A0A5K4F5N3_SCHMA Loading...

LITAF domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F5N3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 105 aa.

						>A0A5K4F5N3_SCHMA|A0A5K4F5N3
MQQSQTYNSQLPPSYPMVITDQPMSQVTFSDMPVTLHCPSCGLNTLTSLEYKSGLLTYLACCGICLVGGVLGCCLIPFCVNSCKDVKHVCPHCQRAVGTYHRLGN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.8	Very low	40.5	Very low	243 Å²	243	155.3 Å²	155.3	100%	1.197	79%	0.79	S	S	*	*				0	83.3	0	43.6	-157	170.1	0	0	109.1
2	Q	47.6	Very low	41.5	Very low	179 Å²	179	150.3 Å²	150.3	84%	0.836	78%	0.776	S	S	*	*			trans	-145.1	99	180	-152.1	140.9	68.7	0	0	110
3	Q	40.3	Very low	41.7	Very low	166 Å²	166	147 Å²	147	78%	0.776	77%	0.77	S	S	*	*			trans	50.6	98.6	146.8	-74	162.6	59.1	0	0	118.8	Q5	Q3-Q5 PolarHBondContact O-N 2.94Å
4	S	35.1	Very low	41.9	Very low	104 Å²	104	145.6 Å²	145.6	73%	0.727	78%	0.778	S	S	*	*			trans	-37	115.2	143.9	45.9	0	0	0	0	112.6
5	Q	43.8	Very low	42.2	Very low	194 Å²	194	146.4 Å²	146.4	91%	0.907	77%	0.768	S	S	*	*			trans	-90.5	90	152.2	-72.3	-163.7	92.1	0	0	107.3	Q3 Y7	Q3-Q5 PolarHBondContact O-N 2.94Å; Q5-Y7 VanDerWaalsContact C-N 3.27Å; Q5-Y7 PolarHBondContact O-N 2.64Å
6	T	38	Very low	42.4	Very low	125 Å²	125	144.1 Å²	144.1	77%	0.767	76%	0.764	S	S	*	*			trans	-62	93.3	159.7	24.5	0	0	0	0	107.3	N8	T6-N8 PolarHBondContact O-N 2.75Å
7	Y	40	Very low	42.7	Very low	186 Å²	186	145.2 Å²	145.2	73%	0.729	77%	0.766	S	S	*	*			trans	-66.1	95.1	163.7	-171	-99.6	0	0	0	106.2	Q5 S9	Q5-Y7 VanDerWaalsContact C-N 3.27Å; Q5-Y7 PolarHBondContact O-N 2.64Å; Y7-S9 VanDerWaalsContact C-N 3.31Å; Y7-S9 PolarHBondContact O-N 2.74Å
8	N	36.9	Very low	43.3	Very low	115 Å²	115	143.1 Å²	143.1	62%	0.615	76%	0.76	S	S	*	*			trans	-64.2	98.3	173.7	-166.5	-9.6	0	0	0	106.3	T6 Q10	T6-N8 PolarHBondContact O-N 2.75Å; N8-Q10 PolarHBondContact O-N 3.11Å
9	S	40	Very low	43.7	Very low	86 Å²	86	144.2 Å²	144.2	60%	0.601	76%	0.764	S	S	*	*			trans	-64.8	71.5	166.1	-49.2	0	0	0	0	107.9	Y7 L11	Y7-S9 VanDerWaalsContact C-N 3.31Å; Y7-S9 PolarHBondContact O-N 2.74Å; S9-L11 VanDerWaalsContact C-N 3.26Å; S9-L11 PolarHBondContact O-N 2.81Å
10	Q	36.1	Very low	43.9	Very low	158 Å²	158	141.2 Å²	141.2	74%	0.738	75%	0.752	S	S	*	*			trans	-64.3	99.4	163.1	-75.3	178.4	-105	0	0	105.4	N8	N8-Q10 PolarHBondContact O-N 3.11Å
11	L	44.3	Very low	44.1	Very low	152 Å²	152	141.8 Å²	141.8	80%	0.796	76%	0.755	S	S	*	*			trans	-44.1	129.9	164.4	-100.5	82.9	0	0	0	107.1	S9	S9-L11 VanDerWaalsContact C-N 3.26Å; S9-L11 PolarHBondContact O-N 2.81Å
12	P	51.8	Low	44.3	Very low	95 Å²	95	136.5 Å²	136.5	62%	0.617	73%	0.727	S	S	*	*			trans	-55	140.1	171.1	24	-31.6	0	0	0	108.2	S14	P12-S14 PolarHBondContact O-N 3.21Å
13	P	45	Very low	44.7	Very low	108 Å²	108	133.1 Å²	133.1	70%	0.701	72%	0.721	S	S	*	*			trans	-54.1	135.9	175	23.6	-32.6	0	0	0	108.3	Y15	P13-Y15 WeakPolarHBondContact O-CD1 3.35Å; P13-Y15 PolarHBondContact O-N 3.37Å
14	S	43.9	Very low	45.3	Very low	127 Å²	127	133.8 Å²	133.8	89%	0.888	73%	0.726	S	S	*	*			trans	-65.3	81.6	174.9	49.5	0	0	0	0	109.5	P12	P12-S14 PolarHBondContact O-N 3.21Å
15	Y	46.7	Very low	46.3	Very low	158 Å²	158	132.9 Å²	132.9	62%	0.62	72%	0.72	S	S	*	*			trans	-72.7	142.7	161.3	50.7	-87.7	0	0	0	107.7	P13 M17	P13-Y15 WeakPolarHBondContact O-CD1 3.35Å; P13-Y15 PolarHBondContact O-N 3.37Å; Y15-M17 PolarHBondContact O-N 3.08Å
16	P	45.1	Very low	47.4	Very low	110 Å²	110	132.4 Å²	132.4	71%	0.714	72%	0.718	S	S	*	*			trans	-53.8	121.7	168.8	23.9	-31.9	0	0	0	107.1	V18	P16-V18 PolarHBondContact O-N 2.81Å
17	M	47.8	Very low	49.1	Very low	162 Å²	162	129.4 Å²	129.4	80%	0.798	70%	0.7	S	S	*	*			trans	-65.4	95.1	171.9	-71.2	-141.4	-65.1	0	0	106.9	Y15 I19	Y15-M17 PolarHBondContact O-N 3.08Å; M17-I19 PolarHBondContact O-N 3.17Å; M17-I19 VanDerWaalsContact O-N 3.08Å
18	V	52.4	Low	51	Low	108 Å²	108	125.7 Å²	125.7	66%	0.655	70%	0.696	S	S	*	*			trans	-64.8	107.9	161.8	177.4	0	0	0	0	104.8	P16 T20	P16-V18 PolarHBondContact O-N 2.81Å; V18-T20 HydrophobicContact CG1-CG2 4.2Å; V18-T20 PolarHBondContact O-N 3.44Å; V18-T20 PolarHBondContact O-OG1 2.8Å
19	I	51.3	Low	53.2	Low	164 Å²	164	122.7 Å²	122.7	84%	0.841	68%	0.678	S	S	*	*			trans	-64.4	82.7	167.6	-54	170.4	0	0	0	105.6	M17	M17-I19 PolarHBondContact O-N 3.17Å; M17-I19 VanDerWaalsContact O-N 3.08Å
20	T	47.4	Very low	55.3	Low	83 Å²	83	120.6 Å²	120.6	51%	0.509	66%	0.663	S	S	.	*			trans	-85.4	116.4	160.5	19.1	0	0	0	0	104.2	V18 Q22	V18-T20 HydrophobicContact CG1-CG2 4.2Å; V18-T20 PolarHBondContact O-N 3.44Å; V18-T20 PolarHBondContact O-OG1 2.8Å; T20-Q22 PolarHBondContact O-N 3.2Å; T20-Q22 PolarHBondContact OG1-NE2 3.45Å
21	D	49.7	Very low	57.5	Low	155 Å²	155	116.2 Å²	116.2	83%	0.829	65%	0.645	S	S	*	*			trans	-59.8	79.4	158.7	-168.1	-102	0	0	0	106.2	P23	D21-P23 VanDerWaalsContact O-CD 3.29Å; D21-P23 WeakPolarHBondContact O-CD 3.4Å
22	Q	47.8	Very low	59.4	Low	131 Å²	131	115 Å²	115	61%	0.612	64%	0.636	S	S	*	*			trans	-76	112.4	175.6	-59.3	-163.9	-0.8	0	0	104.4	T20 M24	T20-Q22 PolarHBondContact O-N 3.2Å; T20-Q22 PolarHBondContact OG1-NE2 3.45Å; Q22-M24 PolarHBondContact O-N 3.44Å
23	P	55	Low	61	Low	109 Å²	109	113.4 Å²	113.4	71%	0.708	63%	0.626	S	S	*	*			trans	-54.9	116.5	178.7	23.4	-32.3	0	0	0	105.8	D21 S25	D21-P23 VanDerWaalsContact O-CD 3.29Å; D21-P23 WeakPolarHBondContact O-CD 3.4Å; P23-S25 VanDerWaalsContact C-N 3.27Å; P23-S25 WeakPolarHBondContact O-CA 3.29Å; P23-S25 PolarHBondContact O-N 3.08Å
24	M	53.1	Low	62.9	Low	179 Å²	179	109.6 Å²	109.6	88%	0.882	60%	0.601	S	S	*	*			trans	-30.1	91.5	-170.7	-98.9	-171.4	176	0	0	110.2	Q22 Q26	Q22-M24 PolarHBondContact O-N 3.44Å; M24-Q26 PolarHBondContact O-N 3.23Å; M24-Q26 VanDerWaalsContact O-N 3.11Å
25	S	56.9	Low	64.9	Low	85 Å²	85	107.9 Å²	107.9	59%	0.594	59%	0.585	S	S	*	*			trans	-70.7	120.6	-175.2	49.2	0	0	0	0	103.6	P23 V27	P23-S25 VanDerWaalsContact C-N 3.27Å; P23-S25 WeakPolarHBondContact O-CA 3.29Å; P23-S25 PolarHBondContact O-N 3.08Å; S25-V27 PolarHBondContact O-N 2.98Å
26	Q	65.5	Low	66.7	Low	184 Å²	184	100.9 Å²	100.9	86%	0.86	56%	0.558	S	S	*	*			trans	-49.5	109	-174.3	-68.4	-175.1	-89.7	0	0	108.6	M24 T28	M24-Q26 PolarHBondContact O-N 3.23Å; M24-Q26 VanDerWaalsContact O-N 3.11Å; Q26-T28 PolarHBondContact O-N 3.42Å; Q26-T28 PolarHBondContact O-OG1 2.96Å
27	V	74.2	Confident	68.7	Low	63 Å²	63	100.7 Å²	100.7	38%	0.382	55%	0.548	S	S	.	.			trans	-64.8	111	-176.5	178.9	0	0	0	0	106.5	S25 F29 V34 L36	S25-V27 PolarHBondContact O-N 2.98Å; V27-F29 HydrophobicContact CG1-CE1 4.25Å; V27-F29 HydrophobicContact CG1-CZ 4.37Å; V27-F29 PolarHBondContact O-N 2.93Å; V27-V34 HydrophobicContact CG1-CB 4.25Å; V27-V34 HydrophobicContact CG1-CG2 3.8Å; V27-L36 HydrophobicContact CG1-CB 4.2Å; V27-L36 HydrophobicContact CG1-CD2 3.91Å; V27-L36 HydrophobicContact CG2-CB 3.95Å
28	T	80.1	Confident	70.6	Confident	107 Å²	107	93 Å²	93	66%	0.656	51%	0.51	S	S	*	.			trans	-84.8	108.2	177.3	-57.6	0	0	0	0	107.4	Q26	Q26-T28 PolarHBondContact O-N 3.42Å; Q26-T28 PolarHBondContact O-OG1 2.96Å
29	F	83.3	Confident	72.1	Confident	53 Å²	53	93.3 Å²	93.3	23%	0.232	51%	0.514	C	S	.	.			trans	-70.2	136	172.8	-61.3	-74.4	0	0	0	109.4	V27 V34 L36 H88 V97 Y100	V27-F29 HydrophobicContact CG1-CE1 4.25Å; V27-F29 HydrophobicContact CG1-CZ 4.37Å; V27-F29 PolarHBondContact O-N 2.93Å; F29-V34 HydrophobicContact CD1-CG2 4.11Å; F29-V34 HydrophobicContact CE1-CG2 4.25Å; F29-L36 HydrophobicContact CE1-CD2 3.61Å; F29-L36 HydrophobicContact CZ-CD2 3.98Å; F29-H88 HydrophobicContact CD1-CB 3.95Å; F29-H88 AromaticContact CD1-CD2 3.49Å; F29-H88 VanDerWaalsContact CD1-CD2 3.49Å; F29-H88 WeakPolarHBondContact CD1-CD2 3.32Å; F29-H88 AromaticContact CD1-CE1 3.98Å; F29-H88 AromaticContact CD1-CG 3.51Å; F29-H88 AromaticContact CD1-ND1 3.85Å; F29-H88 AromaticContact CD1-NE2 3.78Å; F29-H88 HydrophobicContact CE1-CB 4Å; F29-V97 HydrophobicContact CE1-CG2 4.25Å; F29-V97 VanDerWaalsContact CZ-O 3.3Å; F29-V97 WeakPolarHBondContact CZ-O 3.38Å; F29-Y100 WeakPolarHBondContact O-CD2 3.4Å
30	S	83.1	Confident	73.9	Confident	42 Å²	42	88.1 Å²	88.1	29%	0.294	49%	0.492	S	S	.	.			trans	-141.2	-171.6	-176.9	-68.9	0	0	0	0	109	M32 H88	S30-M32 PolarHBondContact O-N 3.37Å; S30-H88 PolarHBondContact O-CE1 3.3Å; S30-H88 PolarHBondContact O-NE2 2.07Å
31	D	82.8	Confident	75.9	Confident	65 Å²	65	86.5 Å²	86.5	35%	0.348	48%	0.484	S	S	.	.	S	Bend	trans	-76.7	9.4	172.8	66.2	-68	0	0	0	114.6	L49 V86	D31-L49 WeakPolarHBondContact O-CD1 3.49Å; D31-V86 HydrophobicContact CB-CG2 4.32Å
32	M	84.6	Confident	77.7	Confident	127 Å²	127	81.1 Å²	81.1	63%	0.626	47%	0.465	S	S	*	.	S	Bend	trans	-118.8	145.2	179.8	-64.4	-171.5	-177.8	0	0	110.8	S30 V34 H88	S30-M32 PolarHBondContact O-N 3.37Å; M32-V34 PolarHBondContact O-N 3.04Å; M32-H88 PolarHBondContact O-CE1 3.04Å; M32-H88 VanDerWaalsContact O-CE1 3.25Å
33	P	84.4	Confident	79.5	Confident	62 Å²	62	78.9 Å²	78.9	40%	0.403	46%	0.457	S	S	.	.			trans	-63.9	134.3	177.2	29.6	-35.4	0	0	0	109.8	L46 T47 L49	P33-L46 HydrophobicContact CB-CD1 4.28Å; P33-L46 HydrophobicContact CB-CD2 3.9Å; P33-L46 HydrophobicContact CB-CG 3.94Å; P33-L46 HydrophobicContact CG-CD2 4.14Å; P33-T47 WeakPolarHBondContact CB-O 3.38Å; P33-L49 HydrophobicContact CB-CD2 4.28Å; P33-L49 HydrophobicContact CB-CG 4.14Å
34	V	85.5	Confident	81	Confident	27 Å²	27	78.5 Å²	78.5	16%	0.164	45%	0.449	C	S	.	.			trans	-111.5	143.5	-178.7	-67.7	0	0	0	0	110.1	V27 F29 M32 L36 T47	V27-V34 HydrophobicContact CG1-CB 4.25Å; V27-V34 HydrophobicContact CG1-CG2 3.8Å; F29-V34 HydrophobicContact CD1-CG2 4.11Å; F29-V34 HydrophobicContact CE1-CG2 4.25Å; M32-V34 PolarHBondContact O-N 3.04Å; V34-L36 HydrophobicContact CG2-CD2 3.96Å; V34-T47 HydrophobicContact CG2-CG2 4.11Å; V34-T47 PolarHBondContact N-OG1 2.86Å; V34-T47 VanDerWaalsContact N-OG1 3.09Å; V34-T47 WeakPolarHBondContact O-CG2 3.42Å; V34-T47 PolarHBondContact O-N 3.21Å; V34-T47 PolarHBondContact O-OG1 3.39Å
35	T	87	Confident	82.6	Confident	91 Å²	91	71.2 Å²	71.2	56%	0.558	41%	0.414	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.3	119.2	169.7	-57.3	0	0	0	0	108
36	L	84.5	Confident	84.1	Confident	12 Å²	12	70.4 Å²	70.4	6%	0.063	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.5	162.6	176.8	66.8	82.7	0	0	0	111.7	V27 F29 V34 C38 T45 T47 V97	V27-L36 HydrophobicContact CG1-CB 4.2Å; V27-L36 HydrophobicContact CG1-CD2 3.91Å; V27-L36 HydrophobicContact CG2-CB 3.95Å; F29-L36 HydrophobicContact CE1-CD2 3.61Å; F29-L36 HydrophobicContact CZ-CD2 3.98Å; V34-L36 HydrophobicContact CG2-CD2 3.96Å; L36-C38 PolarHBondContact O-N 3.48Å; L36-T45 PolarHBondContact N-O 3.05Å; L36-T45 VanDerWaalsContact N-O 3.13Å; L36-T45 PolarHBondContact O-N 2.83Å; L36-T45 VanDerWaalsContact O-N 3.09Å; L36-T47 HydrophobicContact CD2-CG2 3.62Å; L36-T47 HydrophobicContact CG-CG2 3.83Å; L36-V97 HydrophobicContact CD1-CB 4.21Å; L36-V97 HydrophobicContact CD1-CG1 4.22Å; L36-V97 HydrophobicContact CD1-CG2 4.3Å; L36-V97 HydrophobicContact CD2-CB 4.27Å; L36-V97 HydrophobicContact CD2-CG2 3.82Å
37	H	87.4	Confident	85.2	Confident	106 Å²	106	61.7 Å²	61.7	49%	0.491	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.4	109.2	172.8	-148.3	79.6	0	0	0	109	P39 G42 N44	H37-P39 WeakPolarHBondContact O-CD 3.46Å; H37-G42 PolarHBondContact CE1-O 3.29Å; H37-G42 VanDerWaalsContact CE1-O 3.23Å; H37-G42 PolarHBondContact NE2-O 2.76Å; H37-N44 WeakPolarHBondContact CA-OD1 3.5Å; H37-N44 WeakPolarHBondContact CB-OD1 3.42Å; H37-N44 PolarHBondContact N-OD1 3.44Å; H37-N44 PolarHBondContact ND1-OD1 3.48Å
38	C	85.8	Confident	86	Confident	0 Å²	0	61.8 Å²	61.8	0%	0	37%	0.366	C	S	.	.			trans	-67.8	121.9	-173.2	177.3	0	0	0	0	110.6	L36 S40 C41 G42 L43	L36-C38 PolarHBondContact O-N 3.48Å; C38-S40 PolarHBondContact O-N 3.09Å; C38-S40 VanDerWaalsContact O-N 3.17Å; C38-C41 WeakPolarHBondContact CB-SG 3.3Å; C38-C41 PolarHBondContact O-N 3.42Å; C38-C41 PolarHBondContact SG-SG 3.13Å; C38-G42 VanDerWaalsContact O-CA 3.32Å; C38-G42 WeakPolarHBondContact O-CA 3.12Å; C38-G42 PolarHBondContact O-N 3.34Å; C38-L43 PolarHBondContact N-O 3.05Å; C38-L43 VanDerWaalsContact N-O 3.08Å
39	P	85.1	Confident	86.4	Confident	114 Å²	114	58.3 Å²	58.3	74%	0.74	34%	0.343	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69	-16.5	-178.2	27.8	-35.6	0	0	0	113.3	H37	H37-P39 WeakPolarHBondContact O-CD 3.46Å
40	S	89	Confident	86.6	Confident	56 Å²	56	61.1 Å²	61.1	39%	0.392	36%	0.357	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.2	-30.4	179.6	-69.6	0	0	0	0	114.5	C38 R95	C38-S40 PolarHBondContact O-N 3.09Å; C38-S40 VanDerWaalsContact O-N 3.17Å; S40-R95 VanDerWaalsContact CB-CD 3.45Å; S40-R95 WeakPolarHBondContact OG-CD 3.22Å; S40-R95 PolarHBondContact OG-NH1 2.97Å
41	C	90	Very high	86.7	Confident	48 Å²	48	63.9 Å²	63.9	32%	0.324	36%	0.362	S	S	.	.	T	Hydrogen-bonded Turn	trans	-117.4	-11.1	-179.7	65.9	0	0	0	0	114.3	C38 L43 C93	C38-C41 WeakPolarHBondContact CB-SG 3.3Å; C38-C41 PolarHBondContact O-N 3.42Å; C38-C41 PolarHBondContact SG-SG 3.13Å; C41-L43 PolarHBondContact O-N 2.95Å; C41-C93 HydrophobicContact CB-CB 4.11Å
42	G	86.1	Confident	86.7	Confident	43 Å²	43	66.5 Å²	66.5	44%	0.443	37%	0.37	S	S	.	.			trans	67.1	10.8	-176.9	0	0	0	0	0	114.2	H37 C38	H37-G42 PolarHBondContact CE1-O 3.29Å; H37-G42 VanDerWaalsContact CE1-O 3.23Å; H37-G42 PolarHBondContact NE2-O 2.76Å; C38-G42 VanDerWaalsContact O-CA 3.32Å; C38-G42 WeakPolarHBondContact O-CA 3.12Å; C38-G42 PolarHBondContact O-N 3.34Å
43	L	85.7	Confident	86.4	Confident	83 Å²	83	62.5 Å²	62.5	44%	0.435	36%	0.355	S	S	.	.			trans	-94.7	136.2	178.3	-153.3	72.5	0	0	0	109.9	C38 C41 T45 H92	C38-L43 PolarHBondContact N-O 3.05Å; C38-L43 VanDerWaalsContact N-O 3.08Å; C41-L43 PolarHBondContact O-N 2.95Å; L43-T45 PolarHBondContact O-N 3.32Å; L43-H92 HydrophobicContact CD2-CB 4.5Å
44	N	87.9	Confident	86	Confident	102 Å²	102	60 Å²	60	55%	0.545	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.6	111.6	172	-137.7	59.6	0	0	0	108.5	H37	H37-N44 WeakPolarHBondContact CA-OD1 3.5Å; H37-N44 WeakPolarHBondContact CB-OD1 3.42Å; H37-N44 PolarHBondContact N-OD1 3.44Å; H37-N44 PolarHBondContact ND1-OD1 3.48Å
45	T	85.8	Confident	85.6	Confident	25 Å²	25	64 Å²	64	15%	0.153	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.4	154.4	-172.4	-166.4	0	0	0	0	111.4	L36 L43 P91	L36-T45 PolarHBondContact N-O 3.05Å; L36-T45 VanDerWaalsContact N-O 3.13Å; L36-T45 PolarHBondContact O-N 2.83Å; L36-T45 VanDerWaalsContact O-N 3.09Å; L43-T45 PolarHBondContact O-N 3.32Å; T45-P91 HydrophobicContact CG2-CG 4.44Å; T45-P91 WeakPolarHBondContact OG1-CG 3.3Å
46	L	88.1	Confident	85.1	Confident	68 Å²	68	62 Å²	62	36%	0.356	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	123.3	171.7	-169.1	91.7	0	0	0	108.3	P33 P91	P33-L46 HydrophobicContact CB-CD1 4.28Å; P33-L46 HydrophobicContact CB-CD2 3.9Å; P33-L46 HydrophobicContact CB-CG 3.94Å; P33-L46 HydrophobicContact CG-CD2 4.14Å; L46-P91 VanDerWaalsContact O-CD 3.24Å; L46-P91 WeakPolarHBondContact O-CD 3.3Å; L46-P91 WeakPolarHBondContact O-CG 3.38Å
47	T	89.3	Confident	84.8	Confident	2 Å²	2	61.4 Å²	61.4	1%	0.012	34%	0.342	C	S	.	.	P	Polyproline II helix	trans	-65.9	138.9	177.8	61.6	0	0	0	0	111.2	P33 V34 L36 H88 V89 V97	P33-T47 WeakPolarHBondContact CB-O 3.38Å; V34-T47 HydrophobicContact CG2-CG2 4.11Å; V34-T47 PolarHBondContact N-OG1 2.86Å; V34-T47 VanDerWaalsContact N-OG1 3.09Å; V34-T47 WeakPolarHBondContact O-CG2 3.42Å; V34-T47 PolarHBondContact O-N 3.21Å; V34-T47 PolarHBondContact O-OG1 3.39Å; L36-T47 HydrophobicContact CD2-CG2 3.62Å; L36-T47 HydrophobicContact CG-CG2 3.83Å; T47-H88 HydrophobicContact CG2-CB 4.08Å; T47-H88 PolarHBondContact OG1-ND1 3.4Å; T47-V89 CarbonylContact C-O 3.56Å; T47-V97 HydrophobicContact CG2-CG2 3.48Å; T47-V97 VanDerWaalsContact CG2-CG2 3.48Å
48	S	89.9	Confident	84.5	Confident	65 Å²	65	63.1 Å²	63.1	46%	0.455	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.9	142.3	166	-166.6	0	0	0	0	110.2	H88 V89	S48-H88 WeakPolarHBondContact O-CA 3.45Å; S48-V89 PolarHBondContact N-O 3.25Å; S48-V89 PolarHBondContact O-N 3.41Å
49	L	88.8	Confident	84.3	Confident	34 Å²	34	67.7 Å²	67.7	18%	0.178	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.4	122.5	179.6	-59	-172.1	0	0	0	111.1	D31 P33 Y51 V86 K87 H88	D31-L49 WeakPolarHBondContact O-CD1 3.49Å; P33-L49 HydrophobicContact CB-CD2 4.28Å; P33-L49 HydrophobicContact CB-CG 4.14Å; L49-Y51 HydrophobicContact CB-CE2 4.14Å; L49-V86 HydrophobicContact CB-CG1 4.06Å; L49-V86 HydrophobicContact CD1-CG1 4.12Å; L49-V86 HydrophobicContact CD2-CG1 3.63Å; L49-V86 HydrophobicContact CG-CG1 4.15Å; L49-K87 CarbonylContact C-O 3.55Å; L49-K87 WeakPolarHBondContact CA-O 3.31Å; L49-H88 WeakPolarHBondContact CD2-CE1 3.31Å; L49-H88 WeakPolarHBondContact CD2-ND1 3.28Å
50	E	88.4	Confident	84.1	Confident	112 Å²	112	63.7 Å²	63.7	52%	0.523	35%	0.346	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	114.7	170.3	-65.5	-162.4	115.4	0	0	110.5	K87 V89	E50-K87 HydrophobicContact CB-CB 4.11Å; E50-K87 PolarHBondContact N-O 2.86Å; E50-K87 WeakPolarHBondContact O-CB 3.16Å; E50-K87 PolarHBondContact O-N 3.21Å; E50-V89 HydrophobicContact CG-CG2 4.13Å; E50-V89 WeakPolarHBondContact OE2-CG2 3.33Å
51	Y	84.9	Confident	83.7	Confident	99 Å²	99	62.2 Å²	62.2	39%	0.388	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.8	120.8	179.4	-63.3	-90.3	0	0	0	110.7	L49 N81 K84 D85 V86	L49-Y51 HydrophobicContact CB-CE2 4.14Å; Y51-N81 HydrophobicContact CD1-CB 4.37Å; Y51-N81 HydrophobicContact CE1-CB 4.46Å; Y51-K84 HydrophobicContact CD1-CB 4.38Å; Y51-D85 CarbonylContact C-O 3.59Å; Y51-D85 WeakPolarHBondContact CA-O 3.37Å; Y51-V86 HydrophobicContact CD1-CG2 3.73Å; Y51-V86 HydrophobicContact CE1-CG2 3.59Å
52	K	82.6	Confident	83.4	Confident	120 Å²	120	63.2 Å²	63.2	52%	0.522	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	133	176.5	-162.3	173.8	175.9	77	0	110.3	G54 K84 D85	K52-G54 PolarHBondContact O-N 2.78Å; K52-K84 CarbonylContact O-C 3.54Å; K52-K84 WeakPolarHBondContact O-CA 3.32Å; K52-K84 WeakPolarHBondContact O-CB 3.31Å; K52-D85 PolarHBondContact N-O 3.23Å; K52-D85 PolarHBondContact O-N 2.92Å
53	S	78.4	Confident	83.3	Confident	44 Å²	44	62.7 Å²	62.7	31%	0.308	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.9	106.9	174.2	47.9	0	0	0	0	110.1
54	G	75.5	Confident	83.1	Confident	8 Å²	8	61 Å²	61	8%	0.082	33%	0.328	C	S	.	.			trans	-91.1	-175.3	176.6	0	0	0	0	0	112.7	K52 L56 T57 Y58 D85	K52-G54 PolarHBondContact O-N 2.78Å; G54-L56 PolarHBondContact O-N 3.5Å; G54-T57 WeakPolarHBondContact O-CB 3.33Å; G54-T57 PolarHBondContact O-N 3.26Å; G54-Y58 WeakPolarHBondContact O-CD2 3.44Å; G54-Y58 PolarHBondContact O-N 3.25Å; G54-D85 VanDerWaalsContact CA-OD2 3.26Å; G54-D85 WeakPolarHBondContact CA-OD2 2.84Å
55	L	77.6	Confident	82.9	Confident	113 Å²	113	58.8 Å²	58.8	59%	0.592	32%	0.32	S	S	*	.	H	α-helix	trans	-53.5	-38.4	178.7	-177.4	62.8	0	0	0	112.3	T57 Y58 L59 L103	L55-T57 VanDerWaalsContact C-N 3.32Å; L55-T57 PolarHBondContact O-N 2.92Å; L55-Y58 WeakPolarHBondContact O-CB 3.11Å; L55-Y58 PolarHBondContact O-N 2.76Å; L55-Y58 VanDerWaalsContact O-N 3.11Å; L55-L59 HydrophobicContact CD1-CG 4.37Å; L55-L59 HydrophobicContact CD2-CD1 4.5Å; L55-L59 HydrophobicContact CG-CD1 4.09Å; L55-L59 HydrophobicContact CG-CG 4.19Å; L55-L59 WeakPolarHBondContact O-CG 3.26Å; L55-L59 PolarHBondContact O-N 2.81Å; L55-L103 HydrophobicContact CD2-CD2 4.38Å
56	L	76.5	Confident	82.7	Confident	48 Å²	48	64.5 Å²	64.5	25%	0.251	35%	0.349	S	S	.	.	H	α-helix	trans	-58.8	-40.6	178.1	-179.6	63	0	0	0	112.6	G54 Y58 L59 A60 C83 R102	G54-L56 PolarHBondContact O-N 3.5Å; L56-Y58 VanDerWaalsContact C-N 3.3Å; L56-Y58 PolarHBondContact O-N 2.84Å; L56-L59 PolarHBondContact O-N 2.79Å; L56-A60 VanDerWaalsContact O-CB 3.31Å; L56-A60 WeakPolarHBondContact O-CB 3.04Å; L56-A60 PolarHBondContact O-N 2.81Å; L56-C83 HydrophobicContact CD2-CB 4.11Å; L56-C83 HydrophobicContact CG-CB 4.14Å; L56-R102 HydrophobicContact CD2-CB 4.35Å
57	T	79	Confident	82.4	Confident	0 Å²	0	67.5 Å²	67.5	0%	0	37%	0.37	C	S	.	.	H	α-helix	trans	-62.1	-41.6	177	-53.5	0	0	0	0	110.6	G54 L55 C61 F78 C83	G54-T57 WeakPolarHBondContact O-CB 3.33Å; G54-T57 PolarHBondContact O-N 3.26Å; L55-T57 VanDerWaalsContact C-N 3.32Å; L55-T57 PolarHBondContact O-N 2.92Å; T57-C61 PolarHBondContact O-N 3.42Å; T57-C61 VanDerWaalsContact O-N 3.08Å; T57-F78 HydrophobicContact CG2-CD1 4.23Å; T57-F78 HydrophobicContact CG2-CD2 4.35Å; T57-F78 HydrophobicContact CG2-CE1 4.12Å; T57-F78 HydrophobicContact CG2-CE2 4.26Å; T57-F78 HydrophobicContact CG2-CG 4.34Å; T57-F78 HydrophobicContact CG2-CZ 4.14Å; T57-C83 PolarHBondContact OG1-O 3.48Å
58	Y	80	Confident	81.5	Confident	141 Å²	141	69.9 Å²	69.9	55%	0.553	40%	0.395	S	S	*	.	H	α-helix	trans	-68.1	-44.4	176.9	-72.2	-79.8	0	0	0	112.4	G54 L55 L56 A60 C61 C62	G54-Y58 WeakPolarHBondContact O-CD2 3.44Å; G54-Y58 PolarHBondContact O-N 3.25Å; L55-Y58 WeakPolarHBondContact O-CB 3.11Å; L55-Y58 PolarHBondContact O-N 2.76Å; L55-Y58 VanDerWaalsContact O-N 3.11Å; L56-Y58 VanDerWaalsContact C-N 3.3Å; L56-Y58 PolarHBondContact O-N 2.84Å; Y58-A60 VanDerWaalsContact C-N 3.34Å; Y58-A60 PolarHBondContact O-N 2.76Å; Y58-C61 PolarHBondContact O-N 2.97Å; Y58-C62 VanDerWaalsContact O-CB 3.31Å; Y58-C62 WeakPolarHBondContact O-CB 3.48Å; Y58-C62 PolarHBondContact O-N 3.25Å
59	L	82.3	Confident	80.6	Confident	97 Å²	97	67.4 Å²	67.4	51%	0.508	38%	0.379	S	S	.	.	H	α-helix	trans	-61.8	-42.5	177.2	-71.7	179.1	0	0	0	111.7	L55 L56 C62 G63 L103	L55-L59 HydrophobicContact CD1-CG 4.37Å; L55-L59 HydrophobicContact CD2-CD1 4.5Å; L55-L59 HydrophobicContact CG-CD1 4.09Å; L55-L59 HydrophobicContact CG-CG 4.19Å; L55-L59 WeakPolarHBondContact O-CG 3.26Å; L55-L59 PolarHBondContact O-N 2.81Å; L56-L59 PolarHBondContact O-N 2.79Å; L59-C62 PolarHBondContact O-N 2.95Å; L59-G63 PolarHBondContact O-N 3.09Å; L59-L103 HydrophobicContact CD1-CD2 4.44Å
60	A	81.3	Confident	79.6	Confident	30 Å²	30	71.2 Å²	71.2	25%	0.248	40%	0.403	C	S	.	.	H	α-helix	trans	-65.3	-43.1	177.7	0	0	0	0	0	111.8	L56 Y58 G63 I64 P77	L56-A60 VanDerWaalsContact O-CB 3.31Å; L56-A60 WeakPolarHBondContact O-CB 3.04Å; L56-A60 PolarHBondContact O-N 2.81Å; Y58-A60 VanDerWaalsContact C-N 3.34Å; Y58-A60 PolarHBondContact O-N 2.76Å; A60-G63 PolarHBondContact O-N 3.11Å; A60-I64 WeakPolarHBondContact O-CD1 3.48Å; A60-I64 VanDerWaalsContact O-CG1 3.28Å; A60-I64 WeakPolarHBondContact O-CG1 3.46Å; A60-I64 PolarHBondContact O-N 3.41Å; A60-P77 HydrophobicContact CB-CB 3.55Å; A60-P77 HydrophobicContact CB-CG 4.35Å
61	C	80.3	Confident	78.5	Confident	25 Å²	25	74.4 Å²	74.4	17%	0.169	42%	0.423	C	S	.	.	H	α-helix	trans	-64.3	-42.8	174.1	-165.4	0	0	0	0	110.8	T57 Y58 G63 I64 C65 C74 P77 F78	T57-C61 PolarHBondContact O-N 3.42Å; T57-C61 VanDerWaalsContact O-N 3.08Å; Y58-C61 PolarHBondContact O-N 2.97Å; C61-G63 PolarHBondContact O-N 2.85Å; C61-I64 PolarHBondContact O-N 3.36Å; C61-C65 WeakPolarHBondContact O-CB 3.47Å; C61-C65 PolarHBondContact O-N 3.19Å; C61-C74 WeakPolarHBondContact CA-SG 3.35Å; C61-C74 WeakPolarHBondContact CB-SG 3.38Å; C61-C74 PolarHBondContact O-SG 3.18Å; C61-C74 WeakPolarHBondContact SG-CB 3.34Å; C61-C74 PolarHBondContact SG-O 3.44Å; C61-C74 VanDerWaalsContact SG-O 3.41Å; C61-C74 CovalentContact SG-SG 2.07Å; C61-C74 PolarHBondContact SG-SG 3.44Å; C61-P77 HydrophobicContact CB-CG 3.84Å; C61-F78 HydrophobicContact CB-CE2 4.35Å
62	C	82.7	Confident	77.5	Confident	68 Å²	68	71.9 Å²	71.9	46%	0.459	43%	0.427	S	S	.	.	H	α-helix	trans	-58.8	-48.5	175.4	-172.8	0	0	0	0	112	Y58 L59 I64 C65 L66	Y58-C62 VanDerWaalsContact O-CB 3.31Å; Y58-C62 WeakPolarHBondContact O-CB 3.48Å; Y58-C62 PolarHBondContact O-N 3.25Å; L59-C62 PolarHBondContact O-N 2.95Å; C62-I64 VanDerWaalsContact C-N 3.34Å; C62-I64 PolarHBondContact O-N 3.48Å; C62-C65 WeakPolarHBondContact O-CB 3.43Å; C62-C65 PolarHBondContact O-N 3.03Å; C62-L66 VanDerWaalsContact O-CG 3.3Å; C62-L66 WeakPolarHBondContact O-CG 3.47Å; C62-L66 PolarHBondContact O-N 3.1Å
63	G	84	Confident	76.8	Confident	33 Å²	33	68.9 Å²	68.9	34%	0.34	42%	0.421	S	S	.	.	H	α-helix	trans	-59	-43.4	177.2	0	0	0	0	0	112.6	L59 A60 C61 L66 V67	L59-G63 PolarHBondContact O-N 3.09Å; A60-G63 PolarHBondContact O-N 3.11Å; C61-G63 PolarHBondContact O-N 2.85Å; G63-L66 PolarHBondContact O-N 3Å; G63-V67 VanDerWaalsContact O-CG2 3.3Å; G63-V67 WeakPolarHBondContact O-CG2 3.07Å; G63-V67 PolarHBondContact O-N 2.94Å; G63-V67 VanDerWaalsContact O-N 3.11Å
64	I	82.6	Confident	76	Confident	46 Å²	46	67.7 Å²	67.7	24%	0.236	41%	0.412	C	S	.	.	H	α-helix	trans	-67.2	-39.8	177.3	-67.6	163.9	0	0	0	111.6	A60 C61 C62 L66 V67 G69 C73 P77	A60-I64 WeakPolarHBondContact O-CD1 3.48Å; A60-I64 VanDerWaalsContact O-CG1 3.28Å; A60-I64 WeakPolarHBondContact O-CG1 3.46Å; A60-I64 PolarHBondContact O-N 3.41Å; C61-I64 PolarHBondContact O-N 3.36Å; C62-I64 VanDerWaalsContact C-N 3.34Å; C62-I64 PolarHBondContact O-N 3.48Å; I64-L66 VanDerWaalsContact C-N 3.33Å; I64-L66 PolarHBondContact O-N 2.83Å; I64-V67 PolarHBondContact O-N 3.04Å; I64-G69 WeakPolarHBondContact O-CA 3.4Å; I64-G69 PolarHBondContact O-N 3.04Å; I64-C73 HydrophobicContact CG2-CB 3.55Å; I64-P77 HydrophobicContact CD1-CB 4.48Å; I64-P77 VanDerWaalsContact CD1-CD 3.45Å; I64-P77 HydrophobicContact CD1-CG 3.86Å
65	C	82.2	Confident	75.5	Confident	57 Å²	57	72.9 Å²	72.9	39%	0.385	44%	0.437	S	S	.	.	H	α-helix	trans	-58.3	-44.3	172.3	-86.9	0	0	0	0	111.8	C61 C62 V67 G68 C74	C61-C65 WeakPolarHBondContact O-CB 3.47Å; C61-C65 PolarHBondContact O-N 3.19Å; C62-C65 WeakPolarHBondContact O-CB 3.43Å; C62-C65 PolarHBondContact O-N 3.03Å; C65-V67 VanDerWaalsContact C-N 3.33Å; C65-V67 PolarHBondContact O-N 3.12Å; C65-G68 PolarHBondContact O-N 2.9Å; C65-C74 PolarHBondContact SG-SG 3.38Å
66	L	82.9	Confident	75.1	Confident	144 Å²	144	72 Å²	72	75%	0.754	43%	0.432	S	S	*	.	H	α-helix	trans	-66.8	-32.2	-178.9	-70	175.6	0	0	0	113	C62 G63 I64 G68	C62-L66 VanDerWaalsContact O-CG 3.3Å; C62-L66 WeakPolarHBondContact O-CG 3.47Å; C62-L66 PolarHBondContact O-N 3.1Å; G63-L66 PolarHBondContact O-N 3Å; I64-L66 VanDerWaalsContact C-N 3.33Å; I64-L66 PolarHBondContact O-N 2.83Å; L66-G68 PolarHBondContact O-N 2.85Å
67	V	80.9	Confident	74.5	Confident	132 Å²	132	69.9 Å²	69.9	80%	0.8	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.2	5.2	179.1	-177.9	0	0	0	0	112.2	G63 I64 C65	G63-V67 VanDerWaalsContact O-CG2 3.3Å; G63-V67 WeakPolarHBondContact O-CG2 3.07Å; G63-V67 PolarHBondContact O-N 2.94Å; G63-V67 VanDerWaalsContact O-N 3.11Å; I64-V67 PolarHBondContact O-N 3.04Å; C65-V67 VanDerWaalsContact C-N 3.33Å; C65-V67 PolarHBondContact O-N 3.12Å
68	G	71.3	Confident	73.8	Confident	52 Å²	52	74 Å²	74	54%	0.536	44%	0.44	S	S	.	.	T	Hydrogen-bonded Turn	trans	91.4	13.4	177.2	0	0	0	0	0	114.5	C65 L66 V70	C65-G68 PolarHBondContact O-N 2.9Å; L66-G68 PolarHBondContact O-N 2.85Å; G68-V70 PolarHBondContact O-N 3.35Å
69	G	71.2	Confident	72.9	Confident	12 Å²	12	71.8 Å²	71.8	12%	0.124	44%	0.444	C	S	.	.	T	Hydrogen-bonded Turn	trans	-77.1	32.8	178.7	0	0	0	0	0	115.3	I64 L71 C73 C74	I64-G69 WeakPolarHBondContact O-CA 3.4Å; I64-G69 PolarHBondContact O-N 3.04Å; G69-L71 VanDerWaalsContact C-N 3.29Å; G69-L71 PolarHBondContact O-N 3.15Å; G69-C73 PolarHBondContact O-N 2.75Å; G69-C74 PolarHBondContact O-N 2.89Å
70	V	66.5	Low	72.1	Confident	114 Å²	114	69.9 Å²	69.9	69%	0.691	44%	0.436	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.2	-19.3	-176.1	-120.3	0	0	0	0	113	G68 G72	G68-V70 PolarHBondContact O-N 3.35Å; V70-G72 PolarHBondContact O-N 3.48Å; V70-G72 VanDerWaalsContact O-N 3.14Å
71	L	66.6	Low	71.2	Confident	179 Å²	179	72.4 Å²	72.4	94%	0.937	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.4	33.3	-179.8	-65.7	173.3	0	0	0	113.9	G69	G69-L71 VanDerWaalsContact C-N 3.29Å; G69-L71 PolarHBondContact O-N 3.15Å
72	G	63.9	Low	70.5	Confident	46 Å²	46	74.9 Å²	74.9	47%	0.474	46%	0.463	S	S	.	.	T	Hydrogen-bonded Turn	trans	112.7	-7.9	173.4	0	0	0	0	0	116	V70 C74 L75	V70-G72 PolarHBondContact O-N 3.48Å; V70-G72 VanDerWaalsContact O-N 3.14Å; G72-C74 VanDerWaalsContact C-N 3.31Å; G72-C74 PolarHBondContact O-N 2.83Å; G72-L75 PolarHBondContact O-N 2.82Å
73	C	66.3	Low	69.6	Low	57 Å²	57	72.8 Å²	72.8	39%	0.385	45%	0.448	S	S	.	.	G	3₁₀ helix	trans	-71.8	-22.1	179.1	-58.8	0	0	0	0	113.2	I64 G69 L75 I76	I64-C73 HydrophobicContact CG2-CB 3.55Å; G69-C73 PolarHBondContact O-N 2.75Å; C73-L75 PolarHBondContact O-N 3.46Å; C73-L75 VanDerWaalsContact O-N 3.13Å; C73-I76 HydrophobicContact CB-CD1 4Å; C73-I76 WeakPolarHBondContact O-CB 3.34Å; C73-I76 VanDerWaalsContact O-CG1 3.25Å; C73-I76 WeakPolarHBondContact O-CG1 3.38Å; C73-I76 PolarHBondContact O-N 3.01Å
74	C	63.5	Low	69.1	Low	20 Å²	20	72.4 Å²	72.4	14%	0.135	44%	0.438	C	S	.	.	G	3₁₀ helix	trans	-65.5	-12.1	175.4	-136.5	0	0	0	0	113.6	C61 C65 G69 G72 P77	C61-C74 WeakPolarHBondContact CA-SG 3.35Å; C61-C74 WeakPolarHBondContact CB-SG 3.38Å; C61-C74 PolarHBondContact O-SG 3.18Å; C61-C74 WeakPolarHBondContact SG-CB 3.34Å; C61-C74 PolarHBondContact SG-O 3.44Å; C61-C74 VanDerWaalsContact SG-O 3.41Å; C61-C74 CovalentContact SG-SG 2.07Å; C61-C74 PolarHBondContact SG-SG 3.44Å; C65-C74 PolarHBondContact SG-SG 3.38Å; G69-C74 PolarHBondContact O-N 2.89Å; G72-C74 VanDerWaalsContact C-N 3.31Å; G72-C74 PolarHBondContact O-N 2.83Å; C74-P77 VanDerWaalsContact O-CD 3.24Å; C74-P77 WeakPolarHBondContact O-CD 3.24Å; C74-P77 WeakPolarHBondContact O-CG 3.08Å
75	L	64.2	Low	69.1	Low	116 Å²	116	71.4 Å²	71.4	61%	0.607	43%	0.432	S	S	*	.	G	3₁₀ helix	trans	-78.7	-21.8	171.9	-93.4	86.8	0	0	0	113.3	G72 C73 F78 C79	G72-L75 PolarHBondContact O-N 2.82Å; C73-L75 PolarHBondContact O-N 3.46Å; C73-L75 VanDerWaalsContact O-N 3.13Å; L75-F78 CarbonylContact O-C 3.56Å; L75-F78 WeakPolarHBondContact O-CA 3.44Å; L75-F78 WeakPolarHBondContact O-CB 3.47Å; L75-F78 PolarHBondContact O-N 3.08Å; L75-C79 PolarHBondContact O-N 3.09Å; L75-C79 PolarHBondContact O-SG 3.34Å
76	I	69.7	Low	69.2	Low	94 Å²	94	68.7 Å²	68.7	48%	0.482	41%	0.414	S	S	.	.	H	α-helix	trans	-53.1	-49.5	178.1	-57.5	170.2	0	0	0	111.8	C73 F78 C79 V80	C73-I76 HydrophobicContact CB-CD1 4Å; C73-I76 WeakPolarHBondContact O-CB 3.34Å; C73-I76 VanDerWaalsContact O-CG1 3.25Å; C73-I76 WeakPolarHBondContact O-CG1 3.38Å; C73-I76 PolarHBondContact O-N 3.01Å; I76-F78 PolarHBondContact O-N 3.29Å; I76-C79 PolarHBondContact O-N 3.15Å; I76-C79 VanDerWaalsContact O-N 3.08Å; I76-V80 HydrophobicContact CG2-CG2 4.32Å; I76-V80 WeakPolarHBondContact O-CG2 3.42Å; I76-V80 PolarHBondContact O-N 2.91Å
77	P	63.4	Low	69.5	Low	4 Å²	4	65.1 Å²	65.1	3%	0.026	39%	0.392	C	S	.	.	H	α-helix	trans	-68.5	-21.4	179	27.4	-37.3	0	0	0	113	A60 C61 I64 C74	A60-P77 HydrophobicContact CB-CB 3.55Å; A60-P77 HydrophobicContact CB-CG 4.35Å; C61-P77 HydrophobicContact CB-CG 3.84Å; I64-P77 HydrophobicContact CD1-CB 4.48Å; I64-P77 VanDerWaalsContact CD1-CD 3.45Å; I64-P77 HydrophobicContact CD1-CG 3.86Å; C74-P77 VanDerWaalsContact O-CD 3.24Å; C74-P77 WeakPolarHBondContact O-CD 3.24Å; C74-P77 WeakPolarHBondContact O-CG 3.08Å
78	F	63.5	Low	69.9	Low	88 Å²	88	58.8 Å²	58.8	39%	0.386	35%	0.354	S	S	.	.	H	α-helix	trans	-78	-32.5	171.8	-87.3	-85.8	0	0	0	112.6	T57 C61 L75 I76 K84	T57-F78 HydrophobicContact CG2-CD1 4.23Å; T57-F78 HydrophobicContact CG2-CD2 4.35Å; T57-F78 HydrophobicContact CG2-CE1 4.12Å; T57-F78 HydrophobicContact CG2-CE2 4.26Å; T57-F78 HydrophobicContact CG2-CG 4.34Å; T57-F78 HydrophobicContact CG2-CZ 4.14Å; C61-F78 HydrophobicContact CB-CE2 4.35Å; L75-F78 CarbonylContact O-C 3.56Å; L75-F78 WeakPolarHBondContact O-CA 3.44Å; L75-F78 WeakPolarHBondContact O-CB 3.47Å; L75-F78 PolarHBondContact O-N 3.08Å; I76-F78 PolarHBondContact O-N 3.29Å; F78-K84 VanDerWaalsContact O-CE 3.31Å; F78-K84 WeakPolarHBondContact O-CE 3.29Å; F78-K84 PolarHBondContact O-NZ 3.24Å
79	C	62.6	Low	70.9	Confident	94 Å²	94	57.2 Å²	57.2	64%	0.635	33%	0.334	S	S	*	.	H	α-helix	trans	-75.6	-28.4	175	-72.3	0	0	0	0	112.9	L75 I76 N81	L75-C79 PolarHBondContact O-N 3.09Å; L75-C79 PolarHBondContact O-SG 3.34Å; I76-C79 PolarHBondContact O-N 3.15Å; I76-C79 VanDerWaalsContact O-N 3.08Å; C79-N81 PolarHBondContact O-N 3.45Å; C79-N81 VanDerWaalsContact O-N 3.15Å
80	V	64.8	Low	71.8	Confident	56 Å²	56	56.7 Å²	56.7	34%	0.339	33%	0.328	S	S	.	.			trans	-81.8	97.2	178.7	-179.9	0	0	0	0	109.7	I76 S82 C83	I76-V80 HydrophobicContact CG2-CG2 4.32Å; I76-V80 WeakPolarHBondContact O-CG2 3.42Å; I76-V80 PolarHBondContact O-N 2.91Å; V80-S82 PolarHBondContact O-N 2.89Å; V80-S82 VanDerWaalsContact O-N 3.09Å; V80-C83 PolarHBondContact O-N 3.11Å
81	N	63.1	Low	72.8	Confident	84 Å²	84	54.7 Å²	54.7	45%	0.449	32%	0.318	S	S	.	.	G	3₁₀ helix	trans	-57.2	-20.9	171.7	-70.9	-48.7	0	0	0	112.8	Y51 C79 C83 K84	Y51-N81 HydrophobicContact CD1-CB 4.37Å; Y51-N81 HydrophobicContact CE1-CB 4.46Å; C79-N81 PolarHBondContact O-N 3.45Å; C79-N81 VanDerWaalsContact O-N 3.15Å; N81-C83 PolarHBondContact O-N 3.33Å; N81-C83 VanDerWaalsContact O-N 3.12Å; N81-K84 PolarHBondContact O-N 3.28Å; N81-K84 VanDerWaalsContact O-N 3.1Å
82	S	64.1	Low	73.9	Confident	76 Å²	76	52.4 Å²	52.4	53%	0.531	30%	0.302	S	S	.	.	G	3₁₀ helix	trans	-66.3	-5.8	173.8	-48.6	0	0	0	0	114.4	V80 R102	V80-S82 PolarHBondContact O-N 2.89Å; V80-S82 VanDerWaalsContact O-N 3.09Å; S82-R102 WeakPolarHBondContact O-CD 3.33Å; S82-R102 PolarHBondContact O-NE 3.38Å; S82-R102 VanDerWaalsContact O-NE 3.15Å
83	C	64.2	Low	75.2	Confident	24 Å²	24	52.1 Å²	52.1	16%	0.162	29%	0.293	C	S	.	.	G	3₁₀ helix	trans	-104	-2.3	173.5	-60.7	0	0	0	0	113.5	L56 T57 V80 N81	L56-C83 HydrophobicContact CD2-CB 4.11Å; L56-C83 HydrophobicContact CG-CB 4.14Å; T57-C83 PolarHBondContact OG1-O 3.48Å; V80-C83 PolarHBondContact O-N 3.11Å; N81-C83 PolarHBondContact O-N 3.33Å; N81-C83 VanDerWaalsContact O-N 3.12Å
84	K	74.5	Confident	76.4	Confident	26 Å²	26	57.3 Å²	57.3	11%	0.113	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.7	143.6	-178.6	-61.7	179.1	-165.8	-72.5	0	109.7	Y51 K52 F78 N81 R102	Y51-K84 HydrophobicContact CD1-CB 4.38Å; K52-K84 CarbonylContact O-C 3.54Å; K52-K84 WeakPolarHBondContact O-CA 3.32Å; K52-K84 WeakPolarHBondContact O-CB 3.31Å; F78-K84 VanDerWaalsContact O-CE 3.31Å; F78-K84 WeakPolarHBondContact O-CE 3.29Å; F78-K84 PolarHBondContact O-NZ 3.24Å; N81-K84 PolarHBondContact O-N 3.28Å; N81-K84 VanDerWaalsContact O-N 3.1Å; K84-R102 VanDerWaalsContact O-CD 3.29Å; K84-R102 WeakPolarHBondContact O-CD 3.36Å; K84-R102 PolarHBondContact O-NE 2.91Å
85	D	81.5	Confident	77.7	Confident	24 Å²	24	63.6 Å²	63.6	13%	0.128	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70	147.3	170.9	-60.9	-44.1	0	0	0	109.1	Y51 K52 G54 H101 R102	Y51-D85 CarbonylContact C-O 3.59Å; Y51-D85 WeakPolarHBondContact CA-O 3.37Å; K52-D85 PolarHBondContact N-O 3.23Å; K52-D85 PolarHBondContact O-N 2.92Å; G54-D85 VanDerWaalsContact CA-OD2 3.26Å; G54-D85 WeakPolarHBondContact CA-OD2 2.84Å; D85-H101 WeakPolarHBondContact OD1-CA 3.39Å; D85-H101 IonicContact OD1-ND1 3.73Å; D85-H101 IonicContact OD2-ND1 3.74Å; D85-R102 PolarHBondContact OD1-N 3.4Å
86	V	84.8	Confident	78.9	Confident	0 Å²	0	61.3 Å²	61.3	0%	0	33%	0.33	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113	110.3	-174.1	-178.8	0	0	0	0	108.8	D31 L49 Y51 T99 Y100	D31-V86 HydrophobicContact CB-CG2 4.32Å; L49-V86 HydrophobicContact CB-CG1 4.06Å; L49-V86 HydrophobicContact CD1-CG1 4.12Å; L49-V86 HydrophobicContact CD2-CG1 3.63Å; L49-V86 HydrophobicContact CG-CG1 4.15Å; Y51-V86 HydrophobicContact CD1-CG2 3.73Å; Y51-V86 HydrophobicContact CE1-CG2 3.59Å; V86-T99 CarbonylContact O-C 3.56Å; V86-T99 WeakPolarHBondContact O-CA 3.31Å; V86-Y100 HydrophobicContact CB-CD1 4.31Å; V86-Y100 HydrophobicContact CG2-CD1 4.32Å; V86-Y100 PolarHBondContact N-O 3.35Å; V86-Y100 PolarHBondContact O-N 3.39Å
87	K	89.4	Confident	79.7	Confident	69 Å²	69	58.2 Å²	58.2	30%	0.3	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.3	126.6	174	-67	-176.8	172.3	-165.2	0	109.4	L49 E50 T99	L49-K87 CarbonylContact C-O 3.55Å; L49-K87 WeakPolarHBondContact CA-O 3.31Å; E50-K87 HydrophobicContact CB-CB 4.11Å; E50-K87 PolarHBondContact N-O 2.86Å; E50-K87 WeakPolarHBondContact O-CB 3.16Å; E50-K87 PolarHBondContact O-N 3.21Å; K87-T99 HydrophobicContact CG-CG2 3.86Å
88	H	89.2	Confident	80.8	Confident	0 Å²	0	58.7 Å²	58.7	0%	0	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	119.6	174	-68.3	-105.3	0	0	0	109	F29 S30 M32 T47 S48 L49 A96 V97 G98	F29-H88 HydrophobicContact CD1-CB 3.95Å; F29-H88 AromaticContact CD1-CD2 3.49Å; F29-H88 VanDerWaalsContact CD1-CD2 3.49Å; F29-H88 WeakPolarHBondContact CD1-CD2 3.32Å; F29-H88 AromaticContact CD1-CE1 3.98Å; F29-H88 AromaticContact CD1-CG 3.51Å; F29-H88 AromaticContact CD1-ND1 3.85Å; F29-H88 AromaticContact CD1-NE2 3.78Å; F29-H88 HydrophobicContact CE1-CB 4Å; S30-H88 PolarHBondContact O-CE1 3.3Å; S30-H88 PolarHBondContact O-NE2 2.07Å; M32-H88 PolarHBondContact O-CE1 3.04Å; M32-H88 VanDerWaalsContact O-CE1 3.25Å; T47-H88 HydrophobicContact CG2-CB 4.08Å; T47-H88 PolarHBondContact OG1-ND1 3.4Å; S48-H88 WeakPolarHBondContact O-CA 3.45Å; L49-H88 WeakPolarHBondContact CD2-CE1 3.31Å; L49-H88 WeakPolarHBondContact CD2-ND1 3.28Å; H88-A96 CarbonylContact O-C 3.58Å; H88-A96 WeakPolarHBondContact O-CA 3.22Å; H88-V97 HydrophobicContact CB-CG2 3.77Å; H88-V97 WeakPolarHBondContact O-CG2 3.24Å; H88-V97 PolarHBondContact O-N 2.99Å; H88-G98 PolarHBondContact N-O 3.24Å
89	V	91.4	Very high	81.9	Confident	19 Å²	19	56.8 Å²	56.8	12%	0.115	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.7	134.9	-177.7	-177	0	0	0	0	109.7	T47 S48 E50 P91	T47-V89 CarbonylContact C-O 3.56Å; S48-V89 PolarHBondContact N-O 3.25Å; S48-V89 PolarHBondContact O-N 3.41Å; E50-V89 HydrophobicContact CG-CG2 4.13Å; E50-V89 WeakPolarHBondContact OE2-CG2 3.33Å; V89-P91 WeakPolarHBondContact O-CD 3.38Å
90	C	90.1	Very high	83	Confident	0 Å²	0	55.9 Å²	55.9	0%	0	30%	0.301	C	S	.	.			trans	-69.4	122.1	173.7	173.9	0	0	0	0	110	H92 C93 Q94 R95 V97	C90-H92 PolarHBondContact O-N 2.98Å; C90-H92 PolarHBondContact SG-N 3.05Å; C90-C93 VanDerWaalsContact CB-SG 3.56Å; C90-C93 PolarHBondContact SG-SG 3.08Å; C90-Q94 WeakPolarHBondContact O-CA 3.42Å; C90-Q94 PolarHBondContact O-N 2.88Å; C90-R95 PolarHBondContact N-O 3.49Å; C90-V97 HydrophobicContact CB-CG1 4.17Å
91	P	88.9	Confident	83.8	Confident	73 Å²	73	56.9 Å²	56.9	47%	0.474	30%	0.302	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.7	-19.7	-179.7	28.4	-36	0	0	0	113.3	T45 L46 V89	T45-P91 HydrophobicContact CG2-CG 4.44Å; T45-P91 WeakPolarHBondContact OG1-CG 3.3Å; L46-P91 VanDerWaalsContact O-CD 3.24Å; L46-P91 WeakPolarHBondContact O-CD 3.3Å; L46-P91 WeakPolarHBondContact O-CG 3.38Å; V89-P91 WeakPolarHBondContact O-CD 3.38Å
92	H	89.5	Confident	84.3	Confident	130 Å²	130	55.8 Å²	55.8	60%	0.602	29%	0.291	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.6	-44.4	-178.3	-170.2	-78.4	0	0	0	112.9	L43 C90	L43-H92 HydrophobicContact CD2-CB 4.5Å; C90-H92 PolarHBondContact O-N 2.98Å; C90-H92 PolarHBondContact SG-N 3.05Å
93	C	91.2	Very high	84.5	Confident	41 Å²	41	56.2 Å²	56.2	28%	0.277	29%	0.287	S	S	.	.	T	Hydrogen-bonded Turn	trans	-110.2	-0.7	-178.3	71.7	0	0	0	0	113.9	C41 C90 R95	C41-C93 HydrophobicContact CB-CB 4.11Å; C90-C93 VanDerWaalsContact CB-SG 3.56Å; C90-C93 PolarHBondContact SG-SG 3.08Å; C93-R95 PolarHBondContact O-N 2.96Å
94	Q	90.4	Very high	84.2	Confident	166 Å²	166	58.9 Å²	58.9	78%	0.776	32%	0.318	S	S	*	.			trans	54.6	23.7	-179.2	-59.5	-173.2	-44.1	0	0	114.8	C90	C90-Q94 WeakPolarHBondContact O-CA 3.42Å; C90-Q94 PolarHBondContact O-N 2.88Å
95	R	90.2	Very high	82.8	Confident	151 Å²	151	66.9 Å²	66.9	57%	0.57	36%	0.362	S	S	*	.			trans	-94.3	140.5	175.7	-72	-177.4	176.8	-162.6	0.5	110.9	S40 C90 C93 V97	S40-R95 VanDerWaalsContact CB-CD 3.45Å; S40-R95 WeakPolarHBondContact OG-CD 3.22Å; S40-R95 PolarHBondContact OG-NH1 2.97Å; C90-R95 PolarHBondContact N-O 3.49Å; C93-R95 PolarHBondContact O-N 2.96Å; R95-V97 PolarHBondContact O-N 3.43Å
96	A	89.9	Confident	82.9	Confident	69 Å²	69	69 Å²	69	57%	0.57	37%	0.374	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-67.4	126.9	171.6	0	0	0	0	0	109.8	H88	H88-A96 CarbonylContact O-C 3.58Å; H88-A96 WeakPolarHBondContact O-CA 3.22Å
97	V	88.1	Confident	82.8	Confident	28 Å²	28	72.6 Å²	72.6	17%	0.17	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	-20.2	179.6	-67	0	0	0	0	112.1	F29 L36 T47 H88 C90 R95	F29-V97 HydrophobicContact CE1-CG2 4.25Å; F29-V97 VanDerWaalsContact CZ-O 3.3Å; F29-V97 WeakPolarHBondContact CZ-O 3.38Å; L36-V97 HydrophobicContact CD1-CB 4.21Å; L36-V97 HydrophobicContact CD1-CG1 4.22Å; L36-V97 HydrophobicContact CD1-CG2 4.3Å; L36-V97 HydrophobicContact CD2-CB 4.27Å; L36-V97 HydrophobicContact CD2-CG2 3.82Å; T47-V97 HydrophobicContact CG2-CG2 3.48Å; T47-V97 VanDerWaalsContact CG2-CG2 3.48Å; H88-V97 HydrophobicContact CB-CG2 3.77Å; H88-V97 WeakPolarHBondContact O-CG2 3.24Å; H88-V97 PolarHBondContact O-N 2.99Å; C90-V97 HydrophobicContact CB-CG1 4.17Å; R95-V97 PolarHBondContact O-N 3.43Å
98	G	86.3	Confident	82.4	Confident	14 Å²	14	72.8 Å²	72.8	14%	0.144	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-171.1	162	175.2	0	0	0	0	0	111.6	H88	H88-G98 PolarHBondContact N-O 3.24Å
99	T	86.1	Confident	82	Confident	49 Å²	49	77.1 Å²	77.1	30%	0.301	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	125.3	170.4	-55.5	0	0	0	0	108.3	V86 K87 H101	V86-T99 CarbonylContact O-C 3.56Å; V86-T99 WeakPolarHBondContact O-CA 3.31Å; K87-T99 HydrophobicContact CG-CG2 3.86Å; T99-H101 VanDerWaalsContact CG2-CE1 3.46Å; T99-H101 WeakPolarHBondContact CG2-CE1 3.43Å; T99-H101 WeakPolarHBondContact CG2-NE2 3.25Å
100	Y	85.2	Confident	81.4	Confident	75 Å²	75	80.8 Å²	80.8	29%	0.294	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	104.1	171.4	174.5	-112.9	0	0	0	108.5	F29 V86 R102	F29-Y100 WeakPolarHBondContact O-CD2 3.4Å; V86-Y100 HydrophobicContact CB-CD1 4.31Å; V86-Y100 HydrophobicContact CG2-CD1 4.32Å; V86-Y100 PolarHBondContact N-O 3.35Å; V86-Y100 PolarHBondContact O-N 3.39Å; Y100-R102 HydrophobicContact CD1-CG 4.17Å; Y100-R102 HydrophobicContact CE1-CG 3.72Å
101	H	81.5	Confident	80.8	Confident	77 Å²	77	86.1 Å²	86.1	36%	0.356	47%	0.471	S	S	.	.			trans	-84.2	120.7	172.5	-64.5	-71.6	0	0	0	108.9	D85 T99 L103 N105	D85-H101 WeakPolarHBondContact OD1-CA 3.39Å; D85-H101 IonicContact OD1-ND1 3.73Å; D85-H101 IonicContact OD2-ND1 3.74Å; T99-H101 VanDerWaalsContact CG2-CE1 3.46Å; T99-H101 WeakPolarHBondContact CG2-CE1 3.43Å; T99-H101 WeakPolarHBondContact CG2-NE2 3.25Å; H101-L103 PolarHBondContact O-N 3.13Å; H101-N105 PolarHBondContact CD2-OXT 3.14Å
102	R	73.9	Confident	80.3	Confident	61 Å²	61	87.1 Å²	87.1	23%	0.23	47%	0.47	C	S	.	.	S	Bend	trans	-72.6	-22.7	178.5	-65	-172	-179.1	-95.2	7.1	112.2	L56 S82 K84 D85 Y100	L56-R102 HydrophobicContact CD2-CB 4.35Å; S82-R102 WeakPolarHBondContact O-CD 3.33Å; S82-R102 PolarHBondContact O-NE 3.38Å; S82-R102 VanDerWaalsContact O-NE 3.15Å; K84-R102 VanDerWaalsContact O-CD 3.29Å; K84-R102 WeakPolarHBondContact O-CD 3.36Å; K84-R102 PolarHBondContact O-NE 2.91Å; D85-R102 PolarHBondContact OD1-N 3.4Å; Y100-R102 HydrophobicContact CD1-CG 4.17Å; Y100-R102 HydrophobicContact CE1-CG 3.72Å
103	L	69.1	Low	79.5	Confident	85 Å²	85	83.8 Å²	83.8	45%	0.445	46%	0.46	S	S	.	.	S	Bend	trans	-113.3	109.2	173.5	-155.2	70.6	0	0	0	106.8	L55 L59 H101 N105	L55-L103 HydrophobicContact CD2-CD2 4.38Å; L59-L103 HydrophobicContact CD1-CD2 4.44Å; H101-L103 PolarHBondContact O-N 3.13Å; L103-N105 PolarHBondContact O-N 3.32Å
104	G	56.9	Low	78.6	Confident	79 Å²	79	87.3 Å²	87.3	81%	0.814	48%	0.476	S	S	*	.			trans	-56.5	107.9	-165.4	0	0	0	0	0	114
105	N	45.5	Very low	77.5	Confident	194 Å²	194	80.2 Å²	80.2	100%	1.037	45%	0.448	S	S	*	.			trans	-156.4	0	153.6	-158.1	87.8	0	0	0	108.3	H101 L103	H101-N105 PolarHBondContact CD2-OXT 3.14Å; L103-N105 PolarHBondContact O-N 3.32Å

Retrieved 105 of 105 residues in 141 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).