A0A5K4F5U8_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F5U8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 142 aa.

						>A0A5K4F5U8_SCHMA|A0A5K4F5U8
MSLEIINTVDKLTLSDQIEQEKISLNLLRQTNCKLEESIDILEDQLASIEDEDNEWKTRYLIQKEMNDYYKRAFFFCDQQIPKAKALQRTINRAVRRGSKLSSYMDLDEDSVQELEDYRTYIIKLCRELESRIDQEGKKSNI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.7	Low	77.6	Confident	194 Å²	194	109.4 Å²	109.4	96%	0.956	57%	0.572	S	S	*	*				0	24.9	0	-148.1	179.5	-73.4	0	0	112.5	I5	M1-I5 WeakPolarHBondContact O-CD1 3.3Å; M1-I5 VanDerWaalsContact O-CG1 3.3Å; M1-I5 WeakPolarHBondContact O-CG1 3.03Å
2	S	72.1	Confident	78.2	Confident	80 Å²	80	109.6 Å²	109.6	56%	0.559	57%	0.573	S	S	*	*			trans	-110.8	-43.1	-175.6	49.6	0	0	0	0	113.6	I5 I6	S2-I5 PolarHBondContact O-N 3.42Å; S2-I6 WeakPolarHBondContact O-CG1 3.38Å; S2-I6 PolarHBondContact O-N 2.97Å; S2-I6 VanDerWaalsContact O-N 3.09Å
3	L	77.3	Confident	79.1	Confident	127 Å²	127	106.2 Å²	106.2	67%	0.665	56%	0.56	S	S	*	*	H	α-helix	trans	-64.4	-38.5	176.9	-87.9	138.4	0	0	0	113.4	I5 I6 N7	L3-I5 VanDerWaalsContact C-N 3.31Å; L3-I5 PolarHBondContact O-N 3.43Å; L3-I6 PolarHBondContact O-N 3.36Å; L3-N7 PolarHBondContact O-N 2.63Å; L3-N7 PolarHBondContact O-ND2 3.36Å
4	E	76.6	Confident	79.9	Confident	138 Å²	138	105.3 Å²	105.3	65%	0.645	56%	0.555	S	S	*	*	H	α-helix	trans	-63.8	-39.5	176	-69.5	170.2	162.5	0	0	111.4	N7 T8	E4-N7 PolarHBondContact O-N 3.31Å; E4-T8 WeakPolarHBondContact O-CG2 3.38Å; E4-T8 PolarHBondContact O-N 3.09Å; E4-T8 PolarHBondContact O-OG1 3.18Å
5	I	79.9	Confident	80.6	Confident	96 Å²	96	102.7 Å²	102.7	49%	0.492	55%	0.549	S	S	.	.	H	α-helix	trans	-65.6	-44.3	176.9	-61.9	179.2	0	0	0	110.3	M1 S2 L3 N7 T8 V9	M1-I5 WeakPolarHBondContact O-CD1 3.3Å; M1-I5 VanDerWaalsContact O-CG1 3.3Å; M1-I5 WeakPolarHBondContact O-CG1 3.03Å; S2-I5 PolarHBondContact O-N 3.42Å; L3-I5 VanDerWaalsContact C-N 3.31Å; L3-I5 PolarHBondContact O-N 3.43Å; I5-N7 PolarHBondContact O-N 3.49Å; I5-T8 VanDerWaalsContact C-OG1 3.32Å; I5-T8 VanDerWaalsContact CA-OG1 3.31Å; I5-T8 WeakPolarHBondContact CA-OG1 3.23Å; I5-T8 PolarHBondContact O-N 2.92Å; I5-T8 VanDerWaalsContact O-N 3.12Å; I5-T8 PolarHBondContact O-OG1 3.48Å; I5-V9 WeakPolarHBondContact O-CG2 3.31Å; I5-V9 PolarHBondContact O-N 2.94Å
6	I	79.4	Confident	81.4	Confident	95 Å²	95	102.7 Å²	102.7	49%	0.487	55%	0.549	S	S	.	.	H	α-helix	trans	-59.5	-48.1	176.3	-65.8	164.6	0	0	0	110.6	S2 L3 T8 V9 D10	S2-I6 WeakPolarHBondContact O-CG1 3.38Å; S2-I6 PolarHBondContact O-N 2.97Å; S2-I6 VanDerWaalsContact O-N 3.09Å; L3-I6 PolarHBondContact O-N 3.36Å; I6-T8 PolarHBondContact O-N 3.13Å; I6-V9 PolarHBondContact O-N 3.06Å; I6-D10 PolarHBondContact O-N 3.36Å
7	N	79.6	Confident	82	Confident	89 Å²	89	103.1 Å²	103.1	48%	0.476	55%	0.547	S	S	.	.	H	α-helix	trans	-60.2	-32.1	175.8	-73.7	-25.4	0	0	0	113	L3 E4 I5 K11	L3-N7 PolarHBondContact O-N 2.63Å; L3-N7 PolarHBondContact O-ND2 3.36Å; E4-N7 PolarHBondContact O-N 3.31Å; I5-N7 PolarHBondContact O-N 3.49Å; N7-K11 VanDerWaalsContact O-CG 3.23Å; N7-K11 WeakPolarHBondContact O-CG 3.33Å; N7-K11 PolarHBondContact O-N 2.98Å
8	T	81.4	Confident	82.7	Confident	72 Å²	72	101.6 Å²	101.6	44%	0.442	54%	0.538	S	S	.	.	H	α-helix	trans	-72.7	-37.2	173.6	54.2	0	0	0	0	112.7	E4 I5 I6 K11 L12	E4-T8 WeakPolarHBondContact O-CG2 3.38Å; E4-T8 PolarHBondContact O-N 3.09Å; E4-T8 PolarHBondContact O-OG1 3.18Å; I5-T8 VanDerWaalsContact C-OG1 3.32Å; I5-T8 VanDerWaalsContact CA-OG1 3.31Å; I5-T8 WeakPolarHBondContact CA-OG1 3.23Å; I5-T8 PolarHBondContact O-N 2.92Å; I5-T8 VanDerWaalsContact O-N 3.12Å; I5-T8 PolarHBondContact O-OG1 3.48Å; I6-T8 PolarHBondContact O-N 3.13Å; T8-K11 PolarHBondContact O-N 3.44Å; T8-L12 WeakPolarHBondContact O-CG 3.35Å; T8-L12 PolarHBondContact O-N 3.05Å
9	V	81.6	Confident	83.3	Confident	73 Å²	73	101.1 Å²	101.1	44%	0.442	53%	0.532	S	S	.	.	H	α-helix	trans	-65.6	-44	175.2	173.1	0	0	0	0	110.5	I5 I6 K11 L12 T13	I5-V9 WeakPolarHBondContact O-CG2 3.31Å; I5-V9 PolarHBondContact O-N 2.94Å; I6-V9 PolarHBondContact O-N 3.06Å; V9-K11 VanDerWaalsContact C-N 3.27Å; V9-K11 PolarHBondContact O-N 2.93Å; V9-L12 WeakPolarHBondContact O-CB 3.34Å; V9-L12 PolarHBondContact O-N 2.93Å; V9-T13 PolarHBondContact O-N 3.02Å; V9-T13 PolarHBondContact O-OG1 3.36Å
10	D	85.1	Confident	83.8	Confident	90 Å²	90	102.8 Å²	102.8	48%	0.481	54%	0.537	S	S	.	.	H	α-helix	trans	-63.6	-32.9	176.4	-68.8	-23.5	0	0	0	112.6	I6 T13 L14	I6-D10 PolarHBondContact O-N 3.36Å; D10-T13 WeakPolarHBondContact CA-OG1 3.4Å; D10-T13 PolarHBondContact O-OG1 2.84Å; D10-L14 WeakPolarHBondContact O-CB 3.25Å; D10-L14 PolarHBondContact O-N 3.06Å
11	K	86.4	Confident	84.4	Confident	149 Å²	149	104.4 Å²	104.4	65%	0.648	54%	0.542	S	S	*	.	H	α-helix	trans	-68.4	-37.2	171.5	-76.8	174.1	-177.5	-176.1	0	112.4	N7 T8 V9 S15	N7-K11 VanDerWaalsContact O-CG 3.23Å; N7-K11 WeakPolarHBondContact O-CG 3.33Å; N7-K11 PolarHBondContact O-N 2.98Å; T8-K11 PolarHBondContact O-N 3.44Å; V9-K11 VanDerWaalsContact C-N 3.27Å; V9-K11 PolarHBondContact O-N 2.93Å; K11-S15 WeakPolarHBondContact O-CB 3.41Å; K11-S15 PolarHBondContact O-N 2.9Å
12	L	84.9	Confident	86.4	Confident	112 Å²	112	100.5 Å²	100.5	59%	0.586	52%	0.52	S	S	*	.	H	α-helix	trans	-68.2	-44	176.8	-72.2	168.6	0	0	0	111.1	T8 V9 L14 S15 D16	T8-L12 WeakPolarHBondContact O-CG 3.35Å; T8-L12 PolarHBondContact O-N 3.05Å; V9-L12 WeakPolarHBondContact O-CB 3.34Å; V9-L12 PolarHBondContact O-N 2.93Å; L12-L14 PolarHBondContact O-N 3.24Å; L12-S15 WeakPolarHBondContact O-CB 3.36Å; L12-S15 PolarHBondContact O-N 3.12Å; L12-S15 VanDerWaalsContact O-N 3.13Å; L12-D16 PolarHBondContact O-N 3.48Å
13	T	89.4	Confident	87.5	Confident	65 Å²	65	101.2 Å²	101.2	40%	0.399	52%	0.516	S	S	.	.	H	α-helix	trans	-64.4	-40	176.7	57	0	0	0	0	112.2	V9 D10 S15 D16 Q17	V9-T13 PolarHBondContact O-N 3.02Å; V9-T13 PolarHBondContact O-OG1 3.36Å; D10-T13 WeakPolarHBondContact CA-OG1 3.4Å; D10-T13 PolarHBondContact O-OG1 2.84Å; T13-S15 VanDerWaalsContact C-N 3.33Å; T13-D16 PolarHBondContact O-N 3.27Å; T13-Q17 WeakPolarHBondContact O-CG 3.44Å; T13-Q17 PolarHBondContact O-N 3.5Å
14	L	89.9	Confident	88.4	Confident	94 Å²	94	98.2 Å²	98.2	49%	0.492	51%	0.506	S	S	.	.	H	α-helix	trans	-63	-39.7	172	-176.5	65.5	0	0	0	111.7	D10 L12 D16 Q17 I18	D10-L14 WeakPolarHBondContact O-CB 3.25Å; D10-L14 PolarHBondContact O-N 3.06Å; L12-L14 PolarHBondContact O-N 3.24Å; L14-D16 VanDerWaalsContact C-N 3.34Å; L14-Q17 PolarHBondContact O-N 3.03Å; L14-I18 HydrophobicContact CG-CD1 4.09Å; L14-I18 WeakPolarHBondContact O-CB 3.4Å; L14-I18 VanDerWaalsContact O-CG1 3.25Å; L14-I18 WeakPolarHBondContact O-CG1 3.5Å; L14-I18 PolarHBondContact O-N 3.23Å
15	S	91.2	Very high	89.4	Confident	67 Å²	67	95.5 Å²	95.5	47%	0.469	50%	0.496	S	S	.	.	H	α-helix	trans	-62	-41.3	175.2	-172.8	0	0	0	0	111.9	K11 L12 T13 I18 E19	K11-S15 WeakPolarHBondContact O-CB 3.41Å; K11-S15 PolarHBondContact O-N 2.9Å; L12-S15 WeakPolarHBondContact O-CB 3.36Å; L12-S15 PolarHBondContact O-N 3.12Å; L12-S15 VanDerWaalsContact O-N 3.13Å; T13-S15 VanDerWaalsContact C-N 3.33Å; S15-I18 PolarHBondContact O-N 3.44Å; S15-E19 PolarHBondContact O-N 2.95Å
16	D	92.4	Very high	90.2	Very high	102 Å²	102	95 Å²	95	55%	0.545	49%	0.494	S	S	.	.	H	α-helix	trans	-66.4	-40.6	176.5	-70.9	-19.3	0	0	0	111.7	L12 T13 L14 E19 Q20	L12-D16 PolarHBondContact O-N 3.48Å; T13-D16 PolarHBondContact O-N 3.27Å; L14-D16 VanDerWaalsContact C-N 3.34Å; D16-E19 PolarHBondContact O-N 3.35Å; D16-Q20 WeakPolarHBondContact O-CG 3.49Å; D16-Q20 PolarHBondContact O-N 2.95Å
17	Q	92.6	Very high	91	Very high	109 Å²	109	95.1 Å²	95.1	51%	0.509	50%	0.495	S	S	.	.	H	α-helix	trans	-61.7	-45.2	174.3	-73.9	174.4	-6	0	0	111.8	T13 L14 E19 Q20 E21	T13-Q17 WeakPolarHBondContact O-CG 3.44Å; T13-Q17 PolarHBondContact O-N 3.5Å; L14-Q17 PolarHBondContact O-N 3.03Å; Q17-E19 PolarHBondContact O-N 2.99Å; Q17-Q20 PolarHBondContact O-N 3.35Å; Q17-E21 WeakPolarHBondContact O-CG 3.32Å; Q17-E21 PolarHBondContact O-N 3.02Å
18	I	93.8	Very high	91.8	Very high	76 Å²	76	95.6 Å²	95.6	39%	0.39	50%	0.497	S	S	.	.	H	α-helix	trans	-59.2	-39.3	175.2	-72	166.4	0	0	0	110.6	L14 S15 E21 K22	L14-I18 HydrophobicContact CG-CD1 4.09Å; L14-I18 WeakPolarHBondContact O-CB 3.4Å; L14-I18 VanDerWaalsContact O-CG1 3.25Å; L14-I18 WeakPolarHBondContact O-CG1 3.5Å; L14-I18 PolarHBondContact O-N 3.23Å; S15-I18 PolarHBondContact O-N 3.44Å; I18-E21 PolarHBondContact O-N 3.24Å; I18-K22 WeakPolarHBondContact O-CG 3.42Å; I18-K22 PolarHBondContact O-N 3.39Å
19	E	94	Very high	92.6	Very high	92 Å²	92	99.6 Å²	99.6	43%	0.43	50%	0.504	S	S	.	.	H	α-helix	trans	-68.8	-40.2	178.1	-164.2	59.8	-158.3	0	0	112.3	S15 D16 Q17 E21 K22 I23	S15-E19 PolarHBondContact O-N 2.95Å; D16-E19 PolarHBondContact O-N 3.35Å; Q17-E19 PolarHBondContact O-N 2.99Å; E19-E21 PolarHBondContact O-N 3.32Å; E19-K22 WeakPolarHBondContact O-CB 3.42Å; E19-K22 PolarHBondContact O-N 3.07Å; E19-K22 WeakPolarHBondContact OE2-CD 3.49Å; E19-K22 IonicContact OE2-NZ 2.84Å; E19-K22 PolarHBondContact OE2-NZ 3.48Å; E19-I23 WeakPolarHBondContact O-CG1 3.38Å; E19-I23 PolarHBondContact O-N 2.94Å
20	Q	94.2	Very high	93.3	Very high	136 Å²	136	100.7 Å²	100.7	64%	0.636	51%	0.505	S	S	*	.	H	α-helix	trans	-61.8	-41.7	172.7	-71.3	178.1	1.6	0	0	112.3	D16 Q17 K22 I23 S24	D16-Q20 WeakPolarHBondContact O-CG 3.49Å; D16-Q20 PolarHBondContact O-N 2.95Å; Q17-Q20 PolarHBondContact O-N 3.35Å; Q20-K22 VanDerWaalsContact C-N 3.34Å; Q20-K22 PolarHBondContact O-N 3.13Å; Q20-I23 PolarHBondContact O-N 3.23Å; Q20-S24 PolarHBondContact O-N 3.48Å
21	E	95.7	Very high	93.8	Very high	137 Å²	137	99.8 Å²	99.8	64%	0.64	50%	0.502	S	S	*	.	H	α-helix	trans	-62.2	-39.8	175	-74.8	-177.6	175.3	0	0	112	Q17 I18 E19 I23 S24 L25	Q17-E21 WeakPolarHBondContact O-CG 3.32Å; Q17-E21 PolarHBondContact O-N 3.02Å; I18-E21 PolarHBondContact O-N 3.24Å; E19-E21 PolarHBondContact O-N 3.32Å; E21-I23 VanDerWaalsContact C-N 3.35Å; E21-I23 PolarHBondContact O-N 3.46Å; E21-S24 PolarHBondContact O-N 3.47Å; E21-L25 WeakPolarHBondContact O-CB 3.39Å; E21-L25 PolarHBondContact O-N 2.95Å
22	K	96.3	Very high	94.4	Very high	111 Å²	111	97 Å²	97	48%	0.483	49%	0.494	S	S	.	.	H	α-helix	trans	-62.5	-40.3	173.8	-71.2	173.7	-163.9	159.5	0	112.4	I18 E19 Q20 L25 N26	I18-K22 WeakPolarHBondContact O-CG 3.42Å; I18-K22 PolarHBondContact O-N 3.39Å; E19-K22 WeakPolarHBondContact O-CB 3.42Å; E19-K22 PolarHBondContact O-N 3.07Å; E19-K22 WeakPolarHBondContact OE2-CD 3.49Å; E19-K22 IonicContact OE2-NZ 2.84Å; E19-K22 PolarHBondContact OE2-NZ 3.48Å; Q20-K22 VanDerWaalsContact C-N 3.34Å; Q20-K22 PolarHBondContact O-N 3.13Å; K22-L25 PolarHBondContact O-N 3.02Å; K22-N26 PolarHBondContact O-N 3.33Å
23	I	96.1	Very high	94.9	Very high	95 Å²	95	94.6 Å²	94.6	49%	0.487	49%	0.486	S	S	.	.	H	α-helix	trans	-63.7	-47.6	175.8	-66.4	165.9	0	0	0	109.9	E19 Q20 E21 L25 N26 L27	E19-I23 WeakPolarHBondContact O-CG1 3.38Å; E19-I23 PolarHBondContact O-N 2.94Å; Q20-I23 PolarHBondContact O-N 3.23Å; E21-I23 VanDerWaalsContact C-N 3.35Å; E21-I23 PolarHBondContact O-N 3.46Å; I23-L25 VanDerWaalsContact C-N 3.33Å; I23-L25 PolarHBondContact O-N 3.05Å; I23-N26 WeakPolarHBondContact O-CB 3.45Å; I23-N26 PolarHBondContact O-N 3.45Å; I23-N26 VanDerWaalsContact O-N 3.13Å; I23-L27 HydrophobicContact CG2-CD1 4.33Å; I23-L27 PolarHBondContact O-N 3.32Å
24	S	96.1	Very high	95.3	Very high	64 Å²	64	98 Å²	98	45%	0.448	50%	0.495	S	S	.	.	H	α-helix	trans	-58.4	-44.1	176.8	-173	0	0	0	0	111.9	Q20 E21 N26 L27 L28	Q20-S24 PolarHBondContact O-N 3.48Å; E21-S24 PolarHBondContact O-N 3.47Å; S24-N26 VanDerWaalsContact C-N 3.31Å; S24-N26 PolarHBondContact O-N 2.92Å; S24-L27 PolarHBondContact O-N 3.33Å; S24-L28 WeakPolarHBondContact O-CG 3.44Å; S24-L28 PolarHBondContact O-N 3.31Å
25	L	97.1	Very high	95.6	Very high	82 Å²	82	98.1 Å²	98.1	43%	0.429	50%	0.496	S	S	.	.	H	α-helix	trans	-59.9	-40.4	175.3	179.8	63.7	0	0	0	112.2	E21 K22 I23 L28 R29	E21-L25 WeakPolarHBondContact O-CB 3.39Å; E21-L25 PolarHBondContact O-N 2.95Å; K22-L25 PolarHBondContact O-N 3.02Å; I23-L25 VanDerWaalsContact C-N 3.33Å; I23-L25 PolarHBondContact O-N 3.05Å; L25-L28 PolarHBondContact O-N 2.84Å; L25-R29 VanDerWaalsContact O-CG 3.31Å; L25-R29 WeakPolarHBondContact O-CG 3.47Å; L25-R29 PolarHBondContact O-N 2.88Å
26	N	96.6	Very high	96	Very high	86 Å²	86	100.5 Å²	100.5	46%	0.46	50%	0.5	S	S	.	.	H	α-helix	trans	-65.5	-43.1	176.3	-167.9	-10.1	0	0	0	111.5	K22 I23 S24 L28 R29 Q30	K22-N26 PolarHBondContact O-N 3.33Å; I23-N26 WeakPolarHBondContact O-CB 3.45Å; I23-N26 PolarHBondContact O-N 3.45Å; I23-N26 VanDerWaalsContact O-N 3.13Å; S24-N26 VanDerWaalsContact C-N 3.31Å; S24-N26 PolarHBondContact O-N 2.92Å; N26-L28 PolarHBondContact O-N 3.22Å; N26-R29 WeakPolarHBondContact O-CB 3.34Å; N26-R29 PolarHBondContact O-N 2.98Å; N26-Q30 WeakPolarHBondContact O-CG 3.47Å; N26-Q30 PolarHBondContact O-N 3.21Å; N26-Q30 PolarHBondContact OD1-NE2 2.91Å
27	L	96.5	Very high	96.2	Very high	96 Å²	96	101.3 Å²	101.3	50%	0.503	50%	0.501	S	S	.	.	H	α-helix	trans	-61.8	-42.2	175.1	-70.1	171.7	0	0	0	112.2	I23 S24 R29 Q30 T31	I23-L27 HydrophobicContact CG2-CD1 4.33Å; I23-L27 PolarHBondContact O-N 3.32Å; S24-L27 PolarHBondContact O-N 3.33Å; L27-R29 VanDerWaalsContact C-N 3.34Å; L27-Q30 PolarHBondContact O-N 3.42Å; L27-T31 WeakPolarHBondContact O-CB 3.31Å; L27-T31 PolarHBondContact O-N 2.91Å; L27-T31 PolarHBondContact O-OG1 3.16Å
28	L	96.9	Very high	96.4	Very high	99 Å²	99	99 Å²	99	52%	0.518	50%	0.496	S	S	.	.	H	α-helix	trans	-61.8	-42.3	175	-74.6	172.1	0	0	0	111.6	S24 L25 N26 T31 N32	S24-L28 WeakPolarHBondContact O-CG 3.44Å; S24-L28 PolarHBondContact O-N 3.31Å; L25-L28 PolarHBondContact O-N 2.84Å; N26-L28 PolarHBondContact O-N 3.22Å; L28-T31 PolarHBondContact O-N 3.41Å; L28-N32 WeakPolarHBondContact O-CB 3.5Å; L28-N32 PolarHBondContact O-N 3.01Å
29	R	97.6	Very high	96.6	Very high	156 Å²	156	99.6 Å²	99.6	59%	0.589	50%	0.499	S	S	*	.	H	α-helix	trans	-61.1	-46.1	174.7	-74.7	171.9	174.7	175.5	-1.2	112.1	L25 N26 L27 T31 N32 C33	L25-R29 VanDerWaalsContact O-CG 3.31Å; L25-R29 WeakPolarHBondContact O-CG 3.47Å; L25-R29 PolarHBondContact O-N 2.88Å; N26-R29 WeakPolarHBondContact O-CB 3.34Å; N26-R29 PolarHBondContact O-N 2.98Å; L27-R29 VanDerWaalsContact C-N 3.34Å; R29-T31 VanDerWaalsContact C-N 3.29Å; R29-T31 PolarHBondContact O-N 3.27Å; R29-N32 PolarHBondContact O-N 2.99Å; R29-C33 PolarHBondContact O-N 3.45Å; R29-C33 PolarHBondContact O-SG 3.5Å; R29-C33 VanDerWaalsContact O-SG 3.32Å
30	Q	96.4	Very high	96.7	Very high	97 Å²	97	99.5 Å²	99.5	45%	0.453	50%	0.502	S	S	.	.	H	α-helix	trans	-62.5	-37.2	176.3	-69.6	173.9	23.2	0	0	112.3	N26 L27 C33 K34	N26-Q30 WeakPolarHBondContact O-CG 3.47Å; N26-Q30 PolarHBondContact O-N 3.21Å; N26-Q30 PolarHBondContact OD1-NE2 2.91Å; L27-Q30 PolarHBondContact O-N 3.42Å; Q30-C33 PolarHBondContact O-N 3.37Å; Q30-K34 WeakPolarHBondContact O-CG 3.49Å; Q30-K34 PolarHBondContact O-N 2.79Å; Q30-K34 VanDerWaalsContact O-N 3.16Å
31	T	96.7	Very high	96.8	Very high	71 Å²	71	97.6 Å²	97.6	44%	0.436	50%	0.495	S	S	.	.	H	α-helix	trans	-68.8	-42.3	178	-55.3	0	0	0	0	110.8	L27 L28 R29 C33 K34 L35	L27-T31 WeakPolarHBondContact O-CB 3.31Å; L27-T31 PolarHBondContact O-N 2.91Å; L27-T31 PolarHBondContact O-OG1 3.16Å; L28-T31 PolarHBondContact O-N 3.41Å; R29-T31 VanDerWaalsContact C-N 3.29Å; R29-T31 PolarHBondContact O-N 3.27Å; T31-C33 PolarHBondContact O-N 2.88Å; T31-K34 PolarHBondContact O-N 3.5Å; T31-L35 HydrophobicContact CG2-CD1 4.33Å; T31-L35 WeakPolarHBondContact O-CG 3.45Å; T31-L35 PolarHBondContact O-N 3.34Å
32	N	97.1	Very high	96.9	Very high	89 Å²	89	96.2 Å²	96.2	48%	0.476	49%	0.491	S	S	.	.	H	α-helix	trans	-59.9	-45.1	174.2	-76.4	-8.5	0	0	0	111.5	L28 R29 K34 L35 E36	L28-N32 WeakPolarHBondContact O-CB 3.5Å; L28-N32 PolarHBondContact O-N 3.01Å; R29-N32 PolarHBondContact O-N 2.99Å; N32-K34 VanDerWaalsContact C-N 3.3Å; N32-K34 PolarHBondContact O-N 2.9Å; N32-L35 WeakPolarHBondContact O-CB 3.4Å; N32-L35 PolarHBondContact O-N 2.99Å; N32-L35 VanDerWaalsContact O-N 3.09Å; N32-E36 WeakPolarHBondContact O-CG 3.3Å; N32-E36 PolarHBondContact O-N 3.2Å
33	C	96.8	Very high	96.8	Very high	63 Å²	63	96.6 Å²	96.6	43%	0.426	50%	0.495	S	S	.	.	H	α-helix	trans	-58.6	-41.3	175.8	-65.2	0	0	0	0	112.3	R29 Q30 T31 L35 E36 E37	R29-C33 PolarHBondContact O-N 3.45Å; R29-C33 PolarHBondContact O-SG 3.5Å; R29-C33 VanDerWaalsContact O-SG 3.32Å; Q30-C33 PolarHBondContact O-N 3.37Å; T31-C33 PolarHBondContact O-N 2.88Å; C33-L35 VanDerWaalsContact C-N 3.33Å; C33-L35 PolarHBondContact O-N 3.47Å; C33-E36 PolarHBondContact O-N 3.01Å; C33-E37 WeakPolarHBondContact O-CG 3.39Å; C33-E37 PolarHBondContact O-N 2.78Å
34	K	97.1	Very high	96.7	Very high	135 Å²	135	97.7 Å²	97.7	59%	0.587	50%	0.502	S	S	*	.	H	α-helix	trans	-67.9	-32	176.4	-71.2	178.5	179.7	-179.8	0	113.3	Q30 T31 N32 S38	Q30-K34 WeakPolarHBondContact O-CG 3.49Å; Q30-K34 PolarHBondContact O-N 2.79Å; Q30-K34 VanDerWaalsContact O-N 3.16Å; T31-K34 PolarHBondContact O-N 3.5Å; N32-K34 VanDerWaalsContact C-N 3.3Å; N32-K34 PolarHBondContact O-N 2.9Å; K34-S38 WeakPolarHBondContact O-CB 3.5Å; K34-S38 PolarHBondContact O-N 2.97Å; K34-S38 PolarHBondContact O-OG 3.09Å
35	L	97.5	Very high	96.5	Very high	97 Å²	97	99.9 Å²	99.9	51%	0.508	51%	0.505	S	S	.	.	H	α-helix	trans	-71.2	-40.7	175.5	-74.1	172.4	0	0	0	110.8	T31 N32 C33 S38 I39	T31-L35 HydrophobicContact CG2-CD1 4.33Å; T31-L35 WeakPolarHBondContact O-CG 3.45Å; T31-L35 PolarHBondContact O-N 3.34Å; N32-L35 WeakPolarHBondContact O-CB 3.4Å; N32-L35 PolarHBondContact O-N 2.99Å; N32-L35 VanDerWaalsContact O-N 3.09Å; C33-L35 VanDerWaalsContact C-N 3.33Å; C33-L35 PolarHBondContact O-N 3.47Å; L35-S38 PolarHBondContact O-N 3.3Å; L35-I39 VanDerWaalsContact O-CG1 3.29Å; L35-I39 WeakPolarHBondContact O-CG1 3.29Å; L35-I39 PolarHBondContact O-N 3.41Å
36	E	97.7	Very high	96.2	Very high	118 Å²	118	100.8 Å²	100.8	55%	0.551	51%	0.51	S	S	*	.	H	α-helix	trans	-57.7	-50.6	171.4	-70.8	169.2	170.3	0	0	110.5	N32 C33 S38 I39 D40	N32-E36 WeakPolarHBondContact O-CG 3.3Å; N32-E36 PolarHBondContact O-N 3.2Å; C33-E36 PolarHBondContact O-N 3.01Å; E36-S38 VanDerWaalsContact C-N 3.26Å; E36-S38 PolarHBondContact O-N 3.13Å; E36-I39 WeakPolarHBondContact O-CB 3.43Å; E36-I39 PolarHBondContact O-N 2.96Å; E36-I39 VanDerWaalsContact O-N 3.09Å; E36-D40 PolarHBondContact O-N 3.32Å
37	E	97.2	Very high	95.8	Very high	119 Å²	119	99.4 Å²	99.4	56%	0.556	51%	0.51	S	S	*	.	H	α-helix	trans	-57.4	-38	174.7	-71.6	170.7	-176.6	0	0	112.6	C33 I41	C33-E37 WeakPolarHBondContact O-CG 3.39Å; C33-E37 PolarHBondContact O-N 2.78Å; E37-I41 WeakPolarHBondContact O-CD1 3.28Å; E37-I41 VanDerWaalsContact O-CG1 3.3Å; E37-I41 WeakPolarHBondContact O-CG1 3.42Å; E37-I41 PolarHBondContact O-N 3.23Å; E37-I41 VanDerWaalsContact O-N 3.13Å
38	S	97.3	Very high	95.2	Very high	59 Å²	59	98 Å²	98	41%	0.413	51%	0.508	S	S	.	.	H	α-helix	trans	-71.4	-34.3	178.7	-60.3	0	0	0	0	112.3	K34 L35 E36 L42	K34-S38 WeakPolarHBondContact O-CB 3.5Å; K34-S38 PolarHBondContact O-N 2.97Å; K34-S38 PolarHBondContact O-OG 3.09Å; L35-S38 PolarHBondContact O-N 3.3Å; E36-S38 VanDerWaalsContact C-N 3.26Å; E36-S38 PolarHBondContact O-N 3.13Å; S38-L42 VanDerWaalsContact O-CG 3.28Å; S38-L42 WeakPolarHBondContact O-CG 3.41Å; S38-L42 PolarHBondContact O-N 2.89Å; S38-L42 VanDerWaalsContact O-N 3.15Å
39	I	97.4	Very high	94.5	Very high	89 Å²	89	98.2 Å²	98.2	46%	0.456	51%	0.509	S	S	.	.	H	α-helix	trans	-65.5	-48.1	174	-71.9	164.2	0	0	0	109.1	L35 E36 I41 L42 E43	L35-I39 VanDerWaalsContact O-CG1 3.29Å; L35-I39 WeakPolarHBondContact O-CG1 3.29Å; L35-I39 PolarHBondContact O-N 3.41Å; E36-I39 WeakPolarHBondContact O-CB 3.43Å; E36-I39 PolarHBondContact O-N 2.96Å; E36-I39 VanDerWaalsContact O-N 3.09Å; I39-I41 VanDerWaalsContact C-N 3.31Å; I39-I41 PolarHBondContact O-N 2.96Å; I39-L42 PolarHBondContact O-N 3.03Å; I39-E43 HydrophobicContact CG2-CG 4.23Å; I39-E43 WeakPolarHBondContact O-CG 3.48Å; I39-E43 PolarHBondContact O-N 2.86Å
40	D	97	Very high	93.4	Very high	90 Å²	90	96.7 Å²	96.7	48%	0.481	51%	0.509	S	S	.	.	H	α-helix	trans	-55.4	-45.7	178.2	-66	-15.2	0	0	0	111.3	E36 L42 E43 D44	E36-D40 PolarHBondContact O-N 3.32Å; D40-L42 VanDerWaalsContact C-N 3.34Å; D40-L42 PolarHBondContact O-N 3.09Å; D40-E43 PolarHBondContact O-N 3.24Å; D40-D44 PolarHBondContact O-N 3.02Å
41	I	96.6	Very high	92.3	Very high	97 Å²	97	97.5 Å²	97.5	50%	0.497	52%	0.516	S	S	.	.	H	α-helix	trans	-61.7	-40.9	176.8	-68.3	164.5	0	0	0	112	E37 I39 D44 Q45	E37-I41 WeakPolarHBondContact O-CD1 3.28Å; E37-I41 VanDerWaalsContact O-CG1 3.3Å; E37-I41 WeakPolarHBondContact O-CG1 3.42Å; E37-I41 PolarHBondContact O-N 3.23Å; E37-I41 VanDerWaalsContact O-N 3.13Å; I39-I41 VanDerWaalsContact C-N 3.31Å; I39-I41 PolarHBondContact O-N 2.96Å; I41-D44 PolarHBondContact O-N 3.5Å; I41-Q45 WeakPolarHBondContact O-CG 3.32Å; I41-Q45 PolarHBondContact O-N 3.15Å
42	L	96.2	Very high	91.2	Very high	107 Å²	107	98.5 Å²	98.5	56%	0.56	52%	0.516	S	S	*	.	H	α-helix	trans	-71	-35.2	179.7	-72.6	172.5	0	0	0	111.8	S38 I39 D40 Q45 L46	S38-L42 VanDerWaalsContact O-CG 3.28Å; S38-L42 WeakPolarHBondContact O-CG 3.41Å; S38-L42 PolarHBondContact O-N 2.89Å; S38-L42 VanDerWaalsContact O-N 3.15Å; I39-L42 PolarHBondContact O-N 3.03Å; D40-L42 VanDerWaalsContact C-N 3.34Å; D40-L42 PolarHBondContact O-N 3.09Å; L42-Q45 PolarHBondContact O-N 3.26Å; L42-L46 WeakPolarHBondContact O-CB 3.48Å; L42-L46 PolarHBondContact O-N 3.31Å
43	E	95.3	Very high	90.3	Very high	119 Å²	119	99.3 Å²	99.3	56%	0.556	52%	0.52	S	S	*	.	H	α-helix	trans	-65.2	-42.8	173.6	-71.4	-176.7	166.3	0	0	111.1	I39 D40 Q45 L46 A47	I39-E43 HydrophobicContact CG2-CG 4.23Å; I39-E43 WeakPolarHBondContact O-CG 3.48Å; I39-E43 PolarHBondContact O-N 2.86Å; D40-E43 PolarHBondContact O-N 3.24Å; E43-Q45 PolarHBondContact O-N 3.4Å; E43-L46 PolarHBondContact O-N 2.95Å; E43-A47 PolarHBondContact O-N 3.04Å
44	D	93.1	Very high	89.6	Confident	119 Å²	119	100.5 Å²	100.5	64%	0.636	52%	0.522	S	S	*	.	H	α-helix	trans	-61	-43	173.3	-78.9	-15.6	0	0	0	112	D40 I41 A47 S48	D40-D44 PolarHBondContact O-N 3.02Å; I41-D44 PolarHBondContact O-N 3.5Å; D44-A47 PolarHBondContact O-N 3.39Å; D44-S48 PolarHBondContact O-N 3.48Å
45	Q	93	Very high	89	Confident	109 Å²	109	98.3 Å²	98.3	51%	0.509	51%	0.514	S	S	.	.	H	α-helix	trans	-64.3	-40.4	175.9	-75.5	179.2	-9.6	0	0	112.2	I41 L42 E43 S48 I49	I41-Q45 WeakPolarHBondContact O-CG 3.32Å; I41-Q45 PolarHBondContact O-N 3.15Å; L42-Q45 PolarHBondContact O-N 3.26Å; E43-Q45 PolarHBondContact O-N 3.4Å; Q45-S48 WeakPolarHBondContact O-CB 3.39Å; Q45-S48 PolarHBondContact O-N 3.34Å; Q45-I49 WeakPolarHBondContact O-CG1 3.38Å; Q45-I49 PolarHBondContact O-N 3.48Å; Q45-I49 VanDerWaalsContact O-N 3.1Å
46	L	90.6	Very high	88.5	Confident	102 Å²	102	101.3 Å²	101.3	53%	0.534	52%	0.519	S	S	.	.	H	α-helix	trans	-63.2	-44.6	176.8	-175.8	66	0	0	0	111	L42 E43 S48 I49 E50	L42-L46 WeakPolarHBondContact O-CB 3.48Å; L42-L46 PolarHBondContact O-N 3.31Å; E43-L46 PolarHBondContact O-N 2.95Å; L46-S48 VanDerWaalsContact C-N 3.29Å; L46-S48 PolarHBondContact O-N 3.13Å; L46-I49 PolarHBondContact O-N 3.34Å; L46-I49 VanDerWaalsContact O-N 3.13Å; L46-E50 PolarHBondContact O-N 3.5Å
47	A	86.9	Confident	88.1	Confident	56 Å²	56	101.8 Å²	101.8	46%	0.463	52%	0.519	S	S	.	.	H	α-helix	trans	-60.3	-38.8	176	0	0	0	0	0	112.2	E43 D44 I49 E50 D51	E43-A47 PolarHBondContact O-N 3.04Å; D44-A47 PolarHBondContact O-N 3.39Å; A47-I49 PolarHBondContact O-N 3.1Å; A47-E50 PolarHBondContact O-N 2.91Å; A47-D51 PolarHBondContact O-N 3.41Å
48	S	83.9	Confident	87.6	Confident	67 Å²	67	99.8 Å²	99.8	47%	0.469	52%	0.515	S	S	.	.	H	α-helix	trans	-63.6	-38.6	174.7	-173	0	0	0	0	112.7	D44 Q45 L46 D51 E52	D44-S48 PolarHBondContact O-N 3.48Å; Q45-S48 WeakPolarHBondContact O-CB 3.39Å; Q45-S48 PolarHBondContact O-N 3.34Å; L46-S48 VanDerWaalsContact C-N 3.29Å; L46-S48 PolarHBondContact O-N 3.13Å; S48-D51 PolarHBondContact O-N 3.37Å; S48-E52 PolarHBondContact O-N 3.22Å; S48-E52 VanDerWaalsContact O-N 3.11Å
49	I	82.3	Confident	87.3	Confident	103 Å²	103	103.7 Å²	103.7	53%	0.528	52%	0.521	S	S	.	.	H	α-helix	trans	-68.4	-37.9	178.1	-67.9	165.7	0	0	0	110.9	Q45 L46 A47 D51 E52 D53	Q45-I49 WeakPolarHBondContact O-CG1 3.38Å; Q45-I49 PolarHBondContact O-N 3.48Å; Q45-I49 VanDerWaalsContact O-N 3.1Å; L46-I49 PolarHBondContact O-N 3.34Å; L46-I49 VanDerWaalsContact O-N 3.13Å; A47-I49 PolarHBondContact O-N 3.1Å; I49-D51 VanDerWaalsContact C-N 3.27Å; I49-D51 PolarHBondContact O-N 3.14Å; I49-E52 PolarHBondContact O-N 3.2Å; I49-D53 PolarHBondContact O-N 3.11Å
50	E	74.7	Confident	87	Confident	125 Å²	125	106.5 Å²	106.5	58%	0.584	53%	0.526	S	S	*	.	H	α-helix	trans	-62.6	-35	175.6	-70.6	-173.7	168.4	0	0	112.2	L46 A47 N54	L46-E50 PolarHBondContact O-N 3.5Å; A47-E50 PolarHBondContact O-N 2.91Å; E50-N54 PolarHBondContact O-N 3.35Å; E50-N54 PolarHBondContact O-ND2 3.41Å
51	D	74.9	Confident	86.7	Confident	114 Å²	114	106.8 Å²	106.8	61%	0.61	53%	0.528	S	S	*	.	H	α-helix	trans	-70	-38.8	173.3	-161.1	28.4	0	0	0	112	A47 S48 I49 D53 N54 E55	A47-D51 PolarHBondContact O-N 3.41Å; S48-D51 PolarHBondContact O-N 3.37Å; I49-D51 VanDerWaalsContact C-N 3.27Å; I49-D51 PolarHBondContact O-N 3.14Å; D51-D53 VanDerWaalsContact C-N 3.35Å; D51-D53 PolarHBondContact O-N 3.34Å; D51-N54 WeakPolarHBondContact O-CB 3.41Å; D51-N54 PolarHBondContact O-N 3.37Å; D51-N54 VanDerWaalsContact O-N 3.17Å; D51-E55 PolarHBondContact O-N 3.49Å
52	E	73.5	Confident	86.4	Confident	92 Å²	92	106.4 Å²	106.4	43%	0.43	53%	0.526	S	S	.	.	H	α-helix	trans	-61.1	-39.7	173.4	-73.1	-172.9	-177.6	0	0	112.7	S48 I49 N54 E55 W56	S48-E52 PolarHBondContact O-N 3.22Å; S48-E52 VanDerWaalsContact O-N 3.11Å; I49-E52 PolarHBondContact O-N 3.2Å; E52-N54 VanDerWaalsContact C-N 3.29Å; E52-N54 PolarHBondContact O-N 3.43Å; E52-E55 PolarHBondContact O-N 3.37Å; E52-E55 VanDerWaalsContact O-N 3.12Å; E52-W56 VanDerWaalsContact O-CD1 3.25Å; E52-W56 PolarHBondContact O-N 3.4Å
53	D	77.7	Confident	86.3	Confident	105 Å²	105	105.9 Å²	105.9	56%	0.561	52%	0.52	S	S	*	.	H	α-helix	trans	-61.4	-39.7	175.2	-171.3	56.1	0	0	0	111.2	I49 D51 W56 K57	I49-D53 PolarHBondContact O-N 3.11Å; D51-D53 VanDerWaalsContact C-N 3.35Å; D51-D53 PolarHBondContact O-N 3.34Å; D53-W56 PolarHBondContact O-N 2.93Å; D53-K57 VanDerWaalsContact O-CB 3.29Å; D53-K57 WeakPolarHBondContact O-CB 3.4Å; D53-K57 PolarHBondContact O-N 3.17Å
54	N	81.9	Confident	86.3	Confident	88 Å²	88	105.2 Å²	105.2	47%	0.471	52%	0.515	S	S	.	.	H	α-helix	trans	-64.2	-40.3	173	-73.9	-40	0	0	0	112.1	E50 D51 E52 T58	E50-N54 PolarHBondContact O-N 3.35Å; E50-N54 PolarHBondContact O-ND2 3.41Å; D51-N54 WeakPolarHBondContact O-CB 3.41Å; D51-N54 PolarHBondContact O-N 3.37Å; D51-N54 VanDerWaalsContact O-N 3.17Å; E52-N54 VanDerWaalsContact C-N 3.29Å; E52-N54 PolarHBondContact O-N 3.43Å; N54-T58 WeakPolarHBondContact O-CB 3.49Å; N54-T58 PolarHBondContact O-N 2.92Å; N54-T58 PolarHBondContact O-OG1 3.3Å
55	E	84.2	Confident	86.2	Confident	90 Å²	90	106.1 Å²	106.1	42%	0.421	52%	0.516	S	S	.	.	H	α-helix	trans	-64.7	-46	177.6	-161.4	-167.6	-177.9	0	0	111.1	D51 E52 K57 T58 R59	D51-E55 PolarHBondContact O-N 3.49Å; E52-E55 PolarHBondContact O-N 3.37Å; E52-E55 VanDerWaalsContact O-N 3.12Å; E55-K57 VanDerWaalsContact C-N 3.34Å; E55-K57 PolarHBondContact O-N 3.06Å; E55-T58 WeakPolarHBondContact O-CB 3.35Å; E55-T58 PolarHBondContact O-N 3.13Å; E55-T58 VanDerWaalsContact O-N 3.16Å; E55-R59 WeakPolarHBondContact O-CB 3.39Å; E55-R59 WeakPolarHBondContact O-CG 3.46Å; E55-R59 PolarHBondContact O-N 3.5Å; E55-R59 IonicContact OE1-CZ 2.64Å; E55-R59 IonicContact OE1-NE 3.86Å; E55-R59 PolarHBondContact OE1-NE 3.04Å; E55-R59 VanDerWaalsContact OE1-NE 3.07Å; E55-R59 IonicContact OE1-NH2 3.07Å; E55-R59 PolarHBondContact OE1-NH2 3.35Å; E55-R59 IonicContact OE2-CZ 3.17Å; E55-R59 IonicContact OE2-NE 3.2Å; E55-R59 IonicContact OE2-NH2 3.88Å; E55-R59 PolarHBondContact OE2-NH2 2.85Å; E55-R59 VanDerWaalsContact OE2-NH2 3.17Å
56	W	88.2	Confident	86.2	Confident	160 Å²	160	104.7 Å²	104.7	61%	0.606	51%	0.51	S	S	*	.	H	α-helix	trans	-64.9	-40.3	-179.9	-69.7	14.5	0	0	0	111.5	E52 D53 T58 R59 Y60	E52-W56 VanDerWaalsContact O-CD1 3.25Å; E52-W56 PolarHBondContact O-N 3.4Å; D53-W56 PolarHBondContact O-N 2.93Å; W56-T58 VanDerWaalsContact C-N 3.33Å; W56-T58 PolarHBondContact O-N 3.17Å; W56-R59 PolarHBondContact O-N 3.29Å; W56-Y60 VanDerWaalsContact O-CB 3.31Å; W56-Y60 WeakPolarHBondContact O-CB 3.48Å; W56-Y60 PolarHBondContact O-N 3.44Å
57	K	87.6	Confident	86.4	Confident	128 Å²	128	103.2 Å²	103.2	56%	0.557	50%	0.503	S	S	*	.	H	α-helix	trans	-61.7	-42.1	173.2	-172.4	175.8	-178	178.4	0	111.5	D53 E55 Y60 L61	D53-K57 VanDerWaalsContact O-CB 3.29Å; D53-K57 WeakPolarHBondContact O-CB 3.4Å; D53-K57 PolarHBondContact O-N 3.17Å; E55-K57 VanDerWaalsContact C-N 3.34Å; E55-K57 PolarHBondContact O-N 3.06Å; K57-Y60 PolarHBondContact O-N 3.14Å; K57-L61 VanDerWaalsContact O-CG 3.29Å; K57-L61 WeakPolarHBondContact O-CG 3.37Å; K57-L61 PolarHBondContact O-N 3.15Å
58	T	87.4	Confident	86.7	Confident	77 Å²	77	103.2 Å²	103.2	47%	0.472	50%	0.495	S	S	.	.	H	α-helix	trans	-64.3	-48.5	176.4	-59.3	0	0	0	0	111.2	N54 E55 W56 Y60 L61 I62	N54-T58 WeakPolarHBondContact O-CB 3.49Å; N54-T58 PolarHBondContact O-N 2.92Å; N54-T58 PolarHBondContact O-OG1 3.3Å; E55-T58 WeakPolarHBondContact O-CB 3.35Å; E55-T58 PolarHBondContact O-N 3.13Å; E55-T58 VanDerWaalsContact O-N 3.16Å; W56-T58 VanDerWaalsContact C-N 3.33Å; W56-T58 PolarHBondContact O-N 3.17Å; T58-Y60 VanDerWaalsContact C-N 3.31Å; T58-Y60 PolarHBondContact O-N 2.64Å; T58-L61 PolarHBondContact O-N 3.07Å; T58-L61 VanDerWaalsContact O-N 3.17Å; T58-I62 HydrophobicContact CG2-CD1 4.05Å; T58-I62 WeakPolarHBondContact O-CG1 3.5Å; T58-I62 PolarHBondContact O-N 2.88Å
59	R	90.7	Very high	87.2	Confident	141 Å²	141	106.9 Å²	106.9	53%	0.532	50%	0.5	S	S	.	.	H	α-helix	trans	-57.9	-43.1	175.6	-71.7	177.4	-176.1	-174.2	3.8	111.5	E55 W56 I62 Q63	E55-R59 WeakPolarHBondContact O-CB 3.39Å; E55-R59 WeakPolarHBondContact O-CG 3.46Å; E55-R59 PolarHBondContact O-N 3.5Å; E55-R59 IonicContact OE1-CZ 2.64Å; E55-R59 IonicContact OE1-NE 3.86Å; E55-R59 PolarHBondContact OE1-NE 3.04Å; E55-R59 VanDerWaalsContact OE1-NE 3.07Å; E55-R59 IonicContact OE1-NH2 3.07Å; E55-R59 PolarHBondContact OE1-NH2 3.35Å; E55-R59 IonicContact OE2-CZ 3.17Å; E55-R59 IonicContact OE2-NE 3.2Å; E55-R59 IonicContact OE2-NH2 3.88Å; E55-R59 PolarHBondContact OE2-NH2 2.85Å; E55-R59 VanDerWaalsContact OE2-NH2 3.17Å; W56-R59 PolarHBondContact O-N 3.29Å; R59-I62 PolarHBondContact O-N 2.81Å; R59-Q63 WeakPolarHBondContact O-CB 3.29Å; R59-Q63 PolarHBondContact O-N 3Å
60	Y	90.9	Very high	87.7	Confident	147 Å²	147	107.3 Å²	107.3	58%	0.576	50%	0.496	S	S	*	.	H	α-helix	trans	-60.6	-45.7	175.9	171.4	-97.3	0	0	0	112.1	W56 K57 T58 Q63 K64	W56-Y60 VanDerWaalsContact O-CB 3.31Å; W56-Y60 WeakPolarHBondContact O-CB 3.48Å; W56-Y60 PolarHBondContact O-N 3.44Å; K57-Y60 PolarHBondContact O-N 3.14Å; T58-Y60 VanDerWaalsContact C-N 3.31Å; T58-Y60 PolarHBondContact O-N 2.64Å; Y60-Q63 PolarHBondContact O-N 3.34Å; Y60-K64 HydrophobicContact CE1-CD 4.32Å; Y60-K64 WeakPolarHBondContact O-CB 3.47Å; Y60-K64 PolarHBondContact O-N 2.8Å
61	L	91.5	Very high	88.7	Confident	97 Å²	97	107.7 Å²	107.7	51%	0.508	50%	0.495	S	S	.	.	H	α-helix	trans	-64.1	-43.2	179.6	-71.3	173.6	0	0	0	111.9	K57 T58 K64 E65	K57-L61 VanDerWaalsContact O-CG 3.29Å; K57-L61 WeakPolarHBondContact O-CG 3.37Å; K57-L61 PolarHBondContact O-N 3.15Å; T58-L61 PolarHBondContact O-N 3.07Å; T58-L61 VanDerWaalsContact O-N 3.17Å; L61-K64 WeakPolarHBondContact O-CB 3.22Å; L61-K64 PolarHBondContact O-N 3.46Å; L61-E65 PolarHBondContact O-N 3.47Å
62	I	90.6	Very high	89.5	Confident	89 Å²	89	109.8 Å²	109.8	46%	0.456	49%	0.494	S	S	.	.	H	α-helix	trans	-61	-47.7	174.8	-66.4	168.4	0	0	0	110.3	T58 R59 K64 E65 M66	T58-I62 HydrophobicContact CG2-CD1 4.05Å; T58-I62 WeakPolarHBondContact O-CG1 3.5Å; T58-I62 PolarHBondContact O-N 2.88Å; R59-I62 PolarHBondContact O-N 2.81Å; I62-K64 VanDerWaalsContact C-N 3.27Å; I62-K64 PolarHBondContact O-N 3.42Å; I62-E65 PolarHBondContact O-N 2.95Å; I62-E65 VanDerWaalsContact O-N 3.16Å; I62-M66 HydrophobicContact CG2-CG 4.44Å; I62-M66 HydrophobicContact CG2-SD 4.21Å; I62-M66 WeakPolarHBondContact O-CG 3.29Å; I62-M66 PolarHBondContact O-N 3.25Å
63	Q	93.8	Very high	90.3	Very high	96 Å²	96	107 Å²	107	45%	0.449	49%	0.488	S	S	.	.	H	α-helix	trans	-61.5	-38.2	179	-174.3	61.7	58.7	0	0	111.7	R59 Y60 N67	R59-Q63 WeakPolarHBondContact O-CB 3.29Å; R59-Q63 PolarHBondContact O-N 3Å; Y60-Q63 PolarHBondContact O-N 3.34Å; Q63-N67 PolarHBondContact NE2-OD1 2.93Å; Q63-N67 WeakPolarHBondContact O-CB 3.35Å; Q63-N67 PolarHBondContact O-N 3.16Å; Q63-N67 PolarHBondContact O-ND2 3.45Å; Q63-N67 PolarHBondContact O-OD1 3.12Å
64	K	94.4	Very high	90.9	Very high	104 Å²	104	109.1 Å²	109.1	45%	0.452	49%	0.492	S	S	.	.	H	α-helix	trans	-63	-45.6	175	-174.7	-179.8	177.6	-177.7	0	111.3	Y60 L61 I62 N67 D68	Y60-K64 HydrophobicContact CE1-CD 4.32Å; Y60-K64 WeakPolarHBondContact O-CB 3.47Å; Y60-K64 PolarHBondContact O-N 2.8Å; L61-K64 WeakPolarHBondContact O-CB 3.22Å; L61-K64 PolarHBondContact O-N 3.46Å; I62-K64 VanDerWaalsContact C-N 3.27Å; I62-K64 PolarHBondContact O-N 3.42Å; K64-N67 PolarHBondContact O-N 2.98Å; K64-D68 PolarHBondContact O-N 2.99Å
65	E	92.5	Very high	91.4	Very high	139 Å²	139	111.2 Å²	111.2	65%	0.65	50%	0.497	S	S	*	.	H	α-helix	trans	-61.8	-45.9	177.2	-174.2	177.8	-176.7	0	0	112	L61 I62 N67 D68 Y69	L61-E65 PolarHBondContact O-N 3.47Å; I62-E65 PolarHBondContact O-N 2.95Å; I62-E65 VanDerWaalsContact O-N 3.16Å; E65-N67 VanDerWaalsContact C-N 3.33Å; E65-N67 PolarHBondContact O-N 3.35Å; E65-D68 PolarHBondContact O-N 3.19Å; E65-Y69 PolarHBondContact O-N 3.44Å
66	M	92.5	Very high	91.5	Very high	79 Å²	79	112.5 Å²	112.5	39%	0.389	50%	0.502	S	S	.	.	H	α-helix	trans	-59.2	-44.9	175.2	-70.1	-177.9	76.3	0	0	111.5	I62 D68 Y69 Y70	I62-M66 HydrophobicContact CG2-CG 4.44Å; I62-M66 HydrophobicContact CG2-SD 4.21Å; I62-M66 WeakPolarHBondContact O-CG 3.29Å; I62-M66 PolarHBondContact O-N 3.25Å; M66-D68 VanDerWaalsContact C-N 3.31Å; M66-D68 PolarHBondContact O-N 3.41Å; M66-Y69 WeakPolarHBondContact O-CB 3.35Å; M66-Y69 PolarHBondContact O-N 2.99Å; M66-Y70 HydrophobicContact CB-CE2 4.23Å; M66-Y70 HydrophobicContact CE-CE2 4.22Å; M66-Y70 WeakPolarHBondContact O-CD2 3.42Å; M66-Y70 PolarHBondContact O-N 3.41Å
67	N	94.5	Very high	91.5	Very high	70 Å²	70	107.9 Å²	107.9	37%	0.374	49%	0.493	S	S	.	.	H	α-helix	trans	-61.2	-41	177.7	-73.5	-15.8	0	0	0	111.8	Q63 K64 E65 Y70 K71	Q63-N67 PolarHBondContact NE2-OD1 2.93Å; Q63-N67 WeakPolarHBondContact O-CB 3.35Å; Q63-N67 PolarHBondContact O-N 3.16Å; Q63-N67 PolarHBondContact O-ND2 3.45Å; Q63-N67 PolarHBondContact O-OD1 3.12Å; K64-N67 PolarHBondContact O-N 2.98Å; E65-N67 VanDerWaalsContact C-N 3.33Å; E65-N67 PolarHBondContact O-N 3.35Å; N67-Y70 PolarHBondContact O-N 3.49Å; N67-K71 VanDerWaalsContact O-CG 3.32Å; N67-K71 WeakPolarHBondContact O-CG 3.31Å; N67-K71 PolarHBondContact O-N 3.02Å
68	D	94.1	Very high	91.7	Very high	57 Å²	57	107.3 Å²	107.3	31%	0.305	50%	0.496	S	S	.	.	H	α-helix	trans	-69.9	-35.3	177.8	-71.6	-17.6	0	0	0	112	K64 E65 M66 K71 R72	K64-D68 PolarHBondContact O-N 2.99Å; E65-D68 PolarHBondContact O-N 3.19Å; M66-D68 VanDerWaalsContact C-N 3.31Å; M66-D68 PolarHBondContact O-N 3.41Å; D68-K71 IonicContact OD1-NZ 3.24Å; D68-K71 PolarHBondContact OD1-NZ 3.15Å; D68-R72 WeakPolarHBondContact O-CG 3.48Å; D68-R72 PolarHBondContact O-N 3Å
69	Y	93.8	Very high	91.8	Very high	143 Å²	143	107.8 Å²	107.8	56%	0.561	49%	0.493	S	S	*	.	H	α-helix	trans	-60.3	-49.9	169.2	174.5	-95	0	0	0	111.5	E65 M66 K71 R72 A73	E65-Y69 PolarHBondContact O-N 3.44Å; M66-Y69 WeakPolarHBondContact O-CB 3.35Å; M66-Y69 PolarHBondContact O-N 2.99Å; Y69-K71 VanDerWaalsContact C-N 3.34Å; Y69-K71 PolarHBondContact O-N 3.45Å; Y69-R72 PolarHBondContact O-N 3.17Å; Y69-R72 VanDerWaalsContact O-N 3.15Å; Y69-A73 PolarHBondContact O-N 3.38Å
70	Y	93.2	Very high	91.7	Very high	113 Å²	113	104.3 Å²	104.3	44%	0.443	48%	0.483	S	S	.	.	H	α-helix	trans	-62.1	-40.3	179.6	-70.5	-52.2	0	0	0	112.3	M66 N67 R72 A73 F74	M66-Y70 HydrophobicContact CB-CE2 4.23Å; M66-Y70 HydrophobicContact CE-CE2 4.22Å; M66-Y70 WeakPolarHBondContact O-CD2 3.42Å; M66-Y70 PolarHBondContact O-N 3.41Å; N67-Y70 PolarHBondContact O-N 3.49Å; Y70-R72 VanDerWaalsContact C-N 3.32Å; Y70-R72 PolarHBondContact O-N 2.84Å; Y70-A73 PolarHBondContact O-N 3.3Å; Y70-F74 WeakPolarHBondContact O-CB 3.41Å; Y70-F74 WeakPolarHBondContact O-CD2 3.37Å; Y70-F74 PolarHBondContact O-N 2.99Å
71	K	94.5	Very high	91.5	Very high	133 Å²	133	101.4 Å²	101.4	58%	0.578	48%	0.476	S	S	*	.	H	α-helix	trans	-57.1	-44.4	174.2	-74.6	171.1	-170.5	163.7	0	112	N67 D68 Y69 F74 F75	N67-K71 VanDerWaalsContact O-CG 3.32Å; N67-K71 WeakPolarHBondContact O-CG 3.31Å; N67-K71 PolarHBondContact O-N 3.02Å; D68-K71 IonicContact OD1-NZ 3.24Å; D68-K71 PolarHBondContact OD1-NZ 3.15Å; Y69-K71 VanDerWaalsContact C-N 3.34Å; Y69-K71 PolarHBondContact O-N 3.45Å; K71-F74 PolarHBondContact O-N 3.42Å; K71-F75 WeakPolarHBondContact O-CB 3.46Å; K71-F75 PolarHBondContact O-N 3.45Å
72	R	93.1	Very high	91.5	Very high	157 Å²	157	100.2 Å²	100.2	59%	0.592	47%	0.474	S	S	*	.	H	α-helix	trans	-64.9	-43.4	176.5	-70.8	-172	-65.1	-101.1	2.5	111.7	D68 Y69 Y70 F75 F76	D68-R72 WeakPolarHBondContact O-CG 3.48Å; D68-R72 PolarHBondContact O-N 3Å; Y69-R72 PolarHBondContact O-N 3.17Å; Y69-R72 VanDerWaalsContact O-N 3.15Å; Y70-R72 VanDerWaalsContact C-N 3.32Å; Y70-R72 PolarHBondContact O-N 2.84Å; R72-F75 PolarHBondContact O-N 2.92Å; R72-F76 PolarHBondContact O-N 3.45Å
73	A	88.9	Confident	91.4	Very high	35 Å²	35	102.1 Å²	102.1	29%	0.289	48%	0.479	S	S	.	.	H	α-helix	trans	-61.8	-45.2	177.5	0	0	0	0	0	111.6	Y69 Y70 F75 F76 C77	Y69-A73 PolarHBondContact O-N 3.38Å; Y70-A73 PolarHBondContact O-N 3.3Å; A73-F75 PolarHBondContact O-N 3.43Å; A73-F76 PolarHBondContact O-N 3.16Å; A73-C77 WeakPolarHBondContact O-CB 3.47Å; A73-C77 PolarHBondContact O-N 2.92Å; A73-C77 PolarHBondContact O-SG 3.26Å; A73-C77 VanDerWaalsContact O-SG 3.37Å
74	F	91.7	Very high	90.9	Very high	149 Å²	149	100.4 Å²	100.4	65%	0.654	48%	0.481	S	S	*	.	H	α-helix	trans	-59.7	-46.5	174.9	-81.6	-60.7	0	0	0	111.8	Y70 K71 F76 C77 D78	Y70-F74 WeakPolarHBondContact O-CB 3.41Å; Y70-F74 WeakPolarHBondContact O-CD2 3.37Å; Y70-F74 PolarHBondContact O-N 2.99Å; K71-F74 PolarHBondContact O-N 3.42Å; F74-F76 VanDerWaalsContact C-N 3.32Å; F74-F76 PolarHBondContact O-N 3.29Å; F74-C77 PolarHBondContact O-N 3.18Å; F74-D78 WeakPolarHBondContact O-CB 3.36Å; F74-D78 PolarHBondContact O-N 3Å
75	F	90.4	Very high	90.6	Very high	132 Å²	132	100.9 Å²	100.9	58%	0.579	48%	0.484	S	S	*	.	H	α-helix	trans	-59.2	-43.7	176.9	179.8	-104.1	0	0	0	112.1	K71 R72 A73 D78 Q79	K71-F75 WeakPolarHBondContact O-CB 3.46Å; K71-F75 PolarHBondContact O-N 3.45Å; R72-F75 PolarHBondContact O-N 2.92Å; A73-F75 PolarHBondContact O-N 3.43Å; F75-D78 PolarHBondContact O-N 2.94Å; F75-Q79 WeakPolarHBondContact O-CG 3.44Å; F75-Q79 PolarHBondContact O-N 2.91Å
76	F	86.6	Confident	90.3	Very high	117 Å²	117	96.5 Å²	96.5	51%	0.513	47%	0.471	S	S	.	.	H	α-helix	trans	-61.3	-48.9	175.1	-178.9	-96.5	0	0	0	111.5	R72 A73 F74 D78 Q79 Q80	R72-F76 PolarHBondContact O-N 3.45Å; A73-F76 PolarHBondContact O-N 3.16Å; F74-F76 VanDerWaalsContact C-N 3.32Å; F74-F76 PolarHBondContact O-N 3.29Å; F76-D78 VanDerWaalsContact C-N 3.3Å; F76-D78 PolarHBondContact O-N 3.04Å; F76-Q79 PolarHBondContact O-N 3.31Å; F76-Q79 VanDerWaalsContact O-N 3.16Å; F76-Q80 HydrophobicContact CD1-CG 3.96Å; F76-Q80 HydrophobicContact CD2-CG 4.37Å; F76-Q80 HydrophobicContact CE1-CG 3.57Å; F76-Q80 HydrophobicContact CE2-CG 4.02Å; F76-Q80 HydrophobicContact CG-CG 4.35Å; F76-Q80 HydrophobicContact CZ-CG 3.6Å; F76-Q80 WeakPolarHBondContact O-CG 3.08Å; F76-Q80 PolarHBondContact O-N 2.96Å
77	C	89.6	Confident	89.8	Confident	62 Å²	62	96.4 Å²	96.4	42%	0.419	47%	0.472	S	S	.	.	H	α-helix	trans	-57.8	-42.5	176.6	-73.2	0	0	0	0	112.2	A73 F74 Q79 Q80 I81	A73-C77 WeakPolarHBondContact O-CB 3.47Å; A73-C77 PolarHBondContact O-N 2.92Å; A73-C77 PolarHBondContact O-SG 3.26Å; A73-C77 VanDerWaalsContact O-SG 3.37Å; F74-C77 PolarHBondContact O-N 3.18Å; C77-Q79 PolarHBondContact O-N 3.18Å; C77-Q80 PolarHBondContact O-N 3.4Å; C77-Q80 VanDerWaalsContact O-N 3.14Å; C77-I81 HydrophobicContact CB-CD1 4.28Å; C77-I81 WeakPolarHBondContact O-CB 3.37Å; C77-I81 WeakPolarHBondContact O-CD1 3.33Å; C77-I81 VanDerWaalsContact O-CG1 3.26Å; C77-I81 WeakPolarHBondContact O-CG1 3.41Å; C77-I81 PolarHBondContact O-N 3.16Å
78	D	91.6	Very high	89.3	Confident	117 Å²	117	98.6 Å²	98.6	63%	0.626	48%	0.48	S	S	*	.	H	α-helix	trans	-63	-30.9	180	-160.8	45.7	0	0	0	112.1	F74 F75 F76 P82	F74-D78 WeakPolarHBondContact O-CB 3.36Å; F74-D78 PolarHBondContact O-N 3Å; F75-D78 PolarHBondContact O-N 2.94Å; F76-D78 VanDerWaalsContact C-N 3.3Å; F76-D78 PolarHBondContact O-N 3.04Å; D78-P82 WeakPolarHBondContact O-CD 3.31Å; D78-P82 VanDerWaalsContact O-CG 3.3Å; D78-P82 WeakPolarHBondContact O-CG 3.48Å
79	Q	89.1	Confident	88.9	Confident	87 Å²	87	103.8 Å²	103.8	41%	0.407	50%	0.495	S	S	.	.	H	α-helix	trans	-77.3	-38.3	171.7	-66.9	-175	-3.9	0	0	113.7	F75 F76 C77	F75-Q79 WeakPolarHBondContact O-CG 3.44Å; F75-Q79 PolarHBondContact O-N 2.91Å; F76-Q79 PolarHBondContact O-N 3.31Å; F76-Q79 VanDerWaalsContact O-N 3.16Å; C77-Q79 PolarHBondContact O-N 3.18Å
80	Q	87.5	Confident	88.3	Confident	67 Å²	67	98.5 Å²	98.5	31%	0.313	48%	0.478	S	S	.	.	H	α-helix	trans	-82.2	-32.7	-173.8	-60.7	-56.4	-17.4	0	0	113.1	F76 C77 K83 A84	F76-Q80 HydrophobicContact CD1-CG 3.96Å; F76-Q80 HydrophobicContact CD2-CG 4.37Å; F76-Q80 HydrophobicContact CE1-CG 3.57Å; F76-Q80 HydrophobicContact CE2-CG 4.02Å; F76-Q80 HydrophobicContact CG-CG 4.35Å; F76-Q80 HydrophobicContact CZ-CG 3.6Å; F76-Q80 WeakPolarHBondContact O-CG 3.08Å; F76-Q80 PolarHBondContact O-N 2.96Å; C77-Q80 PolarHBondContact O-N 3.4Å; C77-Q80 VanDerWaalsContact O-N 3.14Å; Q80-K83 WeakPolarHBondContact O-CB 3.32Å; Q80-K83 PolarHBondContact O-N 2.96Å; Q80-A84 PolarHBondContact O-N 3.08Å
81	I	88.6	Confident	87.7	Confident	86 Å²	86	95.8 Å²	95.8	44%	0.441	47%	0.47	S	S	.	.	H	α-helix	trans	-58.4	-47.5	-179.9	-74.2	162	0	0	0	112	C77 K83 A84 K85	C77-I81 HydrophobicContact CB-CD1 4.28Å; C77-I81 WeakPolarHBondContact O-CB 3.37Å; C77-I81 WeakPolarHBondContact O-CD1 3.33Å; C77-I81 VanDerWaalsContact O-CG1 3.26Å; C77-I81 WeakPolarHBondContact O-CG1 3.41Å; C77-I81 PolarHBondContact O-N 3.16Å; I81-K83 VanDerWaalsContact C-N 3.32Å; I81-K83 PolarHBondContact O-N 3.28Å; I81-A84 PolarHBondContact O-N 3.34Å; I81-K85 HydrophobicContact CG2-CD 4.08Å; I81-K85 HydrophobicContact CG2-CG 4.45Å; I81-K85 WeakPolarHBondContact O-CB 3.37Å; I81-K85 WeakPolarHBondContact O-CG 3.5Å; I81-K85 PolarHBondContact O-N 2.92Å
82	P	91.4	Very high	87.1	Confident	73 Å²	73	93.3 Å²	93.3	47%	0.474	46%	0.463	S	S	.	.	H	α-helix	trans	-60.2	-39.5	175.8	-25.8	35.2	0	0	0	113.1	D78 K85 A86	D78-P82 WeakPolarHBondContact O-CD 3.31Å; D78-P82 VanDerWaalsContact O-CG 3.3Å; D78-P82 WeakPolarHBondContact O-CG 3.48Å; P82-K85 PolarHBondContact O-N 3.33Å; P82-A86 WeakPolarHBondContact O-CB 3.46Å; P82-A86 PolarHBondContact O-N 3.5Å
83	K	88	Confident	86.6	Confident	128 Å²	128	91.3 Å²	91.3	56%	0.557	46%	0.456	S	S	*	.	H	α-helix	trans	-64	-47.5	177.2	-67.4	176.4	-179.5	177.8	0	111.2	Q80 I81 K85 A86 L87	Q80-K83 WeakPolarHBondContact O-CB 3.32Å; Q80-K83 PolarHBondContact O-N 2.96Å; I81-K83 VanDerWaalsContact C-N 3.32Å; I81-K83 PolarHBondContact O-N 3.28Å; K83-K85 PolarHBondContact O-N 2.88Å; K83-A86 WeakPolarHBondContact O-CB 3.5Å; K83-A86 PolarHBondContact O-N 3.35Å; K83-L87 PolarHBondContact O-N 3.36Å
84	A	82.8	Confident	85.9	Confident	60 Å²	60	89.8 Å²	89.8	50%	0.496	44%	0.443	S	S	.	.	H	α-helix	trans	-60.6	-43	175.5	0	0	0	0	0	111.8	Q80 I81 A86 L87 Q88	Q80-A84 PolarHBondContact O-N 3.08Å; I81-A84 PolarHBondContact O-N 3.34Å; A84-A86 VanDerWaalsContact C-N 3.35Å; A84-A86 PolarHBondContact O-N 2.99Å; A84-L87 PolarHBondContact O-N 2.92Å; A84-Q88 WeakPolarHBondContact O-CB 3.45Å; A84-Q88 PolarHBondContact O-N 3.38Å
85	K	89	Confident	85.3	Confident	115 Å²	115	87.6 Å²	87.6	50%	0.5	44%	0.441	S	S	.	.	H	α-helix	trans	-62.4	-39.2	174.4	-76.4	179.6	177.6	176.3	0	112.3	I81 P82 K83 Q88 R89	I81-K85 HydrophobicContact CG2-CD 4.08Å; I81-K85 HydrophobicContact CG2-CG 4.45Å; I81-K85 WeakPolarHBondContact O-CB 3.37Å; I81-K85 WeakPolarHBondContact O-CG 3.5Å; I81-K85 PolarHBondContact O-N 2.92Å; P82-K85 PolarHBondContact O-N 3.33Å; K83-K85 PolarHBondContact O-N 2.88Å; K85-Q88 PolarHBondContact O-N 3.46Å; K85-R89 VanDerWaalsContact O-CG 3.32Å; K85-R89 WeakPolarHBondContact O-CG 3.36Å; K85-R89 PolarHBondContact O-N 3.27Å
86	A	84.3	Confident	84.9	Confident	46 Å²	46	90.7 Å²	90.7	38%	0.38	45%	0.449	S	S	.	.	H	α-helix	trans	-65.2	-45.2	176.4	0	0	0	0	0	111.5	P82 K83 A84 Q88 R89 T90	P82-A86 WeakPolarHBondContact O-CB 3.46Å; P82-A86 PolarHBondContact O-N 3.5Å; K83-A86 WeakPolarHBondContact O-CB 3.5Å; K83-A86 PolarHBondContact O-N 3.35Å; A84-A86 VanDerWaalsContact C-N 3.35Å; A84-A86 PolarHBondContact O-N 2.99Å; A86-Q88 PolarHBondContact O-N 2.92Å; A86-R89 WeakPolarHBondContact O-CB 3.08Å; A86-R89 PolarHBondContact O-N 2.94Å; A86-T90 PolarHBondContact O-N 2.92Å; A86-T90 VanDerWaalsContact O-N 3.11Å; A86-T90 PolarHBondContact O-OG1 3.01Å
87	L	83	Confident	84.5	Confident	78 Å²	78	92.6 Å²	92.6	41%	0.408	45%	0.453	S	S	.	.	H	α-helix	trans	-59.2	-46.1	174.6	-178.8	60.2	0	0	0	111.3	K83 A84 R89 T90 I91 M105	K83-L87 PolarHBondContact O-N 3.36Å; A84-L87 PolarHBondContact O-N 2.92Å; L87-R89 VanDerWaalsContact C-N 3.31Å; L87-R89 PolarHBondContact O-N 2.96Å; L87-T90 WeakPolarHBondContact O-CA 3.37Å; L87-T90 WeakPolarHBondContact O-CB 3.49Å; L87-T90 PolarHBondContact O-N 3.16Å; L87-I91 HydrophobicContact CG-CD1 4.13Å; L87-I91 WeakPolarHBondContact O-CG1 3.34Å; L87-I91 PolarHBondContact O-N 3.24Å; L87-M105 HydrophobicContact CD1-CE 3.61Å; L87-M105 HydrophobicContact CD1-SD 3.77Å
88	Q	84.5	Confident	83.8	Confident	116 Å²	116	93.3 Å²	93.3	54%	0.542	47%	0.471	S	S	.	.	H	α-helix	trans	-58.4	-40.9	176.1	-168.6	-177.2	23.2	0	0	112.2	A84 K85 A86 T90 I91 N92	A84-Q88 WeakPolarHBondContact O-CB 3.45Å; A84-Q88 PolarHBondContact O-N 3.38Å; K85-Q88 PolarHBondContact O-N 3.46Å; A86-Q88 PolarHBondContact O-N 2.92Å; Q88-T90 VanDerWaalsContact C-N 3.29Å; Q88-T90 PolarHBondContact O-N 3.44Å; Q88-I91 PolarHBondContact O-N 2.96Å; Q88-N92 WeakPolarHBondContact O-CB 3.46Å; Q88-N92 VanDerWaalsContact O-CG 3.29Å; Q88-N92 PolarHBondContact O-N 3.34Å
89	R	86.2	Confident	82.8	Confident	166 Å²	166	89.5 Å²	89.5	63%	0.626	45%	0.453	S	S	*	.	H	α-helix	trans	-63.7	-33.4	174.6	-70.7	171.3	-169.1	162.7	1.8	112.4	K85 A86 L87 R93	K85-R89 VanDerWaalsContact O-CG 3.32Å; K85-R89 WeakPolarHBondContact O-CG 3.36Å; K85-R89 PolarHBondContact O-N 3.27Å; A86-R89 WeakPolarHBondContact O-CB 3.08Å; A86-R89 PolarHBondContact O-N 2.94Å; L87-R89 VanDerWaalsContact C-N 3.31Å; L87-R89 PolarHBondContact O-N 2.96Å; R89-R93 WeakPolarHBondContact O-CG 3.3Å; R89-R93 PolarHBondContact O-N 3.37Å; R89-R93 PolarHBondContact O-NE 3.15Å
90	T	80.4	Confident	81.8	Confident	31 Å²	31	93.3 Å²	93.3	19%	0.19	47%	0.469	C	S	.	.	H	α-helix	trans	-70	-46	175.1	-61.5	0	0	0	0	111	A86 L87 Q88 N92 R93 A94	A86-T90 PolarHBondContact O-N 2.92Å; A86-T90 VanDerWaalsContact O-N 3.11Å; A86-T90 PolarHBondContact O-OG1 3.01Å; L87-T90 WeakPolarHBondContact O-CA 3.37Å; L87-T90 WeakPolarHBondContact O-CB 3.49Å; L87-T90 PolarHBondContact O-N 3.16Å; Q88-T90 VanDerWaalsContact C-N 3.29Å; Q88-T90 PolarHBondContact O-N 3.44Å; T90-N92 PolarHBondContact O-N 2.9Å; T90-R93 WeakPolarHBondContact O-CB 3.21Å; T90-R93 PolarHBondContact O-N 3.22Å; T90-R93 PolarHBondContact OG1-NH2 3.4Å; T90-A94 PolarHBondContact O-N 3.44Å
91	I	79.5	Confident	80.7	Confident	57 Å²	57	93.5 Å²	93.5	29%	0.292	47%	0.471	S	S	.	.	H	α-helix	trans	-56.2	-49.1	173.8	-64.9	164	0	0	0	110.6	L87 Q88 R93 A94 V95 L101	L87-I91 HydrophobicContact CG-CD1 4.13Å; L87-I91 WeakPolarHBondContact O-CG1 3.34Å; L87-I91 PolarHBondContact O-N 3.24Å; Q88-I91 PolarHBondContact O-N 2.96Å; I91-R93 PolarHBondContact O-N 3.3Å; I91-A94 WeakPolarHBondContact O-CB 3.47Å; I91-A94 PolarHBondContact O-N 2.94Å; I91-V95 HydrophobicContact CG2-CG2 4.26Å; I91-V95 WeakPolarHBondContact O-CG2 3.26Å; I91-V95 PolarHBondContact O-N 2.95Å; I91-L101 HydrophobicContact CB-CD1 4.2Å; I91-L101 HydrophobicContact CD1-CD2 4.47Å; I91-L101 HydrophobicContact CG1-CD1 3.56Å; I91-L101 HydrophobicContact CG1-CD2 4.04Å; I91-L101 HydrophobicContact CG1-CG 4.47Å
92	N	82.8	Confident	79.6	Confident	80 Å²	80	93.1 Å²	93.1	43%	0.428	48%	0.476	S	S	.	.	H	α-helix	trans	-63.8	-23.2	179.1	-72.3	-13.5	0	0	0	113.6	Q88 T90 R96	Q88-N92 WeakPolarHBondContact O-CB 3.46Å; Q88-N92 VanDerWaalsContact O-CG 3.29Å; Q88-N92 PolarHBondContact O-N 3.34Å; T90-N92 PolarHBondContact O-N 2.9Å; N92-R96 WeakPolarHBondContact O-CB 3.49Å; N92-R96 WeakPolarHBondContact O-CG 2.94Å; N92-R96 PolarHBondContact O-N 3.45Å; N92-R96 PolarHBondContact O-NE 2.94Å; N92-R96 VanDerWaalsContact O-NE 3.07Å
93	R	81.6	Confident	78.1	Confident	116 Å²	116	93.2 Å²	93.2	44%	0.438	48%	0.478	S	S	.	.	H	α-helix	trans	-77.7	-42.1	171.8	-78	180	-74.9	166.3	0.5	111	R89 T90 I91 R96 R97	R89-R93 WeakPolarHBondContact O-CG 3.3Å; R89-R93 PolarHBondContact O-N 3.37Å; R89-R93 PolarHBondContact O-NE 3.15Å; T90-R93 WeakPolarHBondContact O-CB 3.21Å; T90-R93 PolarHBondContact O-N 3.22Å; T90-R93 PolarHBondContact OG1-NH2 3.4Å; I91-R93 PolarHBondContact O-N 3.3Å; R93-R96 PolarHBondContact O-N 2.89Å; R93-R97 WeakPolarHBondContact O-CG 3.4Å; R93-R97 PolarHBondContact O-N 2.93Å
94	A	75.7	Confident	76.8	Confident	2 Å²	2	90.9 Å²	90.9	2%	0.017	47%	0.467	C	S	.	.	H	α-helix	trans	-60.3	-49.4	176.3	0	0	0	0	0	111.8	T90 I91 R96 R97 G98 S99 L101 Y104	T90-A94 PolarHBondContact O-N 3.44Å; I91-A94 WeakPolarHBondContact O-CB 3.47Å; I91-A94 PolarHBondContact O-N 2.94Å; A94-R96 PolarHBondContact O-N 3.24Å; A94-R97 CarbonylContact O-C 3.55Å; A94-R97 PolarHBondContact O-N 3.19Å; A94-R97 VanDerWaalsContact O-N 3.13Å; A94-G98 PolarHBondContact O-N 3.41Å; A94-S99 PolarHBondContact O-N 3.29Å; A94-S99 VanDerWaalsContact O-N 3.08Å; A94-L101 HydrophobicContact CB-CD1 4.37Å; A94-Y104 VanDerWaalsContact CA-CE2 3.44Å; A94-Y104 HydrophobicContact CB-CD2 3.3Å; A94-Y104 HydrophobicContact CB-CE2 3.5Å; A94-Y104 VanDerWaalsContact CB-CE2 3.5Å; A94-Y104 HydrophobicContact CB-CG 4.01Å
95	V	78.3	Confident	76	Confident	103 Å²	103	90.3 Å²	90.3	62%	0.624	45%	0.454	S	S	*	.	H	α-helix	trans	-59.2	-46.2	178.4	174.8	0	0	0	0	111.2	I91 R97 G98	I91-V95 HydrophobicContact CG2-CG2 4.26Å; I91-V95 WeakPolarHBondContact O-CG2 3.26Å; I91-V95 PolarHBondContact O-N 2.95Å; V95-R97 PolarHBondContact O-N 3.1Å; V95-G98 PolarHBondContact O-N 3.15Å
96	R	81.2	Confident	74.7	Confident	198 Å²	198	92.9 Å²	92.9	75%	0.747	47%	0.473	S	S	*	.	H	α-helix	trans	-62	-29.3	178.1	-82.9	-173.2	-73.5	-177.9	-2.9	113.8	N92 R93 A94 G98	N92-R96 WeakPolarHBondContact O-CB 3.49Å; N92-R96 WeakPolarHBondContact O-CG 2.94Å; N92-R96 PolarHBondContact O-N 3.45Å; N92-R96 PolarHBondContact O-NE 2.94Å; N92-R96 VanDerWaalsContact O-NE 3.07Å; R93-R96 PolarHBondContact O-N 2.89Å; A94-R96 PolarHBondContact O-N 3.24Å; R96-G98 VanDerWaalsContact C-N 3.34Å
97	R	79.9	Confident	73.8	Confident	157 Å²	157	94 Å²	94	59%	0.592	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.6	5.9	177.2	-62.6	-158.7	-166.5	103.8	-8.5	113	R93 A94 V95 S99 Y104	R93-R97 WeakPolarHBondContact O-CG 3.4Å; R93-R97 PolarHBondContact O-N 2.93Å; A94-R97 CarbonylContact O-C 3.55Å; A94-R97 PolarHBondContact O-N 3.19Å; A94-R97 VanDerWaalsContact O-N 3.13Å; V95-R97 PolarHBondContact O-N 3.1Å; R97-S99 WeakPolarHBondContact CB-OG 3.46Å; R97-S99 PolarHBondContact O-N 3.37Å; R97-S99 PolarHBondContact O-OG 3.29Å; R97-Y104 VanDerWaalsContact CD-OH 3.31Å; R97-Y104 WeakPolarHBondContact CD-OH 3.45Å; R97-Y104 PolarHBondContact NH1-OH 3.49Å
98	G	75	Confident	73	Confident	76 Å²	76	94.7 Å²	94.7	78%	0.784	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.8	19.7	-178.8	0	0	0	0	0	114.2	A94 V95 R96	A94-G98 PolarHBondContact O-N 3.41Å; V95-G98 PolarHBondContact O-N 3.15Å; R96-G98 VanDerWaalsContact C-N 3.34Å
99	S	70	Confident	72.3	Confident	37 Å²	37	97.5 Å²	97.5	26%	0.259	49%	0.49	S	S	.	.			trans	-97.5	149.6	-174.9	-3	0	0	0	0	111	A94 R97 Y104	A94-S99 PolarHBondContact O-N 3.29Å; A94-S99 VanDerWaalsContact O-N 3.08Å; R97-S99 WeakPolarHBondContact CB-OG 3.46Å; R97-S99 PolarHBondContact O-N 3.37Å; R97-S99 PolarHBondContact O-OG 3.29Å; S99-Y104 WeakPolarHBondContact OG-CE2 3.39Å
100	K	67	Low	71.7	Confident	168 Å²	168	95.4 Å²	95.4	73%	0.73	49%	0.491	S	S	*	.			trans	-64.3	142.1	175.4	-69	-175.8	178.8	-179.2	0	110.1	S102 S103	K100-S102 PolarHBondContact O-N 3.27Å; K100-S103 WeakPolarHBondContact O-CB 3.42Å; K100-S103 PolarHBondContact O-N 3.37Å; K100-S103 PolarHBondContact O-OG 2.94Å
101	L	65.7	Low	71.3	Confident	71 Å²	71	95.5 Å²	95.5	37%	0.372	49%	0.493	S	S	.	.	G	3₁₀ helix	trans	-59.1	-34.4	-179.1	-175.9	59.6	0	0	0	112.9	I91 A94 S103 Y104 M105	I91-L101 HydrophobicContact CB-CD1 4.2Å; I91-L101 HydrophobicContact CD1-CD2 4.47Å; I91-L101 HydrophobicContact CG1-CD1 3.56Å; I91-L101 HydrophobicContact CG1-CD2 4.04Å; I91-L101 HydrophobicContact CG1-CG 4.47Å; A94-L101 HydrophobicContact CB-CD1 4.37Å; L101-S103 PolarHBondContact O-N 2.89Å; L101-S103 VanDerWaalsContact O-N 3.16Å; L101-Y104 PolarHBondContact O-N 3.12Å; L101-M105 HydrophobicContact CD1-CG 4.39Å; L101-M105 HydrophobicContact CD1-SD 4Å; L101-M105 HydrophobicContact CD2-SD 4.27Å; L101-M105 HydrophobicContact CG-SD 3.97Å; L101-M105 PolarHBondContact O-N 3.16Å
102	S	64.4	Low	71	Confident	77 Å²	77	96.5 Å²	96.5	54%	0.538	50%	0.502	S	S	.	.	G	3₁₀ helix	trans	-62.2	-15.9	173.7	62	0	0	0	0	114.4	K100 Y104 M105	K100-S102 PolarHBondContact O-N 3.27Å; S102-Y104 VanDerWaalsContact C-N 3.31Å; S102-M105 CarbonylContact C-O 3.53Å
103	S	61.2	Low	70.8	Confident	75 Å²	75	97.8 Å²	97.8	52%	0.524	51%	0.505	S	S	.	.	G	3₁₀ helix	trans	-84.1	-5.7	173.1	63.2	0	0	0	0	113.7	K100 L101	K100-S103 WeakPolarHBondContact O-CB 3.42Å; K100-S103 PolarHBondContact O-N 3.37Å; K100-S103 PolarHBondContact O-OG 2.94Å; L101-S103 PolarHBondContact O-N 2.89Å; L101-S103 VanDerWaalsContact O-N 3.16Å
104	Y	60.4	Low	70.5	Confident	79 Å²	79	99 Å²	99	31%	0.31	52%	0.516	S	S	.	.	T	Hydrogen-bonded Turn	trans	-114.7	-11.2	174.2	-76.5	-89	0	0	0	113.5	A94 R97 S99 L101 S102	A94-Y104 VanDerWaalsContact CA-CE2 3.44Å; A94-Y104 HydrophobicContact CB-CD2 3.3Å; A94-Y104 HydrophobicContact CB-CE2 3.5Å; A94-Y104 VanDerWaalsContact CB-CE2 3.5Å; A94-Y104 HydrophobicContact CB-CG 4.01Å; R97-Y104 VanDerWaalsContact CD-OH 3.31Å; R97-Y104 WeakPolarHBondContact CD-OH 3.45Å; R97-Y104 PolarHBondContact NH1-OH 3.49Å; S99-Y104 WeakPolarHBondContact OG-CE2 3.39Å; L101-Y104 PolarHBondContact O-N 3.12Å; S102-Y104 VanDerWaalsContact C-N 3.31Å
105	M	64.8	Low	70.7	Confident	49 Å²	49	104.1 Å²	104.1	24%	0.241	54%	0.542	C	S	.	.	S	Bend	trans	-127.8	111.3	178.9	-57.1	-176.2	65.6	0	0	105.3	L87 L101 S102 L107	L87-M105 HydrophobicContact CD1-CE 3.61Å; L87-M105 HydrophobicContact CD1-SD 3.77Å; L101-M105 HydrophobicContact CD1-CG 4.39Å; L101-M105 HydrophobicContact CD1-SD 4Å; L101-M105 HydrophobicContact CD2-SD 4.27Å; L101-M105 HydrophobicContact CG-SD 3.97Å; L101-M105 PolarHBondContact O-N 3.16Å; S102-M105 CarbonylContact C-O 3.53Å; M105-L107 HydrophobicContact CB-CD1 3.9Å; M105-L107 HydrophobicContact CB-CG 3.76Å; M105-L107 HydrophobicContact CE-CD1 4.12Å; M105-L107 HydrophobicContact CE-CD2 4.44Å; M105-L107 PolarHBondContact O-N 3.33Å; M105-L107 HydrophobicContact SD-CD1 4.37Å
106	D	62.3	Low	70.8	Confident	168 Å²	168	103.5 Å²	103.5	90%	0.898	53%	0.533	S	S	*	.			trans	-67.3	65.1	174	-66.3	-35.4	0	0	0	109.4
107	L	65.1	Low	71	Confident	71 Å²	71	98.5 Å²	98.5	37%	0.372	52%	0.521	S	S	.	.			trans	-89.7	111.6	178.3	-64.2	172.3	0	0	0	107.6	M105 V112	M105-L107 HydrophobicContact CB-CD1 3.9Å; M105-L107 HydrophobicContact CB-CG 3.76Å; M105-L107 HydrophobicContact CE-CD1 4.12Å; M105-L107 HydrophobicContact CE-CD2 4.44Å; M105-L107 PolarHBondContact O-N 3.33Å; M105-L107 HydrophobicContact SD-CD1 4.37Å; L107-V112 HydrophobicContact CB-CG2 4.41Å
108	D	67.1	Low	71.1	Confident	91 Å²	91	97.6 Å²	97.6	49%	0.487	52%	0.518	S	S	.	.			trans	-77.8	171.4	165.5	56.4	16.4	0	0	0	111	D110 S111 V112	D108-D110 PolarHBondContact O-N 3.49Å; D108-S111 WeakPolarHBondContact O-CB 3.49Å; D108-S111 PolarHBondContact O-N 2.99Å; D108-S111 WeakPolarHBondContact OD1-CB 3.44Å; D108-S111 PolarHBondContact OD1-N 3.24Å; D108-S111 PolarHBondContact OD1-OG 2.95Å; D108-V112 PolarHBondContact O-N 3.21Å
109	E	70.1	Confident	71.7	Confident	176 Å²	176	101 Å²	101	82%	0.822	51%	0.508	S	S	*	.	H	α-helix	trans	-62.7	-33.1	-175.6	-153.5	161.3	-159.5	0	0	111.4	V112 Q113	E109-V112 PolarHBondContact O-N 3.39Å; E109-Q113 PolarHBondContact O-N 2.83Å; E109-Q113 VanDerWaalsContact O-N 3.1Å
110	D	73.4	Confident	72.6	Confident	121 Å²	121	103.3 Å²	103.3	65%	0.647	52%	0.52	S	S	*	.	H	α-helix	trans	-64.2	-44.3	174.1	-66.9	-18.2	0	0	0	111.7	D108 V112 Q113 E114	D108-D110 PolarHBondContact O-N 3.49Å; D110-V112 VanDerWaalsContact C-N 3.26Å; D110-V112 PolarHBondContact O-N 2.81Å; D110-Q113 PolarHBondContact O-N 3.34Å; D110-Q113 VanDerWaalsContact O-N 3.15Å; D110-E114 PolarHBondContact O-N 3.18Å
111	S	71.6	Confident	73.6	Confident	34 Å²	34	101.6 Å²	101.6	24%	0.238	51%	0.51	C	S	.	.	H	α-helix	trans	-62.3	-33.8	176.9	-61.9	0	0	0	0	112.7	D108 L115	D108-S111 WeakPolarHBondContact O-CB 3.49Å; D108-S111 PolarHBondContact O-N 2.99Å; D108-S111 WeakPolarHBondContact OD1-CB 3.44Å; D108-S111 PolarHBondContact OD1-N 3.24Å; D108-S111 PolarHBondContact OD1-OG 2.95Å; S111-L115 WeakPolarHBondContact O-CG 3.44Å; S111-L115 PolarHBondContact O-N 2.9Å
112	V	73.8	Confident	74.6	Confident	77 Å²	77	101.7 Å²	101.7	47%	0.467	51%	0.51	S	S	.	.	H	α-helix	trans	-71.2	-40.5	176.5	177.8	0	0	0	0	110.3	L107 D108 E109 D110 L115 E116	L107-V112 HydrophobicContact CB-CG2 4.41Å; D108-V112 PolarHBondContact O-N 3.21Å; E109-V112 PolarHBondContact O-N 3.39Å; D110-V112 VanDerWaalsContact C-N 3.26Å; D110-V112 PolarHBondContact O-N 2.81Å; V112-L115 PolarHBondContact O-N 3.32Å; V112-E116 PolarHBondContact O-N 3.36Å; V112-E116 VanDerWaalsContact O-N 3.16Å
113	Q	77.1	Confident	75.8	Confident	107 Å²	107	101.1 Å²	101.1	50%	0.5	50%	0.5	S	S	.	.	H	α-helix	trans	-65.7	-41.9	178.3	-171	58	49.1	0	0	112.1	E109 D110 L115 E116 D117	E109-Q113 PolarHBondContact O-N 2.83Å; E109-Q113 VanDerWaalsContact O-N 3.1Å; D110-Q113 PolarHBondContact O-N 3.34Å; D110-Q113 VanDerWaalsContact O-N 3.15Å; Q113-L115 PolarHBondContact O-N 3.16Å; Q113-E116 PolarHBondContact O-N 3.33Å; Q113-E116 VanDerWaalsContact O-N 3.12Å; Q113-D117 PolarHBondContact NE2-OD1 3.23Å; Q113-D117 PolarHBondContact O-N 3.17Å
114	E	76.3	Confident	77.2	Confident	143 Å²	143	103.6 Å²	103.6	67%	0.668	50%	0.501	S	S	*	.	H	α-helix	trans	-59.1	-36.8	175.5	-74.9	-169.9	170.9	0	0	112.3	D110 D117 Y118	D110-E114 PolarHBondContact O-N 3.18Å; E114-D117 PolarHBondContact O-N 3.36Å; E114-Y118 WeakPolarHBondContact O-CB 3.44Å; E114-Y118 PolarHBondContact O-N 2.86Å
115	L	80.3	Confident	78.6	Confident	108 Å²	108	103.1 Å²	103.1	57%	0.565	50%	0.504	S	S	*	.	H	α-helix	trans	-69.7	-36.3	176.9	-71.4	173.8	0	0	0	112.4	S111 V112 Q113 R119	S111-L115 WeakPolarHBondContact O-CG 3.44Å; S111-L115 PolarHBondContact O-N 2.9Å; V112-L115 PolarHBondContact O-N 3.32Å; Q113-L115 PolarHBondContact O-N 3.16Å; L115-R119 VanDerWaalsContact O-CB 3.31Å; L115-R119 WeakPolarHBondContact O-CB 3.47Å; L115-R119 PolarHBondContact O-N 3.18Å
116	E	80.3	Confident	79.8	Confident	90 Å²	90	103.6 Å²	103.6	42%	0.421	51%	0.512	S	S	.	.	H	α-helix	trans	-68.3	-39.1	173.5	-79.7	-73.2	175.3	0	0	111.9	V112 Q113 R119 T120	V112-E116 PolarHBondContact O-N 3.36Å; V112-E116 VanDerWaalsContact O-N 3.16Å; Q113-E116 PolarHBondContact O-N 3.33Å; Q113-E116 VanDerWaalsContact O-N 3.12Å; E116-R119 WeakPolarHBondContact O-CB 3.39Å; E116-R119 PolarHBondContact O-N 3.01Å; E116-R119 IonicContact OE2-NH1 3.74Å; E116-T120 PolarHBondContact O-N 3.42Å; E116-T120 PolarHBondContact O-OG1 2.9Å
117	D	85.5	Confident	81.2	Confident	94 Å²	94	103.9 Å²	103.9	50%	0.503	50%	0.5	S	S	.	.	H	α-helix	trans	-64.6	-45.1	175.6	-72.1	-1.4	0	0	0	110.7	Q113 E114 R119 T120 Y121	Q113-D117 PolarHBondContact NE2-OD1 3.23Å; Q113-D117 PolarHBondContact O-N 3.17Å; E114-D117 PolarHBondContact O-N 3.36Å; D117-R119 VanDerWaalsContact C-N 3.33Å; D117-R119 PolarHBondContact O-N 3.37Å; D117-T120 WeakPolarHBondContact O-CB 3.47Å; D117-T120 PolarHBondContact O-N 2.9Å; D117-T120 VanDerWaalsContact O-N 3.16Å; D117-Y121 PolarHBondContact O-N 3.34Å
118	Y	81.5	Confident	82.3	Confident	137 Å²	137	105.2 Å²	105.2	54%	0.537	50%	0.504	S	S	.	.	H	α-helix	trans	-64.6	-38.4	176.9	-166.3	-110.5	0	0	0	112	E114 T120 Y121 I122	E114-Y118 WeakPolarHBondContact O-CB 3.44Å; E114-Y118 PolarHBondContact O-N 2.86Å; Y118-T120 VanDerWaalsContact C-N 3.31Å; Y118-T120 PolarHBondContact O-N 3.14Å; Y118-Y121 HydrophobicContact CD2-CD1 4.48Å; Y118-Y121 HydrophobicContact CE2-CD1 4.25Å; Y118-Y121 PolarHBondContact O-N 3.46Å; Y118-I122 HydrophobicContact CD1-CD1 3.89Å; Y118-I122 HydrophobicContact CD1-CG1 4.41Å; Y118-I122 HydrophobicContact CE1-CD1 3.47Å; Y118-I122 VanDerWaalsContact CE1-CD1 3.47Å; Y118-I122 HydrophobicContact CE1-CG1 4.12Å; Y118-I122 PolarHBondContact O-N 2.73Å
119	R	86.9	Confident	83.2	Confident	149 Å²	149	105.3 Å²	105.3	56%	0.562	50%	0.504	S	S	*	.	H	α-helix	trans	-59.6	-44	172.9	178.6	176.5	177.3	-99.9	-5.4	111.1	L115 E116 D117 Y121 I122 I123	L115-R119 VanDerWaalsContact O-CB 3.31Å; L115-R119 WeakPolarHBondContact O-CB 3.47Å; L115-R119 PolarHBondContact O-N 3.18Å; E116-R119 WeakPolarHBondContact O-CB 3.39Å; E116-R119 PolarHBondContact O-N 3.01Å; E116-R119 IonicContact OE2-NH1 3.74Å; D117-R119 VanDerWaalsContact C-N 3.33Å; D117-R119 PolarHBondContact O-N 3.37Å; R119-Y121 VanDerWaalsContact C-N 3.35Å; R119-I122 PolarHBondContact O-N 3.16Å; R119-I123 HydrophobicContact CG-CD1 4.16Å; R119-I123 WeakPolarHBondContact O-CG1 3.42Å; R119-I123 PolarHBondContact O-N 3.21Å; R119-I123 VanDerWaalsContact O-N 3.08Å
120	T	90.8	Very high	84.1	Confident	84 Å²	84	102.7 Å²	102.7	52%	0.515	49%	0.492	S	S	.	.	H	α-helix	trans	-64.2	-41.4	178.3	-58.6	0	0	0	0	111.4	E116 D117 Y118 I123 K124	E116-T120 PolarHBondContact O-N 3.42Å; E116-T120 PolarHBondContact O-OG1 2.9Å; D117-T120 WeakPolarHBondContact O-CB 3.47Å; D117-T120 PolarHBondContact O-N 2.9Å; D117-T120 VanDerWaalsContact O-N 3.16Å; Y118-T120 VanDerWaalsContact C-N 3.31Å; Y118-T120 PolarHBondContact O-N 3.14Å; T120-I123 PolarHBondContact O-N 3.31Å; T120-K124 PolarHBondContact O-N 3.38Å
121	Y	86.8	Confident	84.7	Confident	132 Å²	132	99.6 Å²	99.6	52%	0.518	48%	0.48	S	S	.	.	H	α-helix	trans	-59.2	-47.4	174.6	175.2	-106.4	0	0	0	112.1	D117 Y118 R119 I123 K124 L125	D117-Y121 PolarHBondContact O-N 3.34Å; Y118-Y121 HydrophobicContact CD2-CD1 4.48Å; Y118-Y121 HydrophobicContact CE2-CD1 4.25Å; Y118-Y121 PolarHBondContact O-N 3.46Å; R119-Y121 VanDerWaalsContact C-N 3.35Å; Y121-I123 VanDerWaalsContact C-N 3.32Å; Y121-I123 PolarHBondContact O-N 2.89Å; Y121-K124 WeakPolarHBondContact O-CB 3.32Å; Y121-K124 PolarHBondContact O-N 2.59Å; Y121-L125 PolarHBondContact O-N 3.42Å
122	I	86.1	Confident	85.3	Confident	74 Å²	74	105.1 Å²	105.1	38%	0.379	50%	0.496	S	S	.	.	H	α-helix	trans	-60	-43.8	178	-71.2	-178.9	0	0	0	111	Y118 R119 K124 L125 C126	Y118-I122 HydrophobicContact CD1-CD1 3.89Å; Y118-I122 HydrophobicContact CD1-CG1 4.41Å; Y118-I122 HydrophobicContact CE1-CD1 3.47Å; Y118-I122 VanDerWaalsContact CE1-CD1 3.47Å; Y118-I122 HydrophobicContact CE1-CG1 4.12Å; Y118-I122 PolarHBondContact O-N 2.73Å; R119-I122 PolarHBondContact O-N 3.16Å; I122-K124 VanDerWaalsContact C-N 3.28Å; I122-K124 PolarHBondContact O-N 3.23Å; I122-L125 PolarHBondContact O-N 2.56Å; I122-C126 PolarHBondContact O-N 3.05Å; I122-C126 PolarHBondContact O-SG 2.91Å; I122-C126 VanDerWaalsContact O-SG 3.38Å
123	I	90.4	Very high	85.7	Confident	64 Å²	64	106.9 Å²	106.9	33%	0.328	50%	0.502	S	S	.	.	H	α-helix	trans	-61	-40.9	179.1	-68.9	167.3	0	0	0	110.8	R119 T120 Y121 C126 R127	R119-I123 HydrophobicContact CG-CD1 4.16Å; R119-I123 WeakPolarHBondContact O-CG1 3.42Å; R119-I123 PolarHBondContact O-N 3.21Å; R119-I123 VanDerWaalsContact O-N 3.08Å; T120-I123 PolarHBondContact O-N 3.31Å; Y121-I123 VanDerWaalsContact C-N 3.32Å; Y121-I123 PolarHBondContact O-N 2.89Å; I123-C126 PolarHBondContact O-N 2.99Å; I123-R127 PolarHBondContact O-N 3.36Å; I123-R127 VanDerWaalsContact O-N 3.16Å
124	K	90.6	Very high	86	Confident	127 Å²	127	106.9 Å²	106.9	55%	0.552	51%	0.505	S	S	*	.	H	α-helix	trans	-62.6	-46.3	176	-172.7	-176.8	175.2	-167.6	0	111.2	T120 Y121 I122 C126 R127 E128	T120-K124 PolarHBondContact O-N 3.38Å; Y121-K124 WeakPolarHBondContact O-CB 3.32Å; Y121-K124 PolarHBondContact O-N 2.59Å; I122-K124 VanDerWaalsContact C-N 3.28Å; I122-K124 PolarHBondContact O-N 3.23Å; K124-C126 VanDerWaalsContact C-N 3.32Å; K124-C126 PolarHBondContact O-N 2.93Å; K124-R127 PolarHBondContact O-N 3.18Å; K124-R127 VanDerWaalsContact O-N 3.15Å; K124-E128 WeakPolarHBondContact CE-OE1 3.4Å; K124-E128 IonicContact NZ-OE1 3.63Å; K124-E128 PolarHBondContact O-N 3.45Å
125	L	89.4	Confident	86.2	Confident	69 Å²	69	106 Å²	106	36%	0.361	50%	0.501	S	S	.	.	H	α-helix	trans	-61.3	-41.4	179.6	-173	66.1	0	0	0	111.7	Y121 I122 R127 E128 L129	Y121-L125 PolarHBondContact O-N 3.42Å; I122-L125 PolarHBondContact O-N 2.56Å; L125-R127 VanDerWaalsContact C-N 3.33Å; L125-R127 PolarHBondContact O-N 3Å; L125-E128 PolarHBondContact O-N 3.48Å; L125-L129 HydrophobicContact CG-CD1 4.41Å; L125-L129 WeakPolarHBondContact O-CG 3.34Å; L125-L129 PolarHBondContact O-N 3Å
126	C	89.9	Confident	85.9	Confident	60 Å²	60	106.3 Å²	106.3	41%	0.405	50%	0.499	S	S	.	.	H	α-helix	trans	-58.1	-45.5	174.7	-70.8	0	0	0	0	111.6	I122 I123 K124 E128 L129 E130	I122-C126 PolarHBondContact O-N 3.05Å; I122-C126 PolarHBondContact O-SG 2.91Å; I122-C126 VanDerWaalsContact O-SG 3.38Å; I123-C126 PolarHBondContact O-N 2.99Å; K124-C126 VanDerWaalsContact C-N 3.32Å; K124-C126 PolarHBondContact O-N 2.93Å; C126-E128 PolarHBondContact O-N 3.47Å; C126-L129 PolarHBondContact O-N 3.41Å; C126-E130 WeakPolarHBondContact O-CG 3.44Å; C126-E130 PolarHBondContact O-N 2.94Å
127	R	91.7	Very high	85.2	Confident	174 Å²	174	104.1 Å²	104.1	66%	0.657	50%	0.5	S	S	*	.	H	α-helix	trans	-64.7	-38.1	178.5	-71.9	178.9	178	170.3	0.4	113.1	I123 K124 L125 E130 S131	I123-R127 PolarHBondContact O-N 3.36Å; I123-R127 VanDerWaalsContact O-N 3.16Å; K124-R127 PolarHBondContact O-N 3.18Å; K124-R127 VanDerWaalsContact O-N 3.15Å; L125-R127 VanDerWaalsContact C-N 3.33Å; L125-R127 PolarHBondContact O-N 3Å; R127-E130 PolarHBondContact O-N 3.41Å; R127-S131 WeakPolarHBondContact O-CB 3.43Å; R127-S131 PolarHBondContact O-N 3.11Å
128	E	89.5	Confident	84.1	Confident	98 Å²	98	107.4 Å²	107.4	46%	0.458	51%	0.511	S	S	.	.	H	α-helix	trans	-64.4	-42.7	175.5	-75.6	178.6	-176.5	0	0	111.2	K124 L125 C126 S131 R132	K124-E128 WeakPolarHBondContact CE-OE1 3.4Å; K124-E128 IonicContact NZ-OE1 3.63Å; K124-E128 PolarHBondContact O-N 3.45Å; L125-E128 PolarHBondContact O-N 3.48Å; C126-E128 PolarHBondContact O-N 3.47Å; E128-S131 PolarHBondContact O-N 3.34Å; E128-R132 WeakPolarHBondContact O-CG 3.31Å; E128-R132 PolarHBondContact O-N 3.21Å
129	L	85.2	Confident	83	Confident	93 Å²	93	109.3 Å²	109.3	49%	0.487	52%	0.522	S	S	.	.	H	α-helix	trans	-63.5	-44.5	176.1	-70.9	173.2	0	0	0	111.8	L125 C126 S131 R132 I133	L125-L129 HydrophobicContact CG-CD1 4.41Å; L125-L129 WeakPolarHBondContact O-CG 3.34Å; L125-L129 PolarHBondContact O-N 3Å; C126-L129 PolarHBondContact O-N 3.41Å; L129-S131 VanDerWaalsContact C-N 3.33Å; L129-S131 PolarHBondContact O-N 3.03Å; L129-R132 PolarHBondContact O-N 3.08Å; L129-I133 WeakPolarHBondContact O-CG1 3.42Å; L129-I133 PolarHBondContact O-N 3.35Å
130	E	89.5	Confident	81.6	Confident	121 Å²	121	107 Å²	107	57%	0.565	53%	0.528	S	S	*	.	H	α-helix	trans	-57.8	-46.1	174.7	-73.4	169.7	172.9	0	0	111.3	C126 R127 R132 I133 D134	C126-E130 WeakPolarHBondContact O-CG 3.44Å; C126-E130 PolarHBondContact O-N 2.94Å; R127-E130 PolarHBondContact O-N 3.41Å; E130-R132 VanDerWaalsContact C-N 3.3Å; E130-R132 PolarHBondContact O-N 3.18Å; E130-I133 PolarHBondContact O-N 2.87Å; E130-D134 PolarHBondContact O-N 3.18Å
131	S	86.3	Confident	79.6	Confident	57 Å²	57	110.2 Å²	110.2	40%	0.399	54%	0.542	S	S	.	.	H	α-helix	trans	-64	-34.4	177.9	-178.4	0	0	0	0	113	R127 E128 L129 D134 Q135	R127-S131 WeakPolarHBondContact O-CB 3.43Å; R127-S131 PolarHBondContact O-N 3.11Å; E128-S131 PolarHBondContact O-N 3.34Å; L129-S131 VanDerWaalsContact C-N 3.33Å; L129-S131 PolarHBondContact O-N 3.03Å; S131-D134 PolarHBondContact O-N 3.13Å; S131-Q135 WeakPolarHBondContact O-CG 3.35Å; S131-Q135 PolarHBondContact O-N 2.93Å; S131-Q135 VanDerWaalsContact O-N 3.15Å
132	R	82.8	Confident	77.3	Confident	150 Å²	150	114.6 Å²	114.6	57%	0.566	57%	0.572	S	S	*	*	H	α-helix	trans	-68.1	-43.6	176.5	-75.8	-176.2	71.2	174.6	1.9	111	E128 L129 E130 D134 Q135 E136	E128-R132 WeakPolarHBondContact O-CG 3.31Å; E128-R132 PolarHBondContact O-N 3.21Å; L129-R132 PolarHBondContact O-N 3.08Å; E130-R132 VanDerWaalsContact C-N 3.3Å; E130-R132 PolarHBondContact O-N 3.18Å; R132-D134 VanDerWaalsContact C-N 3.26Å; R132-D134 PolarHBondContact O-N 3.42Å; R132-Q135 PolarHBondContact O-N 3.39Å; R132-Q135 VanDerWaalsContact O-N 3.14Å; R132-E136 WeakPolarHBondContact O-CG 3.45Å; R132-E136 PolarHBondContact O-N 3.06Å
133	I	82.2	Confident	76.9	Confident	114 Å²	114	116.6 Å²	116.6	59%	0.585	58%	0.582	S	S	*	*	H	α-helix	trans	-56.9	-43.9	175.7	-67.9	166.5	0	0	0	110.2	L129 E130 Q135 E136 G137	L129-I133 WeakPolarHBondContact O-CG1 3.42Å; L129-I133 PolarHBondContact O-N 3.35Å; E130-I133 PolarHBondContact O-N 2.87Å; I133-Q135 PolarHBondContact O-N 3.07Å; I133-E136 PolarHBondContact O-N 3.18Å; I133-G137 PolarHBondContact O-N 3.2Å
134	D	84.9	Confident	76.1	Confident	107 Å²	107	119.4 Å²	119.4	57%	0.572	60%	0.595	S	S	*	*	H	α-helix	trans	-64.4	-37.9	178.2	-81.3	-8.6	0	0	0	113.3	E130 S131 R132 K138	E130-D134 PolarHBondContact O-N 3.18Å; S131-D134 PolarHBondContact O-N 3.13Å; R132-D134 VanDerWaalsContact C-N 3.26Å; R132-D134 PolarHBondContact O-N 3.42Å; D134-K138 WeakPolarHBondContact O-CG 3.36Å; D134-K138 PolarHBondContact O-N 2.91Å; D134-K138 VanDerWaalsContact O-N 3.13Å
135	Q	79.9	Confident	75.3	Confident	123 Å²	123	118.9 Å²	118.9	58%	0.575	60%	0.597	S	S	*	*	H	α-helix	trans	-70.1	-42	177.8	-73.5	-178.9	10.9	0	0	111.9	S131 R132 I133 G137 K138 K139	S131-Q135 WeakPolarHBondContact O-CG 3.35Å; S131-Q135 PolarHBondContact O-N 2.93Å; S131-Q135 VanDerWaalsContact O-N 3.15Å; R132-Q135 PolarHBondContact O-N 3.39Å; R132-Q135 VanDerWaalsContact O-N 3.14Å; I133-Q135 PolarHBondContact O-N 3.07Å; Q135-G137 VanDerWaalsContact C-N 3.34Å; Q135-K138 PolarHBondContact O-N 3.27Å; Q135-K139 PolarHBondContact O-N 3.34Å
136	E	73.4	Confident	74.5	Confident	116 Å²	116	121.9 Å²	121.9	54%	0.542	61%	0.611	S	S	.	*	H	α-helix	trans	-66.2	-40.3	176.9	-70.9	175.7	-170.1	0	0	110.3	R132 I133 K138 K139 S140	R132-E136 WeakPolarHBondContact O-CG 3.45Å; R132-E136 PolarHBondContact O-N 3.06Å; I133-E136 PolarHBondContact O-N 3.18Å; E136-K138 VanDerWaalsContact C-N 3.32Å; E136-K138 PolarHBondContact O-N 3.01Å; E136-K139 PolarHBondContact O-N 3.03Å; E136-K139 VanDerWaalsContact O-N 3.14Å; E136-S140 PolarHBondContact O-N 3.18Å
137	G	65.4	Low	73.6	Confident	43 Å²	43	125.8 Å²	125.8	44%	0.443	62%	0.624	S	S	.	*	H	α-helix	trans	-60.5	-35.8	174.2	0	0	0	0	0	113.9	I133 Q135 K139 S140	I133-G137 PolarHBondContact O-N 3.2Å; Q135-G137 VanDerWaalsContact C-N 3.34Å; G137-K139 VanDerWaalsContact C-N 3.35Å; G137-S140 PolarHBondContact O-N 3.23Å
138	K	63	Low	72.4	Confident	164 Å²	164	122.5 Å²	122.5	71%	0.713	62%	0.622	S	S	*	*	H	α-helix	trans	-70.3	-28.1	176.2	-76.1	177.2	-175.7	177.3	0	113.6	D134 Q135 E136 S140	D134-K138 WeakPolarHBondContact O-CG 3.36Å; D134-K138 PolarHBondContact O-N 2.91Å; D134-K138 VanDerWaalsContact O-N 3.13Å; Q135-K138 PolarHBondContact O-N 3.27Å; E136-K138 VanDerWaalsContact C-N 3.32Å; E136-K138 PolarHBondContact O-N 3.01Å; K138-S140 VanDerWaalsContact C-N 3.26Å; K138-S140 PolarHBondContact O-N 2.92Å
139	K	57.4	Low	71.1	Confident	177 Å²	177	124.3 Å²	124.3	77%	0.77	63%	0.634	S	S	*	*	H	α-helix	trans	-73.6	-19	176.2	-72.1	-174.1	178.2	-178	0	112.8	Q135 E136 G137 N141	Q135-K139 PolarHBondContact O-N 3.34Å; E136-K139 PolarHBondContact O-N 3.03Å; E136-K139 VanDerWaalsContact O-N 3.14Å; G137-K139 VanDerWaalsContact C-N 3.35Å; K139-N141 VanDerWaalsContact C-N 3.26Å; K139-N141 PolarHBondContact O-N 3.44Å
140	S	57.7	Low	70	Confident	99 Å²	99	126.7 Å²	126.7	69%	0.692	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.6	10.2	175.4	-64.2	0	0	0	0	114.8	E136 G137 K138	E136-S140 PolarHBondContact O-N 3.18Å; G137-S140 PolarHBondContact O-N 3.23Å; K138-S140 VanDerWaalsContact C-N 3.26Å; K138-S140 PolarHBondContact O-N 2.92Å
141	N	49.4	Very low	68.4	Low	152 Å²	152	127.2 Å²	127.2	81%	0.813	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-117.8	22	179.3	-96.8	-14.4	0	0	0	114.8	K139	K139-N141 VanDerWaalsContact C-N 3.26Å; K139-N141 PolarHBondContact O-N 3.44Å
142	I	38.7	Very low	66.8	Low	224 Å²	224	133.5 Å²	133.5	100%	1.149	67%	0.674	S	S	*	*			trans	-120.8	0	157.4	-58.3	175.3	0	0	0	106.5

Retrieved 142 of 142 residues in 94.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).