A0A5K4F5J3_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F5J3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 62 aa.

						>A0A5K4F5J3_SCHMA|A0A5K4F5J3
MEPQHQVEGVLAVPVRALNVLGVVDVVDVVVETVVEDVVVNGEPTTKTEKPREMVKSRSKRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.4	Very low	46.3	Very low	244 Å²	244	129.2 Å²	129.2	100%	1.202	68%	0.675	S	S	*	*				0	114.8	0	-75.2	-179.2	-176.2	0	0	106.6
2	E	43.2	Very low	46.8	Very low	160 Å²	160	123.5 Å²	123.5	75%	0.748	66%	0.661	S	S	*	*			trans	-79.7	133.3	169.3	-90.6	173.4	99.9	0	0	109	Q4	E2-Q4 PolarHBondContact OE1-NE2 3.3Å; E2-Q4 HydrophobicContact CB-CG 4.46Å
3	P	43.4	Very low	47.6	Very low	126 Å²	126	119.1 Å²	119.1	82%	0.818	64%	0.641	S	S	*	*			trans	-89.5	108.4	171.3	33.2	-25.5	0	0	0	108.4
4	Q	42.9	Very low	48.1	Very low	121 Å²	121	116.8 Å²	116.8	57%	0.565	64%	0.636	S	S	*	*			trans	-148.2	117.3	175.5	-59.4	-179.4	3.1	0	0	106.8	E2	E2-Q4 PolarHBondContact OE1-NE2 3.3Å; E2-Q4 HydrophobicContact CB-CG 4.46Å
5	H	47.8	Very low	48.8	Very low	148 Å²	148	113.7 Å²	113.7	69%	0.685	62%	0.622	S	S	*	*			cis	-154.8	136.9	48.2	-74.7	74.3	0	0	0	110.3
6	Q	45.7	Very low	49.4	Very low	141 Å²	141	119.6 Å²	119.6	66%	0.659	63%	0.632	S	S	*	*			trans	-89.8	106.3	164.7	-161.6	172.7	35	0	0	107.2	E8	Q6-E8 PolarHBondContact O-N 2.97Å
7	V	48.3	Very low	49.9	Very low	111 Å²	111	115 Å²	115	67%	0.673	62%	0.615	S	S	*	*			trans	-83.6	95.8	171.5	-174.3	0	0	0	0	107.3	G9	V7-G9 PolarHBondContact O-N 3.43Å
8	E	47.4	Very low	50.1	Low	144 Å²	144	116.5 Å²	116.5	67%	0.673	62%	0.622	S	S	*	*			trans	-71	95.1	171.5	-165.9	176.6	-179.2	0	0	108.6	Q6	Q6-E8 PolarHBondContact O-N 2.97Å
9	G	48.4	Very low	50.4	Low	31 Å²	31	114.3 Å²	114.3	32%	0.32	61%	0.61	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.2	109.2	173.5	0	0	0	0	0	110.1	V7	V7-G9 PolarHBondContact O-N 3.43Å
10	V	50.6	Low	51	Low	81 Å²	81	115.8 Å²	115.8	49%	0.491	62%	0.624	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.8	105.7	171.4	176.2	0	0	0	0	108.8	V30	V10-V30 HydrophobicContact CG1-CG1 3.56Å
11	L	47.7	Very low	51.6	Low	114 Å²	114	117.2 Å²	117.2	60%	0.597	63%	0.63	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-89.5	105.7	168.5	-163.9	81	0	0	0	108.4	V13 V31	L11-V13 HydrophobicContact CD2-CG2 3.74Å; L11-V13 HydrophobicContact CG-CG2 3.95Å; L11-V31 HydrophobicContact CB-CB 4.47Å; L11-V31 PolarHBondContact N-O 2.97Å; L11-V31 PolarHBondContact O-N 3.45Å
12	A	52.1	Low	52.2	Low	61 Å²	61	108.3 Å²	108.3	50%	0.504	60%	0.601	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.4	106.6	172.5	0	0	0	0	0	109.6	V29	A12-V29 WeakPolarHBondContact CA-O 3.35Å
13	V	56.6	Low	53	Low	66 Å²	66	104.2 Å²	104.2	40%	0.4	59%	0.586	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-105.1	114.7	176.7	-176.2	0	0	0	0	108.6	L11 V15 V29	L11-V13 HydrophobicContact CD2-CG2 3.74Å; L11-V13 HydrophobicContact CG-CG2 3.95Å; V13-V15 PolarHBondContact O-N 2.87Å; V13-V29 VanDerWaalsContact O-N 3.09Å; V13-V29 PolarHBondContact O-N 2.88Å; V13-V29 PolarHBondContact N-O 3.38Å
14	P	54.6	Low	53.7	Low	87 Å²	87	102 Å²	102	57%	0.565	57%	0.571	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-74.2	112.4	176.6	28.1	-31.5	0	0	0	109.6	V26	P14-V26 HydrophobicContact CB-CG1 4.2Å
15	V	58.8	Low	54.5	Low	70 Å²	70	100.2 Å²	100.2	42%	0.424	57%	0.565	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-98.4	123.9	175.2	-177.5	0	0	0	0	108.4	V13 A17 V27 V29	V13-V15 PolarHBondContact O-N 2.87Å; V15-A17 PolarHBondContact O-N 2.96Å; V15-V27 PolarHBondContact N-O 3.23Å; V15-V27 PolarHBondContact O-N 3.09Å; V15-V29 HydrophobicContact CB-CG2 4.39Å; V15-V29 HydrophobicContact CG2-CG2 3.75Å
16	R	58.5	Low	55	Low	208 Å²	208	97.1 Å²	97.1	79%	0.785	56%	0.556	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-83.2	108.8	169.8	-66.9	-175.4	-179.2	-169.8	0.4	108.3	V24	R16-V24 HydrophobicContact CB-CG1 4.12Å; R16-V24 HydrophobicContact CG-CG1 4.33Å
17	A	58.4	Low	55.6	Low	42 Å²	42	91.8 Å²	91.8	35%	0.347	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	122.9	173.5	0	0	0	0	0	109.4	V15 N19 D25 V27	V15-A17 PolarHBondContact O-N 2.96Å; A17-N19 PolarHBondContact O-N 3.4Å; A17-D25 PolarHBondContact O-N 2.92Å; A17-D25 PolarHBondContact N-O 2.98Å; A17-V27 HydrophobicContact CB-CG2 4.41Å
18	L	52.5	Low	56	Low	142 Å²	142	89.8 Å²	89.8	74%	0.743	52%	0.519	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-79	113.4	165.2	-101.6	122.5	0	0	0	108	V24	L18-V24 HydrophobicContact CG-CG2 4.41Å
19	N	57.2	Low	56.4	Low	74 Å²	74	83.7 Å²	83.7	40%	0.396	49%	0.491	S	S	.	.			trans	-75.9	152	167.6	-165.2	-7.6	0	0	0	109.2	A17 L21 G22 V23	A17-N19 PolarHBondContact O-N 3.4Å; N19-L21 PolarHBondContact O-N 3.47Å; N19-G22 PolarHBondContact O-N 2.96Å; N19-V23 PolarHBondContact N-O 3.07Å
20	V	61.1	Low	56.8	Low	145 Å²	145	83.2 Å²	83.2	88%	0.879	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.3	-13.5	-179.4	-80.3	0	0	0	0	114.2
21	L	64.3	Low	57.1	Low	146 Å²	146	80.9 Å²	80.9	76%	0.764	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.7	7.8	174	-64	173.6	0	0	0	114.3	N19 V23	N19-L21 PolarHBondContact O-N 3.47Å; L21-V23 VanDerWaalsContact C-N 3.29Å; L21-V23 PolarHBondContact O-N 2.87Å
22	G	56.6	Low	57.5	Low	56 Å²	56	78.1 Å²	78.1	58%	0.577	45%	0.452	S	S	*	.	S	Bend	trans	78.6	7.7	179.8	0	0	0	0	0	114.9	N19	N19-G22 PolarHBondContact O-N 2.96Å
23	V	59.7	Low	57.6	Low	74 Å²	74	77.8 Å²	77.8	45%	0.448	44%	0.444	S	S	.	.			trans	-82.5	123.6	174.6	-176.5	0	0	0	0	108.7	N19 L21 D25	N19-V23 PolarHBondContact N-O 3.07Å; L21-V23 VanDerWaalsContact C-N 3.29Å; L21-V23 PolarHBondContact O-N 2.87Å; V23-D25 PolarHBondContact O-N 3.36Å
24	V	58.5	Low	57.7	Low	80 Å²	80	77 Å²	77	49%	0.485	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	101.9	169.7	-179.3	0	0	0	0	107.4	R16 L18	R16-V24 HydrophobicContact CB-CG1 4.12Å; R16-V24 HydrophobicContact CG-CG1 4.33Å; L18-V24 HydrophobicContact CG-CG2 4.41Å
25	D	60	Low	57.9	Low	83 Å²	83	75.3 Å²	75.3	44%	0.444	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.2	128.5	169.6	-82.2	-37.9	0	0	0	109	A17 V23	A17-D25 PolarHBondContact O-N 2.92Å; A17-D25 PolarHBondContact N-O 2.98Å; V23-D25 PolarHBondContact O-N 3.36Å
26	V	58.3	Low	57.9	Low	84 Å²	84	77 Å²	77	51%	0.509	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.9	113.6	169.1	-177.2	0	0	0	0	106.9	P14	P14-V26 HydrophobicContact CB-CG1 4.2Å
27	V	57.3	Low	58	Low	29 Å²	29	72.5 Å²	72.5	18%	0.176	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.2	120	175.3	-173.7	0	0	0	0	107.9	V15 A17 V29 V55	V15-V27 PolarHBondContact N-O 3.23Å; V15-V27 PolarHBondContact O-N 3.09Å; A17-V27 HydrophobicContact CB-CG2 4.41Å; V27-V29 PolarHBondContact O-N 2.85Å; V27-V55 HydrophobicContact CG1-CG1 3.74Å
28	D	58.2	Low	58.2	Low	68 Å²	68	72.5 Å²	72.5	36%	0.364	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	109	170.6	-65.2	-39.9	0	0	0	108
29	V	55	Low	58.7	Low	17 Å²	17	70.7 Å²	70.7	10%	0.103	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.5	118.7	172.7	-177.2	0	0	0	0	107.6	A12 V13 V15 V27 V31 E53	A12-V29 WeakPolarHBondContact CA-O 3.35Å; V13-V29 VanDerWaalsContact O-N 3.09Å; V13-V29 PolarHBondContact O-N 2.88Å; V13-V29 PolarHBondContact N-O 3.38Å; V15-V29 HydrophobicContact CB-CG2 4.39Å; V15-V29 HydrophobicContact CG2-CG2 3.75Å; V27-V29 PolarHBondContact O-N 2.85Å; V29-V31 HydrophobicContact CG1-CG2 4.12Å; V29-E53 HydrophobicContact CG1-CG 4.04Å
30	V	57	Low	59.1	Low	21 Å²	21	70 Å²	70	13%	0.127	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	113.3	176.1	176.1	0	0	0	0	106.6	V10 E32 M54	V10-V30 HydrophobicContact CG1-CG1 3.56Å; V30-E32 HydrophobicContact CG1-CG 4.15Å; V30-M54 PolarHBondContact N-O 3.47Å; V30-M54 PolarHBondContact O-N 3.44Å; V30-M54 VanDerWaalsContact O-N 3.15Å; V30-M54 VanDerWaalsContact O-O 3.13Å
31	V	56.1	Low	59.6	Low	32 Å²	32	71 Å²	71	19%	0.194	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	113.1	172.8	-174.6	0	0	0	0	107.9	L11 V29 T33 P51	L11-V31 HydrophobicContact CB-CB 4.47Å; L11-V31 PolarHBondContact N-O 2.97Å; L11-V31 PolarHBondContact O-N 3.45Å; V29-V31 HydrophobicContact CG1-CG2 4.12Å; V31-T33 HydrophobicContact CG1-CG2 4.38Å; V31-P51 HydrophobicContact CG1-CB 3.27Å; V31-P51 HydrophobicContact CG1-CG 4.41Å
32	E	57.4	Low	60	Low	56 Å²	56	67.2 Å²	67.2	26%	0.262	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.9	116.2	172.1	-70.5	171.2	-163.1	0	0	107.6	V30 R52 K56	V30-E32 HydrophobicContact CG1-CG 4.15Å; E32-R52 PolarHBondContact O-N 3.24Å; E32-K56 IonicContact OE1-NZ 3.92Å
33	T	54	Low	60.7	Low	54 Å²	54	71.4 Å²	71.4	33%	0.331	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	120	170.5	50.9	0	0	0	0	109.2	V31 P51	V31-T33 HydrophobicContact CG1-CG2 4.38Å; T33-P51 HydrophobicContact CG2-CB 3.79Å; T33-P51 HydrophobicContact CG2-CG 4.48Å
34	V	58.5	Low	61	Low	50 Å²	50	73.4 Å²	73.4	30%	0.303	43%	0.426	S	S	.	.	P	Polyproline II helix	trans	-90.8	118.6	172.6	-176	0	0	0	0	108.1	E36 E49	V34-E36 HydrophobicContact CG1-CG 4.2Å; V34-E49 HydrophobicContact CB-CB 4.31Å; V34-E49 PolarHBondContact O-N 2.91Å
35	V	58.8	Low	61.2	Low	50 Å²	50	72.3 Å²	72.3	30%	0.303	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	116.5	171.5	-175.8	0	0	0	0	107.1	T46	V35-T46 HydrophobicContact CG1-CG2 3.32Å
36	E	57.6	Low	61.4	Low	105 Å²	105	72.3 Å²	72.3	49%	0.491	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	116.1	173	-75	-169.2	150.9	0	0	109.2	V34 V38 K47	V34-E36 HydrophobicContact CG1-CG 4.2Å; E36-V38 HydrophobicContact CB-CG2 4.17Å; E36-V38 PolarHBondContact O-N 3.01Å; E36-K47 PolarHBondContact N-O 3.12Å; E36-K47 PolarHBondContact O-N 3.22Å
37	D	61.5	Low	61.7	Low	114 Å²	114	73.8 Å²	73.8	61%	0.61	42%	0.422	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.9	114.7	166.7	-73.1	-34.9	0	0	0	109.3	T46	D37-T46 VanDerWaalsContact OD1-CB 3.25Å; D37-T46 PolarHBondContact OD1-OG1 3.47Å; D37-T46 WeakPolarHBondContact OD1-CG2 3.26Å; D37-T46 VanDerWaalsContact OD1-CG2 3.26Å; D37-T46 WeakPolarHBondContact OD1-CB 3.34Å; D37-T46 WeakPolarHBondContact OD1-CA 3.25Å
38	V	63.6	Low	62	Low	43 Å²	43	77.2 Å²	77.2	26%	0.261	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	125.7	-178.1	-172.7	0	0	0	0	109	E36 V40 T45 K47	E36-V38 HydrophobicContact CB-CG2 4.17Å; E36-V38 PolarHBondContact O-N 3.01Å; V38-V40 HydrophobicContact CB-CG2 4.47Å; V38-V40 HydrophobicContact CG1-CG2 3.88Å; V38-V40 PolarHBondContact O-N 3.05Å; V38-T45 PolarHBondContact O-N 3.24Å; V38-T45 WeakPolarHBondContact O-CB 3.41Å; V38-T45 VanDerWaalsContact O-CB 3.3Å; V38-T45 CarbonylContact O-C 3.48Å; V38-T45 PolarHBondContact N-O 3.24Å; V38-T45 CarbonylContact C-O 3.54Å; V38-T45 WeakPolarHBondContact O-CA 3.46Å; V38-K47 HydrophobicContact CG2-CD 4.07Å; V38-K47 HydrophobicContact CG2-CG 4.4Å
39	V	63	Low	62.1	Low	103 Å²	103	78.6 Å²	78.6	62%	0.624	45%	0.447	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.9	113.6	171.6	-177.8	0	0	0	0	108.5	E43	V39-E43 WeakPolarHBondContact CA-O 3.3Å
40	V	64.4	Low	62.3	Low	61 Å²	61	86.5 Å²	86.5	37%	0.37	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	122.1	177.1	-174.5	0	0	0	0	107.9	V38 G42 E43	V38-V40 HydrophobicContact CB-CG2 4.47Å; V38-V40 HydrophobicContact CG1-CG2 3.88Å; V38-V40 PolarHBondContact O-N 3.05Å; V40-G42 PolarHBondContact O-N 3.15Å; V40-E43 PolarHBondContact N-O 2.8Å; V40-E43 PolarHBondContact O-N 3.19Å; V40-E43 VanDerWaalsContact O-N 3.1Å
41	N	72.3	Confident	62.4	Low	165 Å²	165	89 Å²	89	88%	0.882	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.6	27.6	-179	-60.8	-21.8	0	0	0	115.5	E43	N41-E43 VanDerWaalsContact C-N 3.32Å
42	G	71.8	Confident	62.6	Low	66 Å²	66	96 Å²	96	68%	0.68	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	85.9	-1.7	-179	0	0	0	0	0	114.6	V40	V40-G42 PolarHBondContact O-N 3.15Å
43	E	71.1	Confident	62.4	Low	145 Å²	145	100.2 Å²	100.2	68%	0.678	54%	0.54	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.7	133.4	171.1	-69.1	-163.1	114.4	0	0	111.1	V39 V40 N41 T45	V39-E43 WeakPolarHBondContact CA-O 3.3Å; V40-E43 PolarHBondContact N-O 2.8Å; V40-E43 PolarHBondContact O-N 3.19Å; V40-E43 VanDerWaalsContact O-N 3.1Å; N41-E43 VanDerWaalsContact C-N 3.32Å; E43-T45 PolarHBondContact O-N 3.2Å
44	P	66.3	Low	62.4	Low	116 Å²	116	100.7 Å²	100.7	75%	0.753	54%	0.539	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.5	120.1	173.4	28.5	-32.1	0	0	0	109.5
45	T	62.7	Low	62.2	Low	57 Å²	57	102.5 Å²	102.5	35%	0.35	55%	0.55	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-122.1	119.2	178.6	-53.7	0	0	0	0	109.8	V38 E43	V38-T45 PolarHBondContact O-N 3.24Å; V38-T45 WeakPolarHBondContact O-CB 3.41Å; V38-T45 VanDerWaalsContact O-CB 3.3Å; V38-T45 CarbonylContact O-C 3.48Å; V38-T45 PolarHBondContact N-O 3.24Å; V38-T45 CarbonylContact C-O 3.54Å; V38-T45 WeakPolarHBondContact O-CA 3.46Å; E43-T45 PolarHBondContact O-N 3.2Å
46	T	65.4	Low	62.2	Low	83 Å²	83	105.5 Å²	105.5	51%	0.509	56%	0.559	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-82.3	120.8	173.2	-54.1	0	0	0	0	110.1	V35 D37	V35-T46 HydrophobicContact CG1-CG2 3.32Å; D37-T46 VanDerWaalsContact OD1-CB 3.25Å; D37-T46 PolarHBondContact OD1-OG1 3.47Å; D37-T46 WeakPolarHBondContact OD1-CG2 3.26Å; D37-T46 VanDerWaalsContact OD1-CG2 3.26Å; D37-T46 WeakPolarHBondContact OD1-CB 3.34Å; D37-T46 WeakPolarHBondContact OD1-CA 3.25Å
47	K	63.9	Low	62	Low	115 Å²	115	105 Å²	105	50%	0.5	57%	0.567	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.7	113.1	168.4	-71.1	-175.2	-178.9	176.4	0	108.8	E36 V38	E36-K47 PolarHBondContact N-O 3.12Å; E36-K47 PolarHBondContact O-N 3.22Å; V38-K47 HydrophobicContact CG2-CD 4.07Å; V38-K47 HydrophobicContact CG2-CG 4.4Å
48	T	62.6	Low	61.8	Low	100 Å²	100	108.3 Å²	108.3	61%	0.613	57%	0.571	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-87.1	111.6	169.6	-48.6	0	0	0	0	108.4
49	E	61.7	Low	61.1	Low	97 Å²	97	110.7 Å²	110.7	45%	0.453	59%	0.59	S	S	.	*	P	Polyproline II helix	trans	-71.3	142.2	166.8	-165.6	175.9	145.7	0	0	108.4	V34	V34-E49 HydrophobicContact CB-CB 4.31Å; V34-E49 PolarHBondContact O-N 2.91Å
50	K	58.8	Low	60.8	Low	183 Å²	183	114.3 Å²	114.3	80%	0.796	60%	0.597	S	S	*	*	P	Polyproline II helix	trans	-57.2	139.1	179.2	-78	-177.9	177.4	178.6	0	109.6	R52	K50-R52 PolarHBondContact O-N 2.64Å
51	P	59.3	Low	60	Low	74 Å²	74	122.4 Å²	122.4	48%	0.481	62%	0.621	S	S	.	*	P	Polyproline II helix	trans	-51.9	127.7	176.1	16.8	-28.2	0	0	0	110.4	V31 T33 E53	V31-P51 HydrophobicContact CG1-CB 3.27Å; V31-P51 HydrophobicContact CG1-CG 4.41Å; T33-P51 HydrophobicContact CG2-CB 3.79Å; T33-P51 HydrophobicContact CG2-CG 4.48Å; P51-E53 PolarHBondContact O-N 2.99Å
52	R	59.7	Low	58.9	Low	178 Å²	178	128 Å²	128	67%	0.672	64%	0.637	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-84	111.3	166.5	-79.9	-178.3	155.5	-179.6	-3.4	107.2	E32 K50 M54	E32-R52 PolarHBondContact O-N 3.24Å; K50-R52 PolarHBondContact O-N 2.64Å; R52-M54 PolarHBondContact O-N 2.8Å
53	E	53.6	Low	58.3	Low	145 Å²	145	131.1 Å²	131.1	68%	0.678	64%	0.635	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-70.4	111.2	174.6	-168.4	177.9	165.3	0	0	109	V29 P51 V55	V29-E53 HydrophobicContact CG1-CG 4.04Å; P51-E53 PolarHBondContact O-N 2.99Å; E53-V55 HydrophobicContact CG-CG2 4.49Å
54	M	54.9	Low	57.6	Low	65 Å²	65	130.4 Å²	130.4	32%	0.32	63%	0.633	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.8	101.3	175.5	-82	178.3	39.6	0	0	109.8	V30 R52 K56	V30-M54 PolarHBondContact N-O 3.47Å; V30-M54 PolarHBondContact O-N 3.44Å; V30-M54 VanDerWaalsContact O-N 3.15Å; V30-M54 VanDerWaalsContact O-O 3.13Å; R52-M54 PolarHBondContact O-N 2.8Å; M54-K56 PolarHBondContact O-N 2.78Å; M54-K56 VanDerWaalsContact O-N 3.12Å
55	V	53.2	Low	57.1	Low	88 Å²	88	131.2 Å²	131.2	53%	0.533	63%	0.626	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-78.7	95.3	172.6	-176	0	0	0	0	108.8	V27 E53 S57	V27-V55 HydrophobicContact CG1-CG1 3.74Å; E53-V55 HydrophobicContact CG-CG2 4.49Å; V55-S57 PolarHBondContact O-N 3.29Å
56	K	58	Low	56.8	Low	113 Å²	113	135.5 Å²	135.5	49%	0.491	64%	0.643	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.4	90.8	168.7	-70.3	-179.1	-174	161.4	0	108.5	E32 M54 R58	E32-K56 IonicContact OE1-NZ 3.92Å; M54-K56 PolarHBondContact O-N 2.78Å; M54-K56 VanDerWaalsContact O-N 3.12Å; K56-R58 PolarHBondContact O-N 2.82Å; K56-R58 VanDerWaalsContact O-N 3.07Å
57	S	54.4	Low	56.2	Low	94 Å²	94	138.8 Å²	138.8	66%	0.657	65%	0.651	S	S	*	*			trans	-63.2	108.4	168.1	168.9	0	0	0	0	109.5	V55 S59	V55-S57 PolarHBondContact O-N 3.29Å; S57-S59 PolarHBondContact O-N 3.43Å
58	R	57.6	Low	55.7	Low	184 Å²	184	140.4 Å²	140.4	69%	0.694	66%	0.661	S	S	*	*			trans	-92.9	91.4	170.5	-166.8	176.7	-176.1	179.4	4.2	108.6	K56 K60	K56-R58 PolarHBondContact O-N 2.82Å; K56-R58 VanDerWaalsContact O-N 3.07Å; R58-K60 PolarHBondContact O-N 3.01Å
59	S	49.3	Very low	55.2	Low	93 Å²	93	143.3 Å²	143.3	65%	0.65	66%	0.664	S	S	*	*			trans	-62.1	105.5	171.3	-164.4	0	0	0	0	109.3	S57 R61	S57-S59 PolarHBondContact O-N 3.43Å; S59-R61 VanDerWaalsContact C-N 3.26Å; S59-R61 PolarHBondContact O-N 3.1Å
60	K	56.9	Low	54.7	Low	179 Å²	179	146.8 Å²	146.8	78%	0.778	68%	0.681	S	S	*	*			trans	-72.9	84.8	169.4	-73.3	-95.2	-173	167	0	107.6	R58 K62	R58-K60 PolarHBondContact O-N 3.01Å; K60-K62 PolarHBondContact O-N 3.18Å
61	R	46.4	Very low	54.4	Low	231 Å²	231	143.8 Å²	143.8	87%	0.872	67%	0.671	S	S	*	*			trans	-75.3	106.2	161.9	-78.5	-173.2	-174.2	165.6	1.8	108.5	S59	S59-R61 VanDerWaalsContact C-N 3.26Å; S59-R61 PolarHBondContact O-N 3.1Å
62	K	49.5	Very low	54	Low	282 Å²	282	150.2 Å²	150.2	100%	1.226	69%	0.688	S	S	*	*			trans	-174.3	0	131	-97.3	-167	-173.9	-168.6	0	109.5	K60	K60-K62 PolarHBondContact O-N 3.18Å

Retrieved 62 of 62 residues in 17.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).