 VanDerWaalsContact C-N 3.28Å; C85-R87 PolarHBondContact O-N 3.42Å; R87-K90 PolarHBondContact O-N 3.17Å; R87-L91 PolarHBondContact O-N 3.14Å; R87-L91 VanDerWaalsContact O-N 3.07Å
88	K	98.3	Very high	97.9	Very high	120 Å²	120	93.1 Å²	93.1	52%	0.522	48%	0.479	S	S	.	.	H	α-helix	trans	-67.4	-38.8	177.7	-76	-178	-178.3	172.1	0	112.4	E84 C85 L91 A92	E84-K88 WeakPolarHBondContact O-CG 3.29Å; E84-K88 PolarHBondContact O-N 2.74Å; E84-K88 WeakPolarHBondContact OE1-CE 3.32Å; E84-K88 IonicContact OE1-NZ 3.92Å; C85-K88 PolarHBondContact O-N 2.83Å; C85-K88 VanDerWaalsContact O-N 3.14Å; K88-L91 PolarHBondContact O-N 3.35Å; K88-A92 WeakPolarHBondContact O-CB 3.47Å; K88-A92 PolarHBondContact O-N 3.09Å
89	E	98.4	Very high	98	Very high	128 Å²	128	94.2 Å²	94.2	60%	0.598	48%	0.484	S	S	*	.	H	α-helix	trans	-61.3	-44.8	174.7	-74.9	176.2	172.5	0	0	111.4	C85 I86 L91 A92 Q93	C85-E89 WeakPolarHBondContact O-CG 3.48Å; C85-E89 PolarHBondContact O-N 3.43Å; I86-E89 PolarHBondContact O-N 2.93Å; E89-L91 PolarHBondContact O-N 3.49Å; E89-A92 PolarHBondContact O-N 3.01Å; E89-Q93 WeakPolarHBondContact O-CG 3.33Å; E89-Q93 PolarHBondContact O-N 3.08Å
90	K	98.3	Very high	98.1	Very high	138 Å²	138	94.3 Å²	94.3	60%	0.6	48%	0.482	S	S	*	.	H	α-helix	trans	-58.6	-47.8	174.3	-176.1	179.9	176.5	-175.6	0	111.6	I86 R87 A92 Q93 E94	I86-K90 PolarHBondContact O-N 2.86Å; R87-K90 PolarHBondContact O-N 3.17Å; K90-A92 VanDerWaalsContact C-N 3.3Å; K90-A92 PolarHBondContact O-N 2.94Å; K90-Q93 PolarHBondContact O-N 3.15Å; K90-E94 WeakPolarHBondContact CE-OE1 3.32Å; K90-E94 WeakPolarHBondContact O-CG 3.36Å; K90-E94 PolarHBondContact O-N 3.18Å
91	L	98.4	Very high	98.2	Very high	76 Å²	76	95.6 Å²	95.6	40%	0.398	48%	0.48	S	S	.	.	H	α-helix	trans	-60	-40.1	177.4	-179.7	62.4	0	0	0	112	R87 K88 E89 E94 L95	R87-L91 PolarHBondContact O-N 3.14Å; R87-L91 VanDerWaalsContact O-N 3.07Å; K88-L91 PolarHBondContact O-N 3.35Å; E89-L91 PolarHBondContact O-N 3.49Å; L91-E94 PolarHBondContact O-N 2.96Å; L91-L95 HydrophobicContact CD1-CG 4.47Å; L91-L95 HydrophobicContact CG-CD1 4.25Å; L91-L95 WeakPolarHBondContact O-CB 3.35Å; L91-L95 WeakPolarHBondContact O-CG 3.35Å; L91-L95 PolarHBondContact O-N 3.33Å
92	A	98.3	Very high	98.2	Very high	54 Å²	54	97.3 Å²	97.3	45%	0.446	48%	0.481	S	S	.	.	H	α-helix	trans	-63.7	-40.8	176.8	0	0	0	0	0	112.1	K88 E89 K90 L95 K96	K88-A92 WeakPolarHBondContact O-CB 3.47Å; K88-A92 PolarHBondContact O-N 3.09Å; E89-A92 PolarHBondContact O-N 3.01Å; K90-A92 VanDerWaalsContact C-N 3.3Å; K90-A92 PolarHBondContact O-N 2.94Å; A92-L95 PolarHBondContact O-N 3.33Å; A92-K96 WeakPolarHBondContact O-CB 3.49Å; A92-K96 PolarHBondContact O-N 2.88Å
93	Q	98.3	Very high	98.2	Very high	127 Å²	127	96.9 Å²	96.9	59%	0.593	48%	0.484	S	S	*	.	H	α-helix	trans	-66.1	-41.2	175.4	-65.5	-58.7	-19.5	0	0	112.4	E89 K90 K96 G97	E89-Q93 WeakPolarHBondContact O-CG 3.33Å; E89-Q93 PolarHBondContact O-N 3.08Å; K90-Q93 PolarHBondContact O-N 3.15Å; Q93-K96 PolarHBondContact O-N 3.47Å; Q93-G97 PolarHBondContact O-N 3.13Å
94	E	98.3	Very high	98.2	Very high	100 Å²	100	100.1 Å²	100.1	47%	0.467	49%	0.487	S	S	.	.	H	α-helix	trans	-61.7	-43.6	175.1	-71.6	172.5	-178	0	0	111.8	K90 L91 G97 R98	K90-E94 WeakPolarHBondContact CE-OE1 3.32Å; K90-E94 WeakPolarHBondContact O-CG 3.36Å; K90-E94 PolarHBondContact O-N 3.18Å; L91-E94 PolarHBondContact O-N 2.96Å; E94-G97 PolarHBondContact O-N 3.04Å; E94-R98 WeakPolarHBondContact O-CG 3.47Å; E94-R98 PolarHBondContact O-N 3.19Å; E94-R98 VanDerWaalsContact O-N 3.1Å
95	L	98.3	Very high	98.2	Very high	78 Å²	78	100.1 Å²	100.1	41%	0.408	50%	0.495	S	S	.	.	H	α-helix	trans	-63.7	-41.8	175.4	-74.1	172.4	0	0	0	112	L91 A92 G97 R98 I99	L91-L95 HydrophobicContact CD1-CG 4.47Å; L91-L95 HydrophobicContact CG-CD1 4.25Å; L91-L95 WeakPolarHBondContact O-CB 3.35Å; L91-L95 WeakPolarHBondContact O-CG 3.35Å; L91-L95 PolarHBondContact O-N 3.33Å; A92-L95 PolarHBondContact O-N 3.33Å; L95-G97 PolarHBondContact O-N 3.44Å; L95-R98 PolarHBondContact O-N 2.92Å; L95-I99 WeakPolarHBondContact O-CG1 3.38Å; L95-I99 PolarHBondContact O-N 2.7Å
96	K	98.4	Very high	98.2	Very high	113 Å²	113	101.7 Å²	101.7	49%	0.491	50%	0.498	S	S	.	.	H	α-helix	trans	-58.3	-48	175.4	-177.1	-177.6	172.7	-171.8	0	111.2	A92 Q93 R98 I99 E100	A92-K96 WeakPolarHBondContact O-CB 3.49Å; A92-K96 PolarHBondContact O-N 2.88Å; Q93-K96 PolarHBondContact O-N 3.47Å; K96-R98 VanDerWaalsContact C-N 3.35Å; K96-R98 PolarHBondContact O-N 2.9Å; K96-I99 PolarHBondContact O-N 3.38Å; K96-E100 WeakPolarHBondContact CE-OE1 3.29Å; K96-E100 WeakPolarHBondContact O-CG 3.37Å; K96-E100 PolarHBondContact O-N 3.49Å
97	G	98.1	Very high	98.1	Very high	26 Å²	26	100.9 Å²	100.9	27%	0.268	49%	0.491	S	S	.	.	H	α-helix	trans	-58.4	-44.5	177.2	0	0	0	0	0	112.6	Q93 E94 L95 I99 E100 D101	Q93-G97 PolarHBondContact O-N 3.13Å; E94-G97 PolarHBondContact O-N 3.04Å; L95-G97 PolarHBondContact O-N 3.44Å; G97-I99 VanDerWaalsContact C-N 3.34Å; G97-I99 PolarHBondContact O-N 3.39Å; G97-E100 WeakPolarHBondContact O-CB 3.46Å; G97-E100 PolarHBondContact O-N 3.31Å; G97-D101 PolarHBondContact O-N 2.87Å
98	R	98.3	Very high	98	Very high	130 Å²	130	99.5 Å²	99.5	49%	0.491	50%	0.497	S	S	.	.	H	α-helix	trans	-61.2	-40.2	176	-71.3	173.7	59.8	-162.7	-3.8	113	E94 L95 K96 E100 D101 Y102	E94-R98 WeakPolarHBondContact O-CG 3.47Å; E94-R98 PolarHBondContact O-N 3.19Å; E94-R98 VanDerWaalsContact O-N 3.1Å; L95-R98 PolarHBondContact O-N 2.92Å; K96-R98 VanDerWaalsContact C-N 3.35Å; K96-R98 PolarHBondContact O-N 2.9Å; R98-E100 VanDerWaalsContact C-N 3.34Å; R98-D101 PolarHBondContact O-N 2.86Å; R98-Y102 HydrophobicContact CB-CE2 4.44Å; R98-Y102 WeakPolarHBondContact O-CD2 3.28Å; R98-Y102 PolarHBondContact O-N 3.25Å
99	I	98.3	Very high	97.8	Very high	117 Å²	117	98.3 Å²	98.3	60%	0.6	50%	0.495	S	S	*	.	H	α-helix	trans	-63.8	-41.9	176.5	-69.8	167.6	0	0	0	110.5	L95 K96 G97 D101 Y102 S103	L95-I99 WeakPolarHBondContact O-CG1 3.38Å; L95-I99 PolarHBondContact O-N 2.7Å; K96-I99 PolarHBondContact O-N 3.38Å; G97-I99 VanDerWaalsContact C-N 3.34Å; G97-I99 PolarHBondContact O-N 3.39Å; I99-D101 VanDerWaalsContact C-N 3.33Å; I99-D101 PolarHBondContact O-N 3.47Å; I99-Y102 PolarHBondContact O-N 3.36Å; I99-S103 WeakPolarHBondContact O-CB 3.26Å; I99-S103 PolarHBondContact O-N 2.88Å
100	E	98.3	Very high	97.7	Very high	90 Å²	90	96 Å²	96	42%	0.421	49%	0.486	S	S	.	.	H	α-helix	trans	-62.2	-40.3	176	-70.2	174	-176.9	0	0	111.8	K96 G97 R98 S103 K104	K96-E100 WeakPolarHBondContact CE-OE1 3.29Å; K96-E100 WeakPolarHBondContact O-CG 3.37Å; K96-E100 PolarHBondContact O-N 3.49Å; G97-E100 WeakPolarHBondContact O-CB 3.46Å; G97-E100 PolarHBondContact O-N 3.31Å; R98-E100 VanDerWaalsContact C-N 3.34Å; E100-S103 WeakPolarHBondContact O-CB 3.14Å; E100-S103 PolarHBondContact O-N 3.41Å; E100-K104 WeakPolarHBondContact O-CG 3.36Å; E100-K104 PolarHBondContact O-N 3.15Å
101	D	98.2	Very high	97.4	Very high	90 Å²	90	93 Å²	93	48%	0.481	48%	0.476	S	S	.	.	H	α-helix	trans	-67.3	-41.7	177	-69.6	-21.2	0	0	0	112.6	G97 R98 I99 K104 S105	G97-D101 PolarHBondContact O-N 2.87Å; R98-D101 PolarHBondContact O-N 2.86Å; I99-D101 VanDerWaalsContact C-N 3.33Å; I99-D101 PolarHBondContact O-N 3.47Å; D101-K104 PolarHBondContact O-N 3.24Å; D101-K104 IonicContact OD1-NZ 3.89Å; D101-S105 WeakPolarHBondContact O-CB 3.5Å; D101-S105 PolarHBondContact O-N 3.18Å; D101-S105 PolarHBondContact O-OG 2.93Å
102	Y	98.4	Very high	97.1	Very high	138 Å²	138	94 Å²	94	54%	0.541	48%	0.479	S	S	.	.	H	α-helix	trans	-63.5	-42.1	172.7	-68.4	-42.7	0	0	0	111.6	R98 I99 K104 S105 I106	R98-Y102 HydrophobicContact CB-CE2 4.44Å; R98-Y102 WeakPolarHBondContact O-CD2 3.28Å; R98-Y102 PolarHBondContact O-N 3.25Å; I99-Y102 PolarHBondContact O-N 3.36Å; Y102-K104 PolarHBondContact O-N 2.89Å; Y102-S105 PolarHBondContact O-N 3.42Å; Y102-I106 VanDerWaalsContact O-CG1 3.31Å; Y102-I106 WeakPolarHBondContact O-CG1 3.28Å; Y102-I106 PolarHBondContact O-N 3.45Å
103	S	98	Very high	96.7	Very high	75 Å²	75	98.1 Å²	98.1	52%	0.524	49%	0.488	S	S	.	.	H	α-helix	trans	-59.1	-46.7	176.8	-174.8	0	0	0	0	111.8	I99 E100 S105 I106 Q107	I99-S103 WeakPolarHBondContact O-CB 3.26Å; I99-S103 PolarHBondContact O-N 2.88Å; E100-S103 WeakPolarHBondContact O-CB 3.14Å; E100-S103 PolarHBondContact O-N 3.41Å; S103-S105 VanDerWaalsContact C-N 3.35Å; S103-S105 PolarHBondContact O-N 2.97Å; S103-I106 PolarHBondContact O-N 3.41Å; S103-Q107 PolarHBondContact O-N 3.46Å
104	K	97.6	Very high	96.2	Very high	128 Å²	128	95.5 Å²	95.5	56%	0.557	48%	0.483	S	S	*	.	H	α-helix	trans	-60.4	-43.6	174.7	-70.8	168.6	-170.5	161	0	112	E100 D101 Y102 I106 Q107 V108	E100-K104 WeakPolarHBondContact O-CG 3.36Å; E100-K104 PolarHBondContact O-N 3.15Å; D101-K104 PolarHBondContact O-N 3.24Å; D101-K104 IonicContact OD1-NZ 3.89Å; Y102-K104 PolarHBondContact O-N 2.89Å; K104-I106 PolarHBondContact O-N 3.47Å; K104-Q107 PolarHBondContact O-N 3.38Å; K104-V108 WeakPolarHBondContact O-CG2 3.43Å; K104-V108 PolarHBondContact O-N 3.45Å
105	S	97.8	Very high	95.4	Very high	67 Å²	67	98.5 Å²	98.5	47%	0.469	50%	0.495	S	S	.	.	H	α-helix	trans	-63.3	-42	179.5	-57.9	0	0	0	0	111.7	D101 Y102 S103 V108 I109	D101-S105 WeakPolarHBondContact O-CB 3.5Å; D101-S105 PolarHBondContact O-N 3.18Å; D101-S105 PolarHBondContact O-OG 2.93Å; Y102-S105 PolarHBondContact O-N 3.42Å; S103-S105 VanDerWaalsContact C-N 3.35Å; S103-S105 PolarHBondContact O-N 2.97Å; S105-V108 PolarHBondContact O-N 2.91Å; S105-I109 WeakPolarHBondContact O-CG1 3.36Å; S105-I109 PolarHBondContact O-N 3.07Å; S105-I109 VanDerWaalsContact O-N 3.15Å
106	I	97.5	Very high	94.1	Very high	99 Å²	99	99.6 Å²	99.6	51%	0.508	50%	0.501	S	S	.	.	H	α-helix	trans	-63.3	-42.7	174.6	-69.4	167.2	0	0	0	110.6	Y102 S103 K104 V108 I109 I110	Y102-I106 VanDerWaalsContact O-CG1 3.31Å; Y102-I106 WeakPolarHBondContact O-CG1 3.28Å; Y102-I106 PolarHBondContact O-N 3.45Å; S103-I106 PolarHBondContact O-N 3.41Å; K104-I106 PolarHBondContact O-N 3.47Å; I106-V108 VanDerWaalsContact C-N 3.34Å; I106-V108 PolarHBondContact O-N 2.92Å; I106-I109 WeakPolarHBondContact O-CB 3.39Å; I106-I109 PolarHBondContact O-N 3.35Å; I106-I109 VanDerWaalsContact O-N 3.17Å; I106-I110 HydrophobicContact CG2-CD1 3.81Å; I106-I110 HydrophobicContact CG2-CG1 4.34Å; I106-I110 WeakPolarHBondContact O-CG1 3.48Å; I106-I110 PolarHBondContact O-N 3.3Å
107	Q	96.4	Very high	92.5	Very high	96 Å²	96	98.9 Å²	98.9	45%	0.449	50%	0.502	S	S	.	.	H	α-helix	trans	-60.6	-42.9	177.6	-171.3	61.7	54.3	0	0	112	S103 K104 I109 I110 D111	S103-Q107 PolarHBondContact O-N 3.46Å; K104-Q107 PolarHBondContact O-N 3.38Å; Q107-I109 VanDerWaalsContact C-N 3.3Å; Q107-I109 PolarHBondContact O-N 2.83Å; Q107-I110 PolarHBondContact O-N 3.45Å; Q107-D111 PolarHBondContact NE2-OD1 3.46Å; Q107-D111 VanDerWaalsContact O-CG 3.24Å; Q107-D111 PolarHBondContact O-N 3.07Å
108	V	95.7	Very high	90.7	Very high	100 Å²	100	102.6 Å²	102.6	61%	0.606	52%	0.521	S	S	*	.	H	α-helix	trans	-59.4	-42	175.2	171.1	0	0	0	0	111.5	K104 S105 I106 D111 Q112	K104-V108 WeakPolarHBondContact O-CG2 3.43Å; K104-V108 PolarHBondContact O-N 3.45Å; S105-V108 PolarHBondContact O-N 2.91Å; I106-V108 VanDerWaalsContact C-N 3.34Å; I106-V108 PolarHBondContact O-N 2.92Å; V108-D111 PolarHBondContact O-N 3.06Å; V108-Q112 WeakPolarHBondContact O-CB 3.24Å; V108-Q112 PolarHBondContact O-N 3.5Å; V108-Q112 VanDerWaalsContact O-N 3.07Å
109	I	95.4	Very high	88.8	Confident	94 Å²	94	105.9 Å²	105.9	48%	0.482	54%	0.535	S	S	.	.	H	α-helix	trans	-63.3	-47.8	176.7	-67.2	166.6	0	0	0	110.2	S105 I106 Q107 D111 Q112 F113	S105-I109 WeakPolarHBondContact O-CG1 3.36Å; S105-I109 PolarHBondContact O-N 3.07Å; S105-I109 VanDerWaalsContact O-N 3.15Å; I106-I109 WeakPolarHBondContact O-CB 3.39Å; I106-I109 PolarHBondContact O-N 3.35Å; I106-I109 VanDerWaalsContact O-N 3.17Å; Q107-I109 VanDerWaalsContact C-N 3.3Å; Q107-I109 PolarHBondContact O-N 2.83Å; I109-D111 PolarHBondContact O-N 3.21Å; I109-Q112 PolarHBondContact O-N 3.4Å; I109-F113 HydrophobicContact CG2-CD2 3.61Å; I109-F113 HydrophobicContact CG2-CE2 3.58Å; I109-F113 VanDerWaalsContact O-CD2 3.26Å; I109-F113 WeakPolarHBondContact O-CD2 3.35Å; I109-F113 PolarHBondContact O-N 3.5Å
110	I	94.9	Very high	86.6	Confident	81 Å²	81	109.7 Å²	109.7	42%	0.415	55%	0.548	S	S	.	.	H	α-helix	trans	-57.3	-48.7	177.6	-69.3	168.9	0	0	0	110.7	I106 Q107 Q112 F113 S114	I106-I110 HydrophobicContact CG2-CD1 3.81Å; I106-I110 HydrophobicContact CG2-CG1 4.34Å; I106-I110 WeakPolarHBondContact O-CG1 3.48Å; I106-I110 PolarHBondContact O-N 3.3Å; Q107-I110 PolarHBondContact O-N 3.45Å; I110-Q112 VanDerWaalsContact C-N 3.27Å; I110-Q112 PolarHBondContact O-N 3.42Å; I110-F113 PolarHBondContact O-N 2.86Å; I110-S114 WeakPolarHBondContact O-CB 3.23Å; I110-S114 PolarHBondContact O-N 3.05Å; I110-S114 PolarHBondContact O-OG 3.47Å
111	D	93.3	Very high	84.1	Confident	73 Å²	73	113.1 Å²	113.1	39%	0.39	59%	0.591	S	S	.	*	H	α-helix	trans	-61.4	-36.3	-179.3	-68	-9.5	0	0	0	112.2	Q107 V108 I109 K115	Q107-D111 PolarHBondContact NE2-OD1 3.46Å; Q107-D111 VanDerWaalsContact O-CG 3.24Å; Q107-D111 PolarHBondContact O-N 3.07Å; V108-D111 PolarHBondContact O-N 3.06Å; I109-D111 PolarHBondContact O-N 3.21Å; D111-K115 WeakPolarHBondContact O-CG 3.48Å; D111-K115 PolarHBondContact O-N 3.18Å
112	Q	91.4	Very high	83.4	Confident	98 Å²	98	114.3 Å²	114.3	46%	0.458	60%	0.597	S	S	.	*	H	α-helix	trans	-66.4	-49.4	175.3	-175	59.5	44	0	0	111.2	V108 I109 I110 S114 K115 D116	V108-Q112 WeakPolarHBondContact O-CB 3.24Å; V108-Q112 PolarHBondContact O-N 3.5Å; V108-Q112 VanDerWaalsContact O-N 3.07Å; I109-Q112 PolarHBondContact O-N 3.4Å; I110-Q112 VanDerWaalsContact C-N 3.27Å; I110-Q112 PolarHBondContact O-N 3.42Å; Q112-S114 VanDerWaalsContact C-N 3.3Å; Q112-S114 PolarHBondContact O-N 2.72Å; Q112-K115 PolarHBondContact O-N 2.68Å; Q112-D116 PolarHBondContact NE2-OD1 2.9Å; Q112-D116 PolarHBondContact NE2-OD2 3.14Å; Q112-D116 PolarHBondContact O-N 2.84Å; Q112-D116 VanDerWaalsContact O-N 3.09Å
113	F	89.5	Confident	82.7	Confident	141 Å²	141	113 Å²	113	62%	0.618	60%	0.6	S	S	*	*	H	α-helix	trans	-62.8	-34.8	176.9	-83.7	-74.8	0	0	0	112.7	I109 I110 K115 D116 L117	I109-F113 HydrophobicContact CG2-CD2 3.61Å; I109-F113 HydrophobicContact CG2-CE2 3.58Å; I109-F113 VanDerWaalsContact O-CD2 3.26Å; I109-F113 WeakPolarHBondContact O-CD2 3.35Å; I109-F113 PolarHBondContact O-N 3.5Å; I110-F113 PolarHBondContact O-N 2.86Å; F113-K115 VanDerWaalsContact C-N 3.34Å; F113-D116 PolarHBondContact O-N 3.06Å; F113-L117 WeakPolarHBondContact O-CG 3.35Å; F113-L117 PolarHBondContact O-N 3.23Å
114	S	87.4	Confident	81.8	Confident	72 Å²	72	115.1 Å²	115.1	50%	0.503	60%	0.604	S	S	.	*	H	α-helix	trans	-67.2	-32.2	175.5	-66.9	0	0	0	0	113.3	I110 Q112	I110-S114 WeakPolarHBondContact O-CB 3.23Å; I110-S114 PolarHBondContact O-N 3.05Å; I110-S114 PolarHBondContact O-OG 3.47Å; Q112-S114 VanDerWaalsContact C-N 3.3Å; Q112-S114 PolarHBondContact O-N 2.72Å
115	K	82	Confident	80.9	Confident	163 Å²	163	114.4 Å²	114.4	71%	0.709	61%	0.607	S	S	*	*	H	α-helix	trans	-76.1	-34.6	175.6	-73.6	170	-175.2	171.1	0	112.9	D111 Q112 F113 L117	D111-K115 WeakPolarHBondContact O-CG 3.48Å; D111-K115 PolarHBondContact O-N 3.18Å; Q112-K115 PolarHBondContact O-N 2.68Å; F113-K115 VanDerWaalsContact C-N 3.34Å; K115-L117 VanDerWaalsContact C-N 3.26Å; K115-L117 PolarHBondContact O-N 3.44Å
116	D	72.2	Confident	79.8	Confident	101 Å²	101	117.3 Å²	117.3	54%	0.54	62%	0.615	S	S	.	*	H	α-helix	trans	-80.4	-6	-178	-64.9	-26.2	0	0	0	113	Q112 F113 P118	Q112-D116 PolarHBondContact NE2-OD1 2.9Å; Q112-D116 PolarHBondContact NE2-OD2 3.14Å; Q112-D116 PolarHBondContact O-N 2.84Å; Q112-D116 VanDerWaalsContact O-N 3.09Å; F113-D116 PolarHBondContact O-N 3.06Å; D116-P118 WeakPolarHBondContact O-CD 3.45Å
117	L	63.8	Low	78.6	Confident	98 Å²	98	118.5 Å²	118.5	51%	0.513	62%	0.622	S	S	.	*			trans	-75.1	113	176.7	-85.2	163.9	0	0	0	111.2	F113 K115 Y119	F113-L117 WeakPolarHBondContact O-CG 3.35Å; F113-L117 PolarHBondContact O-N 3.23Å; K115-L117 VanDerWaalsContact C-N 3.26Å; K115-L117 PolarHBondContact O-N 3.44Å; L117-Y119 PolarHBondContact O-N 3.26Å
118	P	59.9	Low	77.4	Confident	104 Å²	104	120.1 Å²	120.1	68%	0.675	64%	0.635	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.5	19.5	-174.2	-16.6	32.7	0	0	0	115.8	D116	D116-P118 WeakPolarHBondContact O-CD 3.45Å
119	Y	58.9	Low	76	Confident	198 Å²	198	121.7 Å²	121.7	78%	0.776	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112.7	10.5	-168.8	-75.1	-80.9	0	0	0	114.6	L117	L117-Y119 PolarHBondContact O-N 3.26Å
120	F	52.6	Low	74.3	Confident	198 Å²	198	124 Å²	124	87%	0.868	65%	0.65	S	S	*	*			trans	-132.3	19.9	177.1	-71.4	-72.4	0	0	0	115.1
121	A	46.2	Very low	72.5	Confident	161 Å²	161	127.9 Å²	127.9	100%	1.331	67%	0.671	S	S	*	*			trans	-118.6	0	163.3	0	0	0	0	0	109.2

Retrieved 121 of 121 residues in 131.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).