A0A5K4F5D2_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F5D2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 55 aa.

						>A0A5K4F5D2_SCHMA|A0A5K4F5D2
MAAVQGGDDVLTPSKKSTEACRKDLESINNQLEASIRDIEKSLVSMEERFSSSNC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.5	Low	53.9	Low	250 Å²	250	125.3 Å²	125.3	100%	1.232	77%	0.771	S	S	*	*				0	94.9	0	-68.2	-177.4	175.4	0	0	107.3
2	A	60.4	Low	54.4	Low	101 Å²	101	120.8 Å²	120.8	84%	0.835	74%	0.744	S	S	*	*			trans	-90.4	111.2	173	0	0	0	0	0	106.6	V4	A2-V4 PolarHBondContact O-N 3.07Å; A2-V4 VanDerWaalsContact O-N 3.07Å
3	A	56.3	Low	54.8	Low	93 Å²	93	118.5 Å²	118.5	77%	0.769	73%	0.732	S	S	*	*			trans	-62.7	109.9	170.5	0	0	0	0	0	107.3	Q5	A3-Q5 PolarHBondContact O-N 2.97Å
4	V	56.6	Low	56.3	Low	142 Å²	142	115.7 Å²	115.7	86%	0.861	72%	0.719	S	S	*	*			trans	-65.1	94.8	163.2	150.6	0	0	0	0	105.5	A2 G6	A2-V4 PolarHBondContact O-N 3.07Å; A2-V4 VanDerWaalsContact O-N 3.07Å; V4-G6 PolarHBondContact O-N 2.89Å
5	Q	57.6	Low	57.8	Low	189 Å²	189	116.1 Å²	116.1	88%	0.883	71%	0.707	S	S	*	*			trans	-78.8	70.7	168	-160.4	156.8	-0.7	0	0	106.6	A3 G7	A3-Q5 PolarHBondContact O-N 2.97Å; Q5-G7 PolarHBondContact O-N 3.02Å
6	G	44.9	Very low	59.3	Low	61 Å²	61	118.6 Å²	118.6	63%	0.629	71%	0.705	S	S	*	*			trans	-73.3	77.1	161.9	0	0	0	0	0	107.5	V4	V4-G6 PolarHBondContact O-N 2.89Å
7	G	51	Low	60.9	Low	59 Å²	59	116.2 Å²	116.2	61%	0.608	70%	0.696	S	S	*	*			trans	-88.6	114.9	167.3	0	0	0	0	0	108	Q5 D9	Q5-G7 PolarHBondContact O-N 3.02Å; G7-D9 PolarHBondContact O-N 3.08Å
8	D	53.5	Low	62.6	Low	141 Å²	141	114.6 Å²	114.6	75%	0.754	69%	0.686	S	S	*	*			trans	-52	60.4	173.7	-70.4	-87.2	0	0	0	115.3	V10	D8-V10 VanDerWaalsContact C-N 3.27Å
9	D	51.8	Low	64.2	Low	117 Å²	117	113.1 Å²	113.1	63%	0.626	67%	0.672	S	S	*	*			trans	-90	7.7	171.4	-133.1	-76.4	0	0	0	112.4	G7 L11 T12	G7-D9 PolarHBondContact O-N 3.08Å; D9-L11 PolarHBondContact O-N 2.72Å; D9-L11 VanDerWaalsContact O-N 3.08Å; D9-T12 PolarHBondContact O-OG1 3.04Å; D9-T12 WeakPolarHBondContact OD1-CG2 3.41Å
10	V	56.1	Low	65.7	Low	134 Å²	134	109.9 Å²	109.9	81%	0.812	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.4	28.2	168.5	-169.3	0	0	0	0	110.9	D8	D8-V10 VanDerWaalsContact C-N 3.27Å
11	L	53.7	Low	67	Low	91 Å²	91	107.8 Å²	107.8	48%	0.476	65%	0.648	S	S	.	*	T	Hydrogen-bonded Turn	trans	-102.1	0.9	169.2	-77	163	0	0	0	112.3	D9 K15	D9-L11 PolarHBondContact O-N 2.72Å; D9-L11 VanDerWaalsContact O-N 3.08Å; L11-K15 HydrophobicContact CB-CD 4.37Å; L11-K15 WeakPolarHBondContact O-CD 3.15Å; L11-K15 VanDerWaalsContact O-CG 3.3Å; L11-K15 WeakPolarHBondContact O-CG 3.41Å
12	T	60.2	Low	69.2	Low	72 Å²	72	103.3 Å²	103.3	44%	0.442	62%	0.617	S	S	.	*	H	α-helix	trans	-87.1	-34.6	-165.1	51.3	0	0	0	0	117.1	D9 K16	D9-T12 PolarHBondContact O-OG1 3.04Å; D9-T12 WeakPolarHBondContact OD1-CG2 3.41Å; T12-K16 WeakPolarHBondContact O-CG 3.46Å
13	P	59.5	Low	70.9	Confident	90 Å²	90	103.8 Å²	103.8	58%	0.584	60%	0.601	S	S	*	*	H	α-helix	trans	-85.3	-37.4	177.7	28.5	-30.2	0	0	0	113	K16 S17	P13-K16 PolarHBondContact O-N 3.42Å; P13-S17 PolarHBondContact O-N 3.05Å
14	S	75.9	Confident	72.9	Confident	80 Å²	80	104.1 Å²	104.1	56%	0.559	59%	0.589	S	S	*	*	H	α-helix	trans	-67.1	-43.2	-176.8	-174.7	0	0	0	0	112.2	K16 S17 T18	S14-K16 VanDerWaalsContact C-N 3.35Å; S14-K16 PolarHBondContact O-N 2.95Å; S14-S17 WeakPolarHBondContact O-CB 3.27Å; S14-S17 PolarHBondContact O-N 2.98Å; S14-T18 WeakPolarHBondContact O-CG2 3.3Å; S14-T18 PolarHBondContact O-N 3.47Å; S14-T18 PolarHBondContact O-OG1 3.18Å
15	K	78.6	Confident	74.9	Confident	122 Å²	122	102.5 Å²	102.5	53%	0.53	58%	0.575	S	S	.	*	H	α-helix	trans	-62.9	-38.5	177.2	-70.8	-179.1	-178.5	171.8	0	113	L11 T18 E19	L11-K15 HydrophobicContact CB-CD 4.37Å; L11-K15 WeakPolarHBondContact O-CD 3.15Å; L11-K15 VanDerWaalsContact O-CG 3.3Å; L11-K15 WeakPolarHBondContact O-CG 3.41Å; K15-T18 WeakPolarHBondContact CA-OG1 3.43Å; K15-T18 PolarHBondContact O-N 2.9Å; K15-T18 PolarHBondContact O-OG1 2.97Å; K15-E19 WeakPolarHBondContact O-CB 3.37Å; K15-E19 PolarHBondContact O-N 3.29Å
16	K	81.8	Confident	76.8	Confident	155 Å²	155	99 Å²	99	67%	0.674	56%	0.559	S	S	*	*	H	α-helix	trans	-66.3	-40.8	175.3	-71	-179.9	-179.6	179.3	0	111.1	T12 P13 S14 E19 A20	T12-K16 WeakPolarHBondContact O-CG 3.46Å; P13-K16 PolarHBondContact O-N 3.42Å; S14-K16 VanDerWaalsContact C-N 3.35Å; S14-K16 PolarHBondContact O-N 2.95Å; K16-E19 PolarHBondContact O-N 3.45Å; K16-A20 WeakPolarHBondContact O-CB 3.42Å; K16-A20 PolarHBondContact O-N 2.98Å
17	S	87.6	Confident	79.3	Confident	79 Å²	79	98.9 Å²	98.9	55%	0.552	55%	0.549	S	S	*	.	H	α-helix	trans	-64.5	-40.4	176.5	-167.9	0	0	0	0	112.3	P13 S14 C21	P13-S17 PolarHBondContact O-N 3.05Å; S14-S17 WeakPolarHBondContact O-CB 3.27Å; S14-S17 PolarHBondContact O-N 2.98Å; S17-C21 VanDerWaalsContact O-CB 3.27Å; S17-C21 WeakPolarHBondContact O-CB 3.44Å; S17-C21 PolarHBondContact O-N 3.41Å
18	T	91.6	Very high	81.6	Confident	86 Å²	86	100 Å²	100	53%	0.528	54%	0.54	S	S	.	.	H	α-helix	trans	-71.5	-37	177.7	55.6	0	0	0	0	112	S14 K15 R22	S14-T18 WeakPolarHBondContact O-CG2 3.3Å; S14-T18 PolarHBondContact O-N 3.47Å; S14-T18 PolarHBondContact O-OG1 3.18Å; K15-T18 WeakPolarHBondContact CA-OG1 3.43Å; K15-T18 PolarHBondContact O-N 2.9Å; K15-T18 PolarHBondContact O-OG1 2.97Å; T18-R22 WeakPolarHBondContact O-CB 3.49Å; T18-R22 PolarHBondContact O-N 2.77Å
19	E	92.5	Very high	83.7	Confident	87 Å²	87	97.2 Å²	97.2	41%	0.407	53%	0.525	S	S	.	.	H	α-helix	trans	-66.6	-41.5	174.9	-164.8	-168.9	150.7	0	0	112	K15 K16 R22 K23	K15-E19 WeakPolarHBondContact O-CB 3.37Å; K15-E19 PolarHBondContact O-N 3.29Å; K16-E19 PolarHBondContact O-N 3.45Å; E19-R22 PolarHBondContact O-N 2.89Å; E19-K23 WeakPolarHBondContact O-CG 3.24Å; E19-K23 PolarHBondContact O-N 3.49Å; E19-K23 WeakPolarHBondContact OE1-CE 3.5Å; E19-K23 IonicContact OE1-NZ 2.77Å; E19-K23 PolarHBondContact OE1-NZ 3.48Å
20	A	93	Very high	86	Confident	49 Å²	49	95.5 Å²	95.5	41%	0.405	52%	0.516	S	S	.	.	H	α-helix	trans	-61.4	-50.4	174.3	0	0	0	0	0	111	K16 R22 K23 D24	K16-A20 WeakPolarHBondContact O-CB 3.42Å; K16-A20 PolarHBondContact O-N 2.98Å; A20-R22 VanDerWaalsContact C-N 3.28Å; A20-R22 PolarHBondContact O-N 3.3Å; A20-K23 PolarHBondContact O-N 2.94Å; A20-D24 PolarHBondContact O-N 3.06Å
21	C	94.8	Very high	88	Confident	66 Å²	66	95.2 Å²	95.2	45%	0.446	51%	0.506	S	S	.	.	H	α-helix	trans	-56.4	-41.3	176	-179.4	0	0	0	0	112.1	S17 K23 D24 L25	S17-C21 VanDerWaalsContact O-CB 3.27Å; S17-C21 WeakPolarHBondContact O-CB 3.44Å; S17-C21 PolarHBondContact O-N 3.41Å; C21-K23 PolarHBondContact O-N 3.4Å; C21-D24 PolarHBondContact O-N 3.06Å; C21-L25 WeakPolarHBondContact O-CB 3.32Å; C21-L25 VanDerWaalsContact O-CG 3.32Å; C21-L25 WeakPolarHBondContact O-CG 3.32Å; C21-L25 PolarHBondContact O-N 3.37Å
22	R	96.2	Very high	90.1	Very high	155 Å²	155	95.6 Å²	95.6	59%	0.585	51%	0.508	S	S	*	.	H	α-helix	trans	-61.7	-43.8	175.9	-172.7	-177.8	69.6	-167.5	-0.7	112.1	T18 E19 A20 L25 E26	T18-R22 WeakPolarHBondContact O-CB 3.49Å; T18-R22 PolarHBondContact O-N 2.77Å; E19-R22 PolarHBondContact O-N 2.89Å; A20-R22 VanDerWaalsContact C-N 3.28Å; A20-R22 PolarHBondContact O-N 3.3Å; R22-L25 PolarHBondContact O-N 3.49Å; R22-E26 WeakPolarHBondContact O-CB 3.35Å; R22-E26 PolarHBondContact O-N 3.02Å
23	K	96.5	Very high	92	Very high	111 Å²	111	95.9 Å²	95.9	48%	0.483	50%	0.504	S	S	.	.	H	α-helix	trans	-64.8	-40.1	177.2	-73.4	176.3	-175.5	163.6	0	111.6	E19 A20 C21 E26 S27	E19-K23 WeakPolarHBondContact O-CG 3.24Å; E19-K23 PolarHBondContact O-N 3.49Å; E19-K23 WeakPolarHBondContact OE1-CE 3.5Å; E19-K23 IonicContact OE1-NZ 2.77Å; E19-K23 PolarHBondContact OE1-NZ 3.48Å; A20-K23 PolarHBondContact O-N 2.94Å; C21-K23 PolarHBondContact O-N 3.4Å; K23-E26 PolarHBondContact O-N 3.33Å; K23-S27 WeakPolarHBondContact O-CB 3.5Å; K23-S27 PolarHBondContact O-N 2.92Å
24	D	97.5	Very high	93.8	Very high	100 Å²	100	93.3 Å²	93.3	54%	0.535	49%	0.49	S	S	.	.	H	α-helix	trans	-63	-45	176.3	-65.8	-23.7	0	0	0	110.9	A20 C21 E26 S27 I28	A20-D24 PolarHBondContact O-N 3.06Å; C21-D24 PolarHBondContact O-N 3.06Å; D24-E26 PolarHBondContact O-N 3.28Å; D24-S27 WeakPolarHBondContact O-CB 3.42Å; D24-S27 PolarHBondContact O-N 3.37Å; D24-I28 VanDerWaalsContact O-CG1 3.24Å; D24-I28 WeakPolarHBondContact O-CG1 3.37Å; D24-I28 PolarHBondContact O-N 2.91Å
25	L	98	Very high	94.9	Very high	108 Å²	108	92.3 Å²	92.3	57%	0.565	48%	0.483	S	S	*	.	H	α-helix	trans	-63.1	-40.5	176.2	-71.7	174	0	0	0	112.6	C21 R22 I28 N29	C21-L25 WeakPolarHBondContact O-CB 3.32Å; C21-L25 VanDerWaalsContact O-CG 3.32Å; C21-L25 WeakPolarHBondContact O-CG 3.32Å; C21-L25 PolarHBondContact O-N 3.37Å; R22-L25 PolarHBondContact O-N 3.49Å; L25-I28 PolarHBondContact O-N 3.45Å; L25-N29 WeakPolarHBondContact O-CB 3.39Å; L25-N29 PolarHBondContact O-N 3Å
26	E	98.2	Very high	95.9	Very high	115 Å²	115	90.9 Å²	90.9	54%	0.537	48%	0.48	S	S	.	.	H	α-helix	trans	-64.5	-42.3	175.4	-173.6	175.6	-172.7	0	0	111.5	R22 K23 D24 N29 N30	R22-E26 WeakPolarHBondContact O-CB 3.35Å; R22-E26 PolarHBondContact O-N 3.02Å; K23-E26 PolarHBondContact O-N 3.33Å; D24-E26 PolarHBondContact O-N 3.28Å; E26-N29 PolarHBondContact O-N 2.95Å; E26-N30 VanDerWaalsContact O-CG 3.27Å; E26-N30 PolarHBondContact O-N 3.37Å; E26-N30 PolarHBondContact O-ND2 3.45Å
27	S	98.2	Very high	96.7	Very high	59 Å²	59	89.1 Å²	89.1	41%	0.413	47%	0.47	S	S	.	.	H	α-helix	trans	-61	-46.5	174.4	-178.9	0	0	0	0	111.7	K23 D24 N29 N30 Q31	K23-S27 WeakPolarHBondContact O-CB 3.5Å; K23-S27 PolarHBondContact O-N 2.92Å; D24-S27 WeakPolarHBondContact O-CB 3.42Å; D24-S27 PolarHBondContact O-N 3.37Å; S27-N29 VanDerWaalsContact C-N 3.35Å; S27-N29 PolarHBondContact O-N 2.9Å; S27-N30 PolarHBondContact O-N 2.92Å; S27-Q31 WeakPolarHBondContact O-CG 3.43Å; S27-Q31 PolarHBondContact O-N 3.23Å
28	I	98.4	Very high	97.2	Very high	83 Å²	83	89.7 Å²	89.7	43%	0.426	47%	0.466	S	S	.	.	H	α-helix	trans	-61	-45.3	177.1	-69.5	163.8	0	0	0	110.3	D24 L25 N30 Q31 L32	D24-I28 VanDerWaalsContact O-CG1 3.24Å; D24-I28 WeakPolarHBondContact O-CG1 3.37Å; D24-I28 PolarHBondContact O-N 2.91Å; L25-I28 PolarHBondContact O-N 3.45Å; I28-N30 PolarHBondContact O-N 3.35Å; I28-Q31 PolarHBondContact O-N 2.9Å; I28-L32 HydrophobicContact CG2-CD1 3.94Å; I28-L32 HydrophobicContact CG2-CG 4.33Å; I28-L32 WeakPolarHBondContact O-CG 3.46Å; I28-L32 PolarHBondContact O-N 3.42Å
29	N	98.6	Very high	97.5	Very high	82 Å²	82	90.7 Å²	90.7	44%	0.439	47%	0.467	S	S	.	.	H	α-helix	trans	-59.5	-47.1	178.7	-171.6	53.2	0	0	0	111.6	L25 E26 S27 Q31 L32 E33	L25-N29 WeakPolarHBondContact O-CB 3.39Å; L25-N29 PolarHBondContact O-N 3Å; E26-N29 PolarHBondContact O-N 2.95Å; S27-N29 VanDerWaalsContact C-N 3.35Å; S27-N29 PolarHBondContact O-N 2.9Å; N29-Q31 VanDerWaalsContact C-N 3.31Å; N29-Q31 PolarHBondContact O-N 2.9Å; N29-L32 PolarHBondContact O-N 3.23Å; N29-E33 PolarHBondContact ND2-OE1 3.21Å; N29-E33 WeakPolarHBondContact O-CG 3.29Å; N29-E33 PolarHBondContact O-N 2.96Å
30	N	98.6	Very high	97.8	Very high	82 Å²	82	91.9 Å²	91.9	44%	0.439	47%	0.473	S	S	.	.	H	α-helix	trans	-61.2	-38	177.6	-70.7	-28.2	0	0	0	112.7	E26 S27 I28 A34	E26-N30 VanDerWaalsContact O-CG 3.27Å; E26-N30 PolarHBondContact O-N 3.37Å; E26-N30 PolarHBondContact O-ND2 3.45Å; S27-N30 PolarHBondContact O-N 2.92Å; I28-N30 PolarHBondContact O-N 3.35Å; N30-A34 WeakPolarHBondContact O-CB 3.48Å; N30-A34 PolarHBondContact O-N 3.41Å
31	Q	98.6	Very high	98	Very high	127 Å²	127	96.1 Å²	96.1	59%	0.593	48%	0.482	S	S	*	.	H	α-helix	trans	-67.5	-41.4	175.6	-74.1	177.5	-44.9	0	0	112.3	S27 I28 N29 A34 S35	S27-Q31 WeakPolarHBondContact O-CG 3.43Å; S27-Q31 PolarHBondContact O-N 3.23Å; I28-Q31 PolarHBondContact O-N 2.9Å; N29-Q31 VanDerWaalsContact C-N 3.31Å; N29-Q31 PolarHBondContact O-N 2.9Å; Q31-A34 PolarHBondContact O-N 3.38Å; Q31-S35 WeakPolarHBondContact O-CB 3.45Å; Q31-S35 PolarHBondContact O-N 2.92Å
32	L	98.7	Very high	98.1	Very high	99 Å²	99	96.3 Å²	96.3	52%	0.518	48%	0.484	S	S	.	.	H	α-helix	trans	-64.6	-44.7	176.3	-71.5	174.1	0	0	0	111.3	I28 N29 A34 S35 I36	I28-L32 HydrophobicContact CG2-CD1 3.94Å; I28-L32 HydrophobicContact CG2-CG 4.33Å; I28-L32 WeakPolarHBondContact O-CG 3.46Å; I28-L32 PolarHBondContact O-N 3.42Å; N29-L32 PolarHBondContact O-N 3.23Å; L32-A34 VanDerWaalsContact C-N 3.32Å; L32-A34 PolarHBondContact O-N 3.05Å; L32-S35 WeakPolarHBondContact O-CB 3.28Å; L32-S35 PolarHBondContact O-N 3.2Å; L32-I36 VanDerWaalsContact O-CG1 3.28Å; L32-I36 WeakPolarHBondContact O-CG1 3.44Å; L32-I36 PolarHBondContact O-N 3.35Å
33	E	98.6	Very high	98.2	Very high	79 Å²	79	93.1 Å²	93.1	37%	0.369	48%	0.478	S	S	.	.	H	α-helix	trans	-60.5	-40	175.3	-73.4	-179.3	-167.5	0	0	112.5	N29 R37	N29-E33 PolarHBondContact ND2-OE1 3.21Å; N29-E33 WeakPolarHBondContact O-CG 3.29Å; N29-E33 PolarHBondContact O-N 2.96Å; E33-R37 WeakPolarHBondContact O-CG 3.45Å; E33-R37 PolarHBondContact O-N 2.78Å; E33-R37 VanDerWaalsContact O-N 3.15Å; E33-R37 IonicContact OE2-NH1 3.9Å
34	A	98.4	Very high	98.2	Very high	35 Å²	35	91.2 Å²	91.2	29%	0.289	48%	0.476	S	S	.	.	H	α-helix	trans	-64	-45.7	174.8	0	0	0	0	0	111.8	N30 Q31 L32 I36 R37 D38	N30-A34 WeakPolarHBondContact O-CB 3.48Å; N30-A34 PolarHBondContact O-N 3.41Å; Q31-A34 PolarHBondContact O-N 3.38Å; L32-A34 VanDerWaalsContact C-N 3.32Å; L32-A34 PolarHBondContact O-N 3.05Å; A34-I36 VanDerWaalsContact C-N 3.35Å; A34-I36 PolarHBondContact O-N 3.02Å; A34-R37 PolarHBondContact O-N 2.91Å; A34-D38 PolarHBondContact O-N 3.46Å; A34-D38 VanDerWaalsContact O-N 3.07Å
35	S	98.6	Very high	98.1	Very high	60 Å²	60	89.2 Å²	89.2	42%	0.42	47%	0.47	S	S	.	.	H	α-helix	trans	-59.5	-43.7	177	-173.7	0	0	0	0	112.1	Q31 L32 R37 D38 I39	Q31-S35 WeakPolarHBondContact O-CB 3.45Å; Q31-S35 PolarHBondContact O-N 2.92Å; L32-S35 WeakPolarHBondContact O-CB 3.28Å; L32-S35 PolarHBondContact O-N 3.2Å; S35-R37 PolarHBondContact O-N 3.15Å; S35-D38 PolarHBondContact O-N 2.88Å; S35-I39 VanDerWaalsContact O-CG1 3.29Å; S35-I39 WeakPolarHBondContact O-CG1 3.39Å; S35-I39 PolarHBondContact O-N 3Å
36	I	98.7	Very high	98	Very high	91 Å²	91	88.5 Å²	88.5	47%	0.467	47%	0.465	S	S	.	.	H	α-helix	trans	-58.8	-48.6	176.3	-69.7	164.3	0	0	0	110.6	L32 A34 D38 I39 E40	L32-I36 VanDerWaalsContact O-CG1 3.28Å; L32-I36 WeakPolarHBondContact O-CG1 3.44Å; L32-I36 PolarHBondContact O-N 3.35Å; A34-I36 VanDerWaalsContact C-N 3.35Å; A34-I36 PolarHBondContact O-N 3.02Å; I36-D38 VanDerWaalsContact C-N 3.28Å; I36-D38 PolarHBondContact O-N 3.19Å; I36-I39 PolarHBondContact O-N 3.31Å; I36-E40 HydrophobicContact CG2-CG 4.38Å; I36-E40 WeakPolarHBondContact O-CG 3.43Å; I36-E40 PolarHBondContact O-N 3.25Å
37	R	98.3	Very high	97.8	Very high	119 Å²	119	88.1 Å²	88.1	45%	0.449	46%	0.463	S	S	.	.	H	α-helix	trans	-60.5	-36.9	178.8	-72.9	-174.5	-65.5	-97.6	1.9	112.9	E33 A34 S35 K41	E33-R37 WeakPolarHBondContact O-CG 3.45Å; E33-R37 PolarHBondContact O-N 2.78Å; E33-R37 VanDerWaalsContact O-N 3.15Å; E33-R37 IonicContact OE2-NH1 3.9Å; A34-R37 PolarHBondContact O-N 2.91Å; S35-R37 PolarHBondContact O-N 3.15Å; R37-K41 VanDerWaalsContact O-CG 3.31Å; R37-K41 WeakPolarHBondContact O-CG 3.43Å; R37-K41 PolarHBondContact O-N 3.15Å
38	D	98.5	Very high	97.7	Very high	90 Å²	90	91 Å²	91	48%	0.481	47%	0.47	S	S	.	.	H	α-helix	trans	-73.5	-34.8	179.1	-70.7	-19.9	0	0	0	112	A34 S35 I36 K41 S42	A34-D38 PolarHBondContact O-N 3.46Å; A34-D38 VanDerWaalsContact O-N 3.07Å; S35-D38 PolarHBondContact O-N 2.88Å; I36-D38 VanDerWaalsContact C-N 3.28Å; I36-D38 PolarHBondContact O-N 3.19Å; D38-K41 IonicContact OD1-NZ 3.8Å; D38-S42 WeakPolarHBondContact O-CB 3.42Å; D38-S42 PolarHBondContact O-N 2.97Å; D38-S42 PolarHBondContact O-OG 3.02Å
39	I	98.5	Very high	97.5	Very high	107 Å²	107	95.4 Å²	95.4	55%	0.549	48%	0.481	S	S	.	.	H	α-helix	trans	-64.4	-47	171.6	-68.6	165.1	0	0	0	110.4	S35 I36 K41 S42 L43	S35-I39 VanDerWaalsContact O-CG1 3.29Å; S35-I39 WeakPolarHBondContact O-CG1 3.39Å; S35-I39 PolarHBondContact O-N 3Å; I36-I39 PolarHBondContact O-N 3.31Å; I39-K41 PolarHBondContact O-N 3.25Å; I39-S42 WeakPolarHBondContact O-CB 3.31Å; I39-S42 PolarHBondContact O-N 3.07Å; I39-S42 VanDerWaalsContact O-N 3.15Å; I39-L43 PolarHBondContact O-N 3.47Å
40	E	98.3	Very high	97.2	Very high	113 Å²	113	98.1 Å²	98.1	53%	0.528	49%	0.489	S	S	.	.	H	α-helix	trans	-58.6	-46.8	177.8	-72.8	173.8	155.4	0	0	111.5	I36 S42 L43 V44	I36-E40 HydrophobicContact CG2-CG 4.38Å; I36-E40 WeakPolarHBondContact O-CG 3.43Å; I36-E40 PolarHBondContact O-N 3.25Å; E40-S42 VanDerWaalsContact C-N 3.31Å; E40-S42 PolarHBondContact O-N 3.05Å; E40-L43 PolarHBondContact O-N 3.35Å; E40-V44 WeakPolarHBondContact O-CG2 3.37Å; E40-V44 PolarHBondContact O-N 3.47Å
41	K	97.5	Very high	96.8	Very high	138 Å²	138	97.8 Å²	97.8	60%	0.6	49%	0.493	S	S	*	.	H	α-helix	trans	-60	-41.4	174.8	-74.4	172.1	-173.6	168	0	112.5	R37 D38 I39 L43 V44 S45	R37-K41 VanDerWaalsContact O-CG 3.31Å; R37-K41 WeakPolarHBondContact O-CG 3.43Å; R37-K41 PolarHBondContact O-N 3.15Å; D38-K41 IonicContact OD1-NZ 3.8Å; I39-K41 PolarHBondContact O-N 3.25Å; K41-L43 VanDerWaalsContact C-N 3.32Å; K41-V44 PolarHBondContact O-N 2.99Å; K41-S45 WeakPolarHBondContact O-CB 3.44Å; K41-S45 PolarHBondContact O-N 2.91Å
42	S	97.7	Very high	96.3	Very high	69 Å²	69	95.9 Å²	95.9	48%	0.483	49%	0.494	S	S	.	.	H	α-helix	trans	-64.4	-40	178.4	-60.7	0	0	0	0	111.1	D38 I39 E40 S45 M46	D38-S42 WeakPolarHBondContact O-CB 3.42Å; D38-S42 PolarHBondContact O-N 2.97Å; D38-S42 PolarHBondContact O-OG 3.02Å; I39-S42 WeakPolarHBondContact O-CB 3.31Å; I39-S42 PolarHBondContact O-N 3.07Å; I39-S42 VanDerWaalsContact O-N 3.15Å; E40-S42 VanDerWaalsContact C-N 3.31Å; E40-S42 PolarHBondContact O-N 3.05Å; S42-S45 PolarHBondContact O-N 3.22Å; S42-M46 WeakPolarHBondContact O-CG 3.22Å; S42-M46 PolarHBondContact O-N 2.98Å
43	L	97.4	Very high	95.5	Very high	88 Å²	88	95.5 Å²	95.5	46%	0.461	50%	0.499	S	S	.	.	H	α-helix	trans	-63.5	-50.5	176.4	-176.2	63.4	0	0	0	111.7	I39 E40 K41 S45 M46 E47	I39-L43 PolarHBondContact O-N 3.47Å; E40-L43 PolarHBondContact O-N 3.35Å; K41-L43 VanDerWaalsContact C-N 3.32Å; L43-S45 VanDerWaalsContact C-N 3.29Å; L43-S45 PolarHBondContact O-N 3.5Å; L43-M46 HydrophobicContact CD1-CE 4.02Å; L43-M46 WeakPolarHBondContact O-CB 3.44Å; L43-M46 PolarHBondContact O-N 3.4Å; L43-E47 WeakPolarHBondContact O-CG 3.35Å; L43-E47 PolarHBondContact O-N 3.35Å
44	V	96.8	Very high	94.4	Very high	72 Å²	72	98.2 Å²	98.2	44%	0.436	52%	0.517	S	S	.	.	H	α-helix	trans	-57.2	-44.9	177.1	172.9	0	0	0	0	110.8	E40 K41 M46 E47 E48	E40-V44 WeakPolarHBondContact O-CG2 3.37Å; E40-V44 PolarHBondContact O-N 3.47Å; K41-V44 PolarHBondContact O-N 2.99Å; V44-M46 VanDerWaalsContact C-N 3.3Å; V44-M46 PolarHBondContact O-N 3.06Å; V44-E47 PolarHBondContact O-N 2.92Å; V44-E48 HydrophobicContact CG1-CG 4.48Å; V44-E48 WeakPolarHBondContact O-CG 3.15Å; V44-E48 PolarHBondContact O-N 3.46Å
45	S	95.7	Very high	92.5	Very high	58 Å²	58	104.6 Å²	104.6	41%	0.406	56%	0.557	S	S	.	*	H	α-helix	trans	-62	-36.9	177.1	-174.2	0	0	0	0	112.6	K41 S42 L43 R49	K41-S45 WeakPolarHBondContact O-CB 3.44Å; K41-S45 PolarHBondContact O-N 2.91Å; S42-S45 PolarHBondContact O-N 3.22Å; L43-S45 VanDerWaalsContact C-N 3.29Å; L43-S45 PolarHBondContact O-N 3.5Å; S45-R49 WeakPolarHBondContact O-CG 3.39Å; S45-R49 PolarHBondContact O-N 3.16Å; S45-R49 VanDerWaalsContact O-N 3.11Å
46	M	95.6	Very high	92.2	Very high	93 Å²	93	106.8 Å²	106.8	46%	0.458	56%	0.564	S	S	.	*	H	α-helix	trans	-67.2	-44.6	174.1	-72.7	-174.6	-63.2	0	0	111.7	S42 L43 V44 E48 R49 F50	S42-M46 WeakPolarHBondContact O-CG 3.22Å; S42-M46 PolarHBondContact O-N 2.98Å; L43-M46 HydrophobicContact CD1-CE 4.02Å; L43-M46 WeakPolarHBondContact O-CB 3.44Å; L43-M46 PolarHBondContact O-N 3.4Å; V44-M46 VanDerWaalsContact C-N 3.3Å; V44-M46 PolarHBondContact O-N 3.06Å; M46-E48 VanDerWaalsContact C-N 3.32Å; M46-E48 PolarHBondContact O-N 2.69Å; M46-R49 PolarHBondContact O-N 3.48Å; M46-R49 VanDerWaalsContact O-N 3.16Å; M46-F50 HydrophobicContact CB-CD2 4.5Å; M46-F50 HydrophobicContact CB-CE2 4.48Å; M46-F50 WeakPolarHBondContact O-CD2 3.4Å; M46-F50 PolarHBondContact O-N 3.2Å
47	E	94.6	Very high	91.8	Very high	107 Å²	107	107.6 Å²	107.6	50%	0.5	57%	0.569	S	S	.	*	H	α-helix	trans	-59.3	-42.8	177.5	-70.5	177.8	156.6	0	0	111.7	L43 V44 R49 F50 S51	L43-E47 WeakPolarHBondContact O-CG 3.35Å; L43-E47 PolarHBondContact O-N 3.35Å; V44-E47 PolarHBondContact O-N 2.92Å; E47-R49 PolarHBondContact O-N 3.11Å; E47-F50 PolarHBondContact O-N 3.38Å; E47-S51 VanDerWaalsContact O-CB 3.28Å; E47-S51 WeakPolarHBondContact O-CB 3.34Å; E47-S51 PolarHBondContact O-N 2.86Å; E47-S51 PolarHBondContact O-OG 3.41Å
48	E	94.6	Very high	91.5	Very high	118 Å²	118	107 Å²	107	55%	0.551	58%	0.576	S	S	*	*	H	α-helix	trans	-61.8	-41.8	174.6	-73.5	177	170.2	0	0	111.9	V44 M46 S51 S52	V44-E48 HydrophobicContact CG1-CG 4.48Å; V44-E48 WeakPolarHBondContact O-CG 3.15Å; V44-E48 PolarHBondContact O-N 3.46Å; M46-E48 VanDerWaalsContact C-N 3.32Å; M46-E48 PolarHBondContact O-N 2.69Å; E48-S51 PolarHBondContact O-N 2.95Å; E48-S52 VanDerWaalsContact O-CB 3.26Å; E48-S52 WeakPolarHBondContact O-CB 3.28Å; E48-S52 PolarHBondContact O-N 2.75Å; E48-S52 PolarHBondContact O-OG 3.33Å
49	R	94.3	Very high	91.1	Very high	177 Å²	177	108 Å²	108	67%	0.668	58%	0.581	S	S	*	*	H	α-helix	trans	-66.8	-41.7	178.1	-73.2	175.7	72.2	173.4	3.9	112.2	S45 M46 E47 S52 S53	S45-R49 WeakPolarHBondContact O-CG 3.39Å; S45-R49 PolarHBondContact O-N 3.16Å; S45-R49 VanDerWaalsContact O-N 3.11Å; M46-R49 PolarHBondContact O-N 3.48Å; M46-R49 VanDerWaalsContact O-N 3.16Å; E47-R49 PolarHBondContact O-N 3.11Å; R49-S52 PolarHBondContact O-N 3.44Å; R49-S53 WeakPolarHBondContact O-CB 3.26Å; R49-S53 PolarHBondContact O-N 2.93Å; R49-S53 PolarHBondContact O-OG 2.87Å
50	F	92.2	Very high	90.6	Very high	138 Å²	138	108.1 Å²	108.1	61%	0.605	58%	0.583	S	S	*	*	H	α-helix	trans	-69	-39.5	175.9	-77.6	-64.8	0	0	0	112	M46 E47 S52 S53 N54	M46-F50 HydrophobicContact CB-CD2 4.5Å; M46-F50 HydrophobicContact CB-CE2 4.48Å; M46-F50 WeakPolarHBondContact O-CD2 3.4Å; M46-F50 PolarHBondContact O-N 3.2Å; E47-F50 PolarHBondContact O-N 3.38Å; F50-S52 VanDerWaalsContact C-N 3.3Å; F50-S52 PolarHBondContact O-N 3.25Å; F50-S53 PolarHBondContact O-N 2.71Å; F50-N54 PolarHBondContact O-N 3.46Å; F50-N54 PolarHBondContact O-ND2 3.47Å
51	S	91.1	Very high	90.1	Very high	76 Å²	76	107.7 Å²	107.7	53%	0.531	59%	0.587	S	S	.	*	H	α-helix	trans	-64.5	-36.9	175.2	-58.1	0	0	0	0	111.8	E47 E48	E47-S51 VanDerWaalsContact O-CB 3.28Å; E47-S51 WeakPolarHBondContact O-CB 3.34Å; E47-S51 PolarHBondContact O-N 2.86Å; E47-S51 PolarHBondContact O-OG 3.41Å; E48-S51 PolarHBondContact O-N 2.95Å
52	S	88.4	Confident	89.6	Confident	87 Å²	87	105.6 Å²	105.6	61%	0.608	59%	0.586	S	S	*	*	H	α-helix	trans	-78.7	-22.8	177.7	-54.9	0	0	0	0	113.7	E48 R49 F50	E48-S52 VanDerWaalsContact O-CB 3.26Å; E48-S52 WeakPolarHBondContact O-CB 3.28Å; E48-S52 PolarHBondContact O-N 2.75Å; E48-S52 PolarHBondContact O-OG 3.33Å; R49-S52 PolarHBondContact O-N 3.44Å; F50-S52 VanDerWaalsContact C-N 3.3Å; F50-S52 PolarHBondContact O-N 3.25Å
53	S	82.1	Confident	88.9	Confident	90 Å²	90	108.4 Å²	108.4	63%	0.629	59%	0.594	S	S	*	*	H	α-helix	trans	-84.6	-20.1	179	-58.2	0	0	0	0	113.1	R49 F50	R49-S53 WeakPolarHBondContact O-CB 3.26Å; R49-S53 PolarHBondContact O-N 2.93Å; R49-S53 PolarHBondContact O-OG 2.87Å; F50-S53 PolarHBondContact O-N 2.71Å
54	N	75.5	Confident	88.2	Confident	137 Å²	137	110.1 Å²	110.1	73%	0.733	61%	0.605	S	S	*	*			trans	-97	-1.1	-178.6	-69.8	-19.6	0	0	0	113.8	F50	F50-N54 PolarHBondContact O-N 3.46Å; F50-N54 PolarHBondContact O-ND2 3.47Å
55	C	57.9	Low	87.5	Confident	168 Å²	168	113.5 Å²	113.5	100%	1.135	62%	0.62	S	S	*	*			trans	-107.9	0	174.9	-73.3	0	0	0	0	110

Retrieved 55 of 55 residues in 92.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).