A0A5K4F5V8_SCHMA Loading...

CST complex subunit TEN1

AlphaFold DB , UniProt , Accession A0A5K4F5V8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 93 aa.

						>A0A5K4F5V8_SCHMA|A0A5K4F5V8
MPRNAEVHICHGKYLVAGICKNRKFRLVGLQEQLSKEGHTPYLHDTSDLYEVTEIKVNEEVVHQCKVTDFQFGGDGELDPLCKIIVDKVNTAY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.1	Low	82.2	Confident	172 Å²	172	65.4 Å²	65.4	85%	0.847	31%	0.308	S	S	*	.				0	88.4	0	-88.4	-169.1	168.2	0	0	106.6	R3	M1-R3 PolarHBondContact O-N 2.73Å
2	P	57.3	Low	83.1	Confident	23 Å²	23	59.9 Å²	59.9	15%	0.149	28%	0.282	C	S	.	.			trans	-70.7	89.8	170.3	31	-31.5	0	0	0	106.9	N4 A5 H39 N90 A92 Y93	P2-N4 PolarHBondContact O-N 3.4Å; P2-A5 HydrophobicContact CB-CB 4.01Å; P2-A5 HydrophobicContact CG-CB 4.23Å; P2-H39 PolarHBondContact O-CE1 2.84Å; P2-H39 VanDerWaalsContact O-CE1 3.23Å; P2-N90 WeakPolarHBondContact CD-O 3.06Å; P2-A92 WeakPolarHBondContact CG-O 3.21Å; P2-Y93 VanDerWaalsContact CB-O 3.28Å; P2-Y93 WeakPolarHBondContact CB-O 2.99Å; P2-Y93 VanDerWaalsContact CD-O 3.24Å; P2-Y93 WeakPolarHBondContact CD-O 3.49Å; P2-Y93 WeakPolarHBondContact CG-O 3.46Å
3	R	67.2	Low	83.9	Confident	217 Å²	217	60.9 Å²	60.9	82%	0.819	29%	0.285	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63	131.4	170	-77	-176.4	173.1	-179.4	-2.4	107.6	M1	M1-R3 PolarHBondContact O-N 2.73Å
4	N	75.8	Confident	84.5	Confident	121 Å²	121	56.6 Å²	56.6	65%	0.647	27%	0.265	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.1	37.9	177.6	-49.8	-14.2	0	0	0	114.3	P2 G38	P2-N4 PolarHBondContact O-N 3.4Å; N4-G38 WeakPolarHBondContact CA-O 3.49Å; N4-G38 PolarHBondContact OD1-O 2.93Å
5	A	84	Confident	84.9	Confident	8 Å²	8	59.1 Å²	59.1	7%	0.066	28%	0.28	C	S	.	.			trans	-63.7	140.3	172.2	0	0	0	0	0	111.9	P2 H39 T40 V57	P2-A5 HydrophobicContact CB-CB 4.01Å; P2-A5 HydrophobicContact CG-CB 4.23Å; A5-H39 WeakPolarHBondContact CB-ND1 3.28Å; A5-H39 PolarHBondContact N-ND1 3.2Å; A5-T40 PolarHBondContact O-N 3.2Å; A5-T40 VanDerWaalsContact O-N 3.09Å; A5-V57 HydrophobicContact CB-CG1 4.07Å
6	E	92.7	Very high	85.2	Confident	105 Å²	105	58.9 Å²	58.9	49%	0.491	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.4	119.8	167.4	-63.3	-173	151.3	0	0	109.1	Y42	E6-Y42 HydrophobicContact CB-CD2 4.48Å; E6-Y42 HydrophobicContact CB-CE2 4.14Å; E6-Y42 HydrophobicContact CG-CE2 4.09Å
7	V	94.6	Very high	85.5	Confident	0 Å²	0	61.2 Å²	61.2	0%	0	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	115.2	-176.5	-175.9	0	0	0	0	108.8	I9 L34 H39 T40 P41 Y42 I55 V57 V89	V7-I9 HydrophobicContact CG1-CG1 4.46Å; V7-L34 HydrophobicContact CB-CD1 4.28Å; V7-L34 HydrophobicContact CG1-CD1 3.8Å; V7-L34 HydrophobicContact CG1-CD2 4.49Å; V7-L34 HydrophobicContact CG2-CD2 4.37Å; V7-H39 HydrophobicContact CG2-CB 3.92Å; V7-T40 PolarHBondContact N-O 3.32Å; V7-P41 CarbonylContact O-C 3.54Å; V7-P41 WeakPolarHBondContact O-CA 3.48Å; V7-Y42 PolarHBondContact O-N 3.18Å; V7-I55 HydrophobicContact CG1-CG2 3.58Å; V7-V57 HydrophobicContact CG1-CG2 4.41Å; V7-V57 HydrophobicContact CG2-CG2 4.21Å; V7-V89 HydrophobicContact CG1-CG2 4.35Å; V7-V89 HydrophobicContact CG2-CG1 3.79Å
8	H	95	Very high	85.9	Confident	58 Å²	58	61.7 Å²	61.7	27%	0.269	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	113.6	179.9	-62.4	-111.3	0	0	0	109.6	H44 K56	H8-H44 AromaticContact CG-NE2 3.77Å; H8-H44 AromaticContact ND1-CD2 3.84Å; H8-H44 AromaticContact ND1-CE1 3.84Å; H8-H44 AromaticContact ND1-NE2 3.03Å; H8-H44 PolarHBondContact ND1-NE2 3.48Å; H8-K56 HydrophobicContact CB-CB 4.16Å; H8-K56 PolarHBondContact N-O 2.83Å; H8-K56 PolarHBondContact O-N 3.08Å
9	I	95.2	Very high	86.2	Confident	0 Å²	0	63.7 Å²	63.7	0%	0	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.1	92.8	177.9	-52.3	172.6	0	0	0	107.6	V7 L27 L30 Q31 L34 P41 Y42 L43 H44 T53 I55	V7-I9 HydrophobicContact CG1-CG1 4.46Å; I9-L27 HydrophobicContact CG2-CD1 4.18Å; I9-L27 HydrophobicContact CG2-CD2 4.42Å; I9-L30 HydrophobicContact CD1-CD2 3.97Å; I9-L30 HydrophobicContact CD1-CG 4.27Å; I9-L30 HydrophobicContact CG1-CD2 4.43Å; I9-Q31 HydrophobicContact CD1-CG 3.95Å; I9-L34 HydrophobicContact CD1-CD1 4Å; I9-P41 HydrophobicContact CD1-CB 3.98Å; I9-Y42 PolarHBondContact N-O 3.43Å; I9-L43 HydrophobicContact CB-CD2 3.98Å; I9-L43 HydrophobicContact CB-CG 4.49Å; I9-L43 HydrophobicContact CG2-CD2 3.76Å; I9-H44 PolarHBondContact O-N 3.05Å; I9-T53 HydrophobicContact CG2-CG2 3.79Å; I9-I55 HydrophobicContact CB-CD1 4.19Å; I9-I55 HydrophobicContact CG1-CD1 3.91Å; I9-I55 HydrophobicContact CG2-CD1 3.83Å
10	C	94.5	Very high	86.4	Confident	15 Å²	15	63.8 Å²	63.8	10%	0.101	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.7	117.2	176.9	-61.8	0	0	0	0	109.3	H44 L49 T53 E54	C10-H44 WeakPolarHBondContact CA-O 3.34Å; C10-L49 HydrophobicContact CB-CD1 4.5Å; C10-T53 CarbonylContact O-C 3.59Å; C10-T53 WeakPolarHBondContact O-CA 3.37Å; C10-E54 HydrophobicContact CB-CB 4.32Å; C10-E54 PolarHBondContact N-O 3.26Å; C10-E54 PolarHBondContact O-N 2.96Å
11	H	94.2	Very high	86.7	Confident	0 Å²	0	65.9 Å²	65.9	0%	0	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.6	142.9	-176.8	77.9	94.1	0	0	0	113.6	N22 R23 L27 H44 D45 T46 T53 V67	H11-N22 PolarHBondContact O-ND2 3.45Å; H11-R23 PolarHBondContact CE1-O 3.5Å; H11-L27 HydrophobicContact CB-CD1 3.6Å; H11-L27 VanDerWaalsContact CD2-CD1 3.44Å; H11-L27 WeakPolarHBondContact CD2-CD1 3.49Å; H11-H44 PolarHBondContact N-O 3.13Å; H11-D45 IonicContact CE1-OD1 3.9Å; H11-D45 PolarHBondContact CE1-OD1 3.34Å; H11-D45 VanDerWaalsContact CE1-OD1 3.23Å; H11-D45 IonicContact NE2-OD1 2.73Å; H11-D45 PolarHBondContact NE2-OD1 3.26Å; H11-T46 PolarHBondContact O-N 3.09Å; H11-T53 HydrophobicContact CB-CG2 4.23Å; H11-V67 HydrophobicContact CB-CG2 4.12Å
12	G	93.1	Very high	88.4	Confident	0 Å²	0	59.7 Å²	59.7	0%	0	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.3	173.9	179.3	0	0	0	0	0	114.6	N22 L49 V52	G12-N22 VanDerWaalsContact C-ND2 3.33Å; G12-L49 CarbonylContact C-O 3.58Å; G12-L49 WeakPolarHBondContact CA-O 3.48Å; G12-V52 PolarHBondContact N-O 2.94Å
13	K	93.6	Very high	90	Very high	73 Å²	73	59.9 Å²	59.9	32%	0.317	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73	147	170	-60.3	171	-170.3	169.8	0	109.4	N22 L49 Y50 E51	K13-N22 WeakPolarHBondContact CG-OD1 3.38Å; K13-L49 PolarHBondContact N-O 2.77Å; K13-Y50 CarbonylContact O-C 3.54Å; K13-Y50 WeakPolarHBondContact O-CD2 3.45Å; K13-E51 PolarHBondContact O-N 2.95Å
14	Y	92	Very high	91.1	Very high	1 Å²	1	53.7 Å²	53.7	0%	0.004	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.2	153	170.6	66.6	-76.5	0	0	0	111.4	V16 K21 R23 V67 T68	Y14-V16 HydrophobicContact CD2-CG2 3.49Å; Y14-V16 VanDerWaalsContact CD2-CG2 3.49Å; Y14-V16 HydrophobicContact CE2-CG2 3.22Å; Y14-K21 PolarHBondContact N-O 3.15Å; Y14-K21 PolarHBondContact O-N 2.84Å; Y14-R23 HydrophobicContact CE1-CB 3.62Å; Y14-R23 HydrophobicContact CE1-CG 4Å; Y14-R23 PolarHBondContact O-NH1 3.27Å; Y14-R23 WeakPolarHBondContact OH-CB 3.36Å; Y14-V67 HydrophobicContact CD1-CB 4.11Å; Y14-V67 HydrophobicContact CD1-CG1 3.51Å; Y14-V67 HydrophobicContact CE1-CB 4.47Å; Y14-V67 HydrophobicContact CE1-CG1 3.41Å; Y14-V67 VanDerWaalsContact CE1-CG1 3.41Å; Y14-V67 HydrophobicContact CG-CB 4.47Å; Y14-V67 HydrophobicContact CG-CG1 4.18Å; Y14-T68 HydrophobicContact CD2-CG2 3.92Å; Y14-T68 HydrophobicContact CE2-CG2 4.49Å
15	L	90.9	Very high	91.8	Very high	93 Å²	93	54.3 Å²	54.3	49%	0.487	30%	0.301	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.9	125.3	-178.2	-173.8	67.5	0	0	0	110.7	G18 C20	L15-G18 VanDerWaalsContact CD1-C 3.47Å; L15-C20 HydrophobicContact CD1-CB 4.29Å
16	V	89.5	Confident	92.2	Very high	56 Å²	56	56.4 Å²	56.4	34%	0.339	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.8	128	168.1	-178	0	0	0	0	108	Y14 G18 I19 R23	Y14-V16 HydrophobicContact CD2-CG2 3.49Å; Y14-V16 VanDerWaalsContact CD2-CG2 3.49Å; Y14-V16 HydrophobicContact CE2-CG2 3.22Å; V16-G18 VanDerWaalsContact C-N 3.26Å; V16-G18 PolarHBondContact O-N 3.07Å; V16-I19 PolarHBondContact N-O 3.46Å; V16-I19 VanDerWaalsContact N-O 3.11Å; V16-I19 PolarHBondContact O-N 2.87Å; V16-R23 PolarHBondContact O-NH2 3.01Å
17	A	90.4	Very high	92.2	Very high	98 Å²	98	51.4 Å²	51.4	81%	0.81	28%	0.284	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.1	45.2	179	0	0	0	0	0	113	I19	A17-I19 VanDerWaalsContact C-N 3.26Å; A17-I19 PolarHBondContact O-N 3.36Å
18	G	91.8	Very high	92.2	Very high	70 Å²	70	53.9 Å²	53.9	72%	0.722	30%	0.299	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.4	-3.2	178.7	0	0	0	0	0	115.8	L15 V16	L15-G18 VanDerWaalsContact CD1-C 3.47Å; V16-G18 VanDerWaalsContact C-N 3.26Å; V16-G18 PolarHBondContact O-N 3.07Å
19	I	91.2	Very high	92.1	Very high	100 Å²	100	51.3 Å²	51.3	51%	0.513	29%	0.288	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.9	117.7	-178.4	-57.3	172.9	0	0	0	110.3	V16 A17 K21 R23	V16-I19 PolarHBondContact N-O 3.46Å; V16-I19 VanDerWaalsContact N-O 3.11Å; V16-I19 PolarHBondContact O-N 2.87Å; A17-I19 VanDerWaalsContact C-N 3.26Å; A17-I19 PolarHBondContact O-N 3.36Å; I19-K21 HydrophobicContact CG2-CD 4.15Å; I19-K21 HydrophobicContact CG2-CG 4.19Å; I19-R23 PolarHBondContact O-NH1 2.93Å; I19-R23 PolarHBondContact O-NH2 3.32Å
20	C	91	Very high	92.1	Very high	65 Å²	65	51.3 Å²	51.3	44%	0.439	29%	0.288	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	109.6	174.4	-177.7	0	0	0	0	110.5	L15 Y50	L15-C20 HydrophobicContact CD1-CB 4.29Å; C20-Y50 VanDerWaalsContact SG-CE2 3.59Å
21	K	92.1	Very high	92.1	Very high	109 Å²	109	52.9 Å²	52.9	47%	0.474	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.7	159.4	177.9	64.5	176.5	-177.8	177.6	0	111.7	Y14 I19 R23	Y14-K21 PolarHBondContact N-O 3.15Å; Y14-K21 PolarHBondContact O-N 2.84Å; I19-K21 HydrophobicContact CG2-CD 4.15Å; I19-K21 HydrophobicContact CG2-CG 4.19Å; K21-R23 HydrophobicContact CD-CG 4.39Å; K21-R23 HydrophobicContact CG-CG 3.84Å; K21-R23 PolarHBondContact O-N 3.05Å
22	N	90.3	Very high	92	Very high	41 Å²	41	57.3 Å²	57.3	22%	0.219	31%	0.314	C	S	.	.			trans	-65.2	129.2	167.5	-59.7	82	0	0	0	108.3	H11 G12 K13 D45 T46	H11-N22 PolarHBondContact O-ND2 3.45Å; G12-N22 VanDerWaalsContact C-ND2 3.33Å; K13-N22 WeakPolarHBondContact CG-OD1 3.38Å; N22-D45 HydrophobicContact CB-CB 4.27Å; N22-D45 VanDerWaalsContact CB-OD1 3.3Å; N22-D45 WeakPolarHBondContact CB-OD1 3.5Å; N22-T46 PolarHBondContact ND2-O 3.36Å
23	R	90.8	Very high	92	Very high	27 Å²	27	58.6 Å²	58.6	10%	0.102	32%	0.32	C	S	.	.			trans	-135.7	143.2	173.2	-50	176.6	174.3	79.3	-3.7	108.6	H11 Y14 V16 I19 K21 F25	H11-R23 PolarHBondContact CE1-O 3.5Å; Y14-R23 HydrophobicContact CE1-CB 3.62Å; Y14-R23 HydrophobicContact CE1-CG 4Å; Y14-R23 PolarHBondContact O-NH1 3.27Å; Y14-R23 WeakPolarHBondContact OH-CB 3.36Å; V16-R23 PolarHBondContact O-NH2 3.01Å; I19-R23 PolarHBondContact O-NH1 2.93Å; I19-R23 PolarHBondContact O-NH2 3.32Å; K21-R23 HydrophobicContact CD-CG 4.39Å; K21-R23 HydrophobicContact CG-CG 3.84Å; K21-R23 PolarHBondContact O-N 3.05Å; R23-F25 HydrophobicContact CB-CD2 4.24Å
24	K	91.3	Very high	92	Very high	88 Å²	88	55.1 Å²	55.1	38%	0.383	31%	0.305	S	S	.	.			trans	-101.5	-11.6	-172.8	-60.9	175.7	-177.6	-177.3	0	113.2	R26 L27 V28 L43 D45	K24-R26 VanDerWaalsContact C-N 3.29Å; K24-R26 PolarHBondContact O-N 3.4Å; K24-R26 VanDerWaalsContact O-N 3.14Å; K24-L27 WeakPolarHBondContact O-CA 3.4Å; K24-L27 PolarHBondContact O-N 3.37Å; K24-V28 PolarHBondContact O-N 2.94Å; K24-L43 HydrophobicContact CB-CD1 4.16Å; K24-L43 HydrophobicContact CD-CD1 4.02Å; K24-L43 HydrophobicContact CG-CD1 4.08Å; K24-D45 WeakPolarHBondContact CE-OD1 3.46Å; K24-D45 WeakPolarHBondContact CE-OD2 3.37Å; K24-D45 IonicContact NZ-OD1 3.8Å; K24-D45 IonicContact NZ-OD2 2.81Å; K24-D45 PolarHBondContact NZ-OD2 3.48Å
25	F	90.1	Very high	92	Very high	133 Å²	133	57.9 Å²	57.9	58%	0.583	33%	0.325	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.7	-36.6	-171.1	-65.7	-74.2	0	0	0	115.1	R23 L27 F72 G73	R23-F25 HydrophobicContact CB-CD2 4.24Å; F25-L27 VanDerWaalsContact C-N 3.33Å; F25-F72 HydrophobicContact CB-CD1 3.92Å; F25-F72 HydrophobicContact CB-CE1 3.4Å; F25-F72 VanDerWaalsContact CB-CE1 3.4Å; F25-F72 HydrophobicContact CB-CZ 4.23Å; F25-F72 HydrophobicContact CG-CE1 4.11Å; F25-G73 PolarHBondContact O-N 3.12Å; F25-G73 VanDerWaalsContact O-N 3.16Å
26	R	91.4	Very high	92	Very high	53 Å²	53	58.6 Å²	58.6	20%	0.2	32%	0.324	C	S	.	.	T	Hydrogen-bonded Turn	trans	-77.4	-20.2	177.4	-67.2	-176.5	177	-101.3	3.6	113.2	K24 V67 T68 F70 F72	K24-R26 VanDerWaalsContact C-N 3.29Å; K24-R26 PolarHBondContact O-N 3.4Å; K24-R26 VanDerWaalsContact O-N 3.14Å; R26-V67 WeakPolarHBondContact CD-O 3.42Å; R26-T68 PolarHBondContact NH1-O 2.78Å; R26-T68 VanDerWaalsContact NH1-O 3.14Å; R26-F70 HydrophobicContact CB-CB 3.86Å; R26-F70 PolarHBondContact NH1-O 3.14Å; R26-F70 WeakPolarHBondContact O-CB 3.5Å; R26-F72 HydrophobicContact CG-CD1 4.42Å; R26-F72 HydrophobicContact CG-CD2 3.63Å; R26-F72 HydrophobicContact CG-CE2 3.77Å; R26-F72 HydrophobicContact CG-CG 3.98Å; R26-F72 HydrophobicContact CG-CZ 4.23Å; R26-F72 VanDerWaalsContact CZ-CD2 3.43Å; R26-F72 VanDerWaalsContact NE-CE2 3.28Å
27	L	93.3	Very high	92.1	Very high	0 Å²	0	61 Å²	61	0%	0	33%	0.331	C	S	.	.	T	Hydrogen-bonded Turn	trans	-91.1	-10.5	-176.6	-58.7	173.6	0	0	0	112.7	I9 H11 K24 F25 G29 L30 Q31 L43 T53 F70	I9-L27 HydrophobicContact CG2-CD1 4.18Å; I9-L27 HydrophobicContact CG2-CD2 4.42Å; H11-L27 HydrophobicContact CB-CD1 3.6Å; H11-L27 VanDerWaalsContact CD2-CD1 3.44Å; H11-L27 WeakPolarHBondContact CD2-CD1 3.49Å; K24-L27 WeakPolarHBondContact O-CA 3.4Å; K24-L27 PolarHBondContact O-N 3.37Å; F25-L27 VanDerWaalsContact C-N 3.33Å; L27-G29 VanDerWaalsContact C-N 3.33Å; L27-G29 PolarHBondContact O-N 3.37Å; L27-L30 PolarHBondContact O-N 3.17Å; L27-Q31 WeakPolarHBondContact O-CG 3.38Å; L27-Q31 PolarHBondContact O-N 3.44Å; L27-Q31 VanDerWaalsContact O-N 3.09Å; L27-L43 HydrophobicContact CB-CD2 4.09Å; L27-L43 HydrophobicContact CD1-CD2 3.48Å; L27-L43 VanDerWaalsContact CD1-CD2 3.48Å; L27-L43 HydrophobicContact CG-CD2 4.41Å; L27-T53 HydrophobicContact CD2-CG2 4.09Å; L27-F70 HydrophobicContact CD2-CD2 3.63Å; L27-F70 HydrophobicContact CD2-CE1 4.44Å; L27-F70 HydrophobicContact CD2-CE2 3.53Å; L27-F70 HydrophobicContact CD2-CG 4.13Å; L27-F70 HydrophobicContact CD2-CZ 3.97Å
28	V	93.6	Very high	92.1	Very high	52 Å²	52	57.8 Å²	57.8	32%	0.315	31%	0.308	S	S	.	.	H	α-helix	trans	-56.6	-46.8	179.5	177.7	0	0	0	0	111.2	K24 L30 Q31 E32	K24-V28 PolarHBondContact O-N 2.94Å; V28-L30 VanDerWaalsContact C-N 3.29Å; V28-L30 PolarHBondContact O-N 3.12Å; V28-Q31 WeakPolarHBondContact O-CB 3.45Å; V28-Q31 PolarHBondContact O-N 3.23Å; V28-Q31 VanDerWaalsContact O-N 3.13Å; V28-E32 PolarHBondContact O-N 3.18Å
29	G	93.8	Very high	92.2	Very high	3 Å²	3	54.8 Å²	54.8	3%	0.031	28%	0.275	C	S	.	.	H	α-helix	trans	-60.3	-38.6	179.4	0	0	0	0	0	112.9	L27 E32 Q33 G74	L27-G29 VanDerWaalsContact C-N 3.33Å; L27-G29 PolarHBondContact O-N 3.37Å; G29-E32 PolarHBondContact O-N 2.72Å; G29-Q33 WeakPolarHBondContact O-CG 3.29Å; G29-Q33 PolarHBondContact O-N 3.4Å; G29-G74 WeakPolarHBondContact CA-O 3.35Å
30	L	94.5	Very high	92.2	Very high	0 Å²	0	53 Å²	53	0%	0	27%	0.269	C	S	.	.	H	α-helix	trans	-66	-41.5	176	177.7	63.9	0	0	0	111.8	I9 L27 V28 E32 Q33 L34 I55 F70 C82 I85	I9-L30 HydrophobicContact CD1-CD2 3.97Å; I9-L30 HydrophobicContact CD1-CG 4.27Å; I9-L30 HydrophobicContact CG1-CD2 4.43Å; L27-L30 PolarHBondContact O-N 3.17Å; V28-L30 VanDerWaalsContact C-N 3.29Å; V28-L30 PolarHBondContact O-N 3.12Å; L30-E32 VanDerWaalsContact C-N 3.33Å; L30-E32 PolarHBondContact O-N 3.05Å; L30-Q33 PolarHBondContact O-N 3.33Å; L30-L34 HydrophobicContact CD1-CD1 4.01Å; L30-L34 HydrophobicContact CD1-CG 4.11Å; L30-L34 HydrophobicContact CD2-CD1 4.46Å; L30-L34 HydrophobicContact CG-CD1 3.87Å; L30-L34 HydrophobicContact CG-CG 4.4Å; L30-L34 WeakPolarHBondContact O-CB 3.33Å; L30-L34 WeakPolarHBondContact O-CG 3.5Å; L30-L34 PolarHBondContact O-N 3.04Å; L30-I55 HydrophobicContact CD2-CD1 3.62Å; L30-F70 HydrophobicContact CB-CE1 4.04Å; L30-F70 HydrophobicContact CD2-CE1 3.76Å; L30-F70 HydrophobicContact CD2-CZ 3.83Å; L30-F70 HydrophobicContact CG-CE1 4.33Å; L30-C82 HydrophobicContact CD1-CB 4.34Å; L30-I85 HydrophobicContact CD1-CB 3.92Å; L30-I85 HydrophobicContact CD1-CD1 4.1Å; L30-I85 HydrophobicContact CD1-CG2 3.7Å; L30-I85 HydrophobicContact CD2-CD1 4Å; L30-I85 HydrophobicContact CD2-CG2 4.35Å
31	Q	94.6	Very high	92.4	Very high	48 Å²	48	51 Å²	51	22%	0.224	26%	0.255	C	S	.	.	H	α-helix	trans	-61.6	-42.8	177.4	-65.8	-172.6	-65	0	0	111.7	I9 L27 V28 L34 S35 P41 L43	I9-Q31 HydrophobicContact CD1-CG 3.95Å; L27-Q31 WeakPolarHBondContact O-CG 3.38Å; L27-Q31 PolarHBondContact O-N 3.44Å; L27-Q31 VanDerWaalsContact O-N 3.09Å; V28-Q31 WeakPolarHBondContact O-CB 3.45Å; V28-Q31 PolarHBondContact O-N 3.23Å; V28-Q31 VanDerWaalsContact O-N 3.13Å; Q31-L34 PolarHBondContact O-N 3.34Å; Q31-S35 WeakPolarHBondContact O-CB 3.3Å; Q31-S35 PolarHBondContact O-N 3.18Å; Q31-S35 PolarHBondContact O-OG 3.47Å; Q31-P41 HydrophobicContact CB-CB 4.4Å; Q31-P41 HydrophobicContact CB-CG 4.05Å; Q31-P41 HydrophobicContact CG-CB 4.27Å; Q31-P41 HydrophobicContact CG-CG 4.37Å; Q31-L43 HydrophobicContact CG-CD1 4.25Å; Q31-L43 HydrophobicContact CG-CG 4.49Å
32	E	93.7	Very high	92.5	Very high	93 Å²	93	50.3 Å²	50.3	44%	0.435	25%	0.25	S	S	.	.	H	α-helix	trans	-62	-46.3	176.7	-70.7	-65.3	151	0	0	111.2	V28 G29 L30 L34 S35 K36	V28-E32 PolarHBondContact O-N 3.18Å; G29-E32 PolarHBondContact O-N 2.72Å; L30-E32 VanDerWaalsContact C-N 3.33Å; L30-E32 PolarHBondContact O-N 3.05Å; E32-L34 PolarHBondContact O-N 3.34Å; E32-S35 PolarHBondContact O-N 3.49Å; E32-K36 WeakPolarHBondContact O-CB 3.41Å; E32-K36 WeakPolarHBondContact O-CG 3.4Å; E32-K36 PolarHBondContact O-N 2.73Å
33	Q	93.1	Very high	92.7	Very high	27 Å²	27	50.1 Å²	50.1	13%	0.126	25%	0.249	C	C	.	.	H	α-helix	trans	-61.7	-45.3	177.8	-73.3	-62.1	-51.4	0	0	112.7	G29 L30 S35 K36 E37 D75 C82 V86	G29-Q33 WeakPolarHBondContact O-CG 3.29Å; G29-Q33 PolarHBondContact O-N 3.4Å; L30-Q33 PolarHBondContact O-N 3.33Å; Q33-S35 VanDerWaalsContact C-N 3.32Å; Q33-S35 PolarHBondContact O-N 2.93Å; Q33-K36 PolarHBondContact O-N 3.06Å; Q33-E37 WeakPolarHBondContact O-CG 3.33Å; Q33-E37 PolarHBondContact O-N 3.38Å; Q33-E37 VanDerWaalsContact O-N 3.15Å; Q33-D75 WeakPolarHBondContact CG-O 3.33Å; Q33-D75 PolarHBondContact NE2-O 3.47Å; Q33-C82 HydrophobicContact CG-CB 4.07Å; Q33-V86 HydrophobicContact CB-CG2 3.95Å
34	L	92.9	Very high	92.8	Very high	0 Å²	0	52.2 Å²	52.2	0%	0	26%	0.26	C	S	.	.	H	α-helix	trans	-63.1	-40.3	176.7	-70.8	168.5	0	0	0	111.7	V7 I9 L30 Q31 E32 E37 G38 H39 P41 V86 V89	V7-L34 HydrophobicContact CB-CD1 4.28Å; V7-L34 HydrophobicContact CG1-CD1 3.8Å; V7-L34 HydrophobicContact CG1-CD2 4.49Å; V7-L34 HydrophobicContact CG2-CD2 4.37Å; I9-L34 HydrophobicContact CD1-CD1 4Å; L30-L34 HydrophobicContact CD1-CD1 4.01Å; L30-L34 HydrophobicContact CD1-CG 4.11Å; L30-L34 HydrophobicContact CD2-CD1 4.46Å; L30-L34 HydrophobicContact CG-CD1 3.87Å; L30-L34 HydrophobicContact CG-CG 4.4Å; L30-L34 WeakPolarHBondContact O-CB 3.33Å; L30-L34 WeakPolarHBondContact O-CG 3.5Å; L30-L34 PolarHBondContact O-N 3.04Å; Q31-L34 PolarHBondContact O-N 3.34Å; E32-L34 PolarHBondContact O-N 3.34Å; L34-E37 PolarHBondContact O-N 3.33Å; L34-G38 PolarHBondContact O-N 3.02Å; L34-H39 HydrophobicContact CB-CB 4.35Å; L34-H39 WeakPolarHBondContact O-CB 3.46Å; L34-H39 PolarHBondContact O-N 2.86Å; L34-P41 HydrophobicContact CB-CB 4.24Å; L34-P41 HydrophobicContact CB-CG 4.32Å; L34-P41 HydrophobicContact CD1-CB 4.02Å; L34-V86 HydrophobicContact CD2-CG2 3.99Å; L34-V86 HydrophobicContact CG-CG2 4.4Å; L34-V89 HydrophobicContact CD2-CB 4.4Å; L34-V89 HydrophobicContact CD2-CG1 4.33Å; L34-V89 HydrophobicContact CD2-CG2 4.19Å
35	S	92.3	Very high	92.9	Very high	59 Å²	59	52 Å²	52	41%	0.413	26%	0.263	S	S	.	.	H	α-helix	trans	-68	-39.1	178.1	-54.8	0	0	0	0	112.1	Q31 E32 Q33 E37 G38 H39 P41	Q31-S35 WeakPolarHBondContact O-CB 3.3Å; Q31-S35 PolarHBondContact O-N 3.18Å; Q31-S35 PolarHBondContact O-OG 3.47Å; E32-S35 PolarHBondContact O-N 3.49Å; Q33-S35 VanDerWaalsContact C-N 3.32Å; Q33-S35 PolarHBondContact O-N 2.93Å; S35-E37 VanDerWaalsContact C-N 3.27Å; S35-E37 PolarHBondContact O-N 3.47Å; S35-G38 PolarHBondContact O-N 3.15Å; S35-H39 WeakPolarHBondContact CA-O 3.24Å; S35-P41 WeakPolarHBondContact OG-CD 3.3Å; S35-P41 WeakPolarHBondContact OG-CG 3.43Å
36	K	91.5	Very high	92.8	Very high	108 Å²	108	47.4 Å²	47.4	47%	0.47	25%	0.245	S	C	.	.	H	α-helix	trans	-60.1	-37.1	174.8	-81	177.9	176.2	177.6	0	112	E32 Q33 G38 D75 E77	E32-K36 WeakPolarHBondContact O-CB 3.41Å; E32-K36 WeakPolarHBondContact O-CG 3.4Å; E32-K36 PolarHBondContact O-N 2.73Å; Q33-K36 PolarHBondContact O-N 3.06Å; K36-G38 PolarHBondContact O-N 3.25Å; K36-D75 IonicContact NZ-OD2 3.23Å; K36-E77 IonicContact NZ-OE1 3.04Å; K36-E77 PolarHBondContact NZ-OE1 2.9Å
37	E	90.4	Very high	92.2	Very high	107 Å²	107	48.4 Å²	48.4	50%	0.5	26%	0.26	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.2	-3.8	175.7	-69.1	-72.5	141.9	0	0	113.4	Q33 L34 S35 V86	Q33-E37 WeakPolarHBondContact O-CG 3.33Å; Q33-E37 PolarHBondContact O-N 3.38Å; Q33-E37 VanDerWaalsContact O-N 3.15Å; L34-E37 PolarHBondContact O-N 3.33Å; S35-E37 VanDerWaalsContact C-N 3.27Å; S35-E37 PolarHBondContact O-N 3.47Å; E37-V86 HydrophobicContact CG-CG1 3.68Å
38	G	91.3	Very high	91.8	Very high	31 Å²	31	55.3 Å²	55.3	32%	0.32	30%	0.298	S	S	.	.	T	Hydrogen-bonded Turn	trans	89.1	14.3	177	0	0	0	0	0	114.7	N4 L34 S35 K36	N4-G38 WeakPolarHBondContact CA-O 3.49Å; N4-G38 PolarHBondContact OD1-O 2.93Å; L34-G38 PolarHBondContact O-N 3.02Å; S35-G38 PolarHBondContact O-N 3.15Å; K36-G38 PolarHBondContact O-N 3.25Å
39	H	92.2	Very high	91.4	Very high	7 Å²	7	54.5 Å²	54.5	3%	0.032	29%	0.291	C	S	.	.			trans	-88.1	161	171.3	-58.3	-71.3	0	0	0	111.6	P2 A5 V7 L34 S35 P41 N90	P2-H39 PolarHBondContact O-CE1 2.84Å; P2-H39 VanDerWaalsContact O-CE1 3.23Å; A5-H39 WeakPolarHBondContact CB-ND1 3.28Å; A5-H39 PolarHBondContact N-ND1 3.2Å; V7-H39 HydrophobicContact CG2-CB 3.92Å; L34-H39 HydrophobicContact CB-CB 4.35Å; L34-H39 WeakPolarHBondContact O-CB 3.46Å; L34-H39 PolarHBondContact O-N 2.86Å; S35-H39 WeakPolarHBondContact CA-O 3.24Å; H39-P41 VanDerWaalsContact O-CD 3.29Å; H39-P41 WeakPolarHBondContact O-CD 3.37Å; H39-N90 PolarHBondContact NE2-OD1 3.4Å
40	T	93.1	Very high	91.3	Very high	62 Å²	62	60.1 Å²	60.1	38%	0.38	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	102.7	176.1	-50.5	0	0	0	0	110	A5 V7 Y42	A5-T40 PolarHBondContact O-N 3.2Å; A5-T40 VanDerWaalsContact O-N 3.09Å; V7-T40 PolarHBondContact N-O 3.32Å; T40-Y42 HydrophobicContact CG2-CD2 4.49Å; T40-Y42 HydrophobicContact CG2-CE1 4.31Å; T40-Y42 HydrophobicContact CG2-CE2 3.68Å; T40-Y42 WeakPolarHBondContact CG2-OH 3.49Å
41	P	94.2	Very high	91.1	Very high	22 Å²	22	62.5 Å²	62.5	14%	0.143	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.7	126.9	-179	31.4	-33.9	0	0	0	112.8	V7 I9 Q31 L34 S35 H39	V7-P41 CarbonylContact O-C 3.54Å; V7-P41 WeakPolarHBondContact O-CA 3.48Å; I9-P41 HydrophobicContact CD1-CB 3.98Å; Q31-P41 HydrophobicContact CB-CB 4.4Å; Q31-P41 HydrophobicContact CB-CG 4.05Å; Q31-P41 HydrophobicContact CG-CB 4.27Å; Q31-P41 HydrophobicContact CG-CG 4.37Å; L34-P41 HydrophobicContact CB-CB 4.24Å; L34-P41 HydrophobicContact CB-CG 4.32Å; L34-P41 HydrophobicContact CD1-CB 4.02Å; S35-P41 WeakPolarHBondContact OG-CD 3.3Å; S35-P41 WeakPolarHBondContact OG-CG 3.43Å; H39-P41 VanDerWaalsContact O-CD 3.29Å; H39-P41 WeakPolarHBondContact O-CD 3.37Å
42	Y	94.7	Very high	91.1	Very high	96 Å²	96	62 Å²	62	38%	0.376	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	122.3	174.3	-63.8	-78.7	0	0	0	111	E6 V7 I9 T40 H44	E6-Y42 HydrophobicContact CB-CD2 4.48Å; E6-Y42 HydrophobicContact CB-CE2 4.14Å; E6-Y42 HydrophobicContact CG-CE2 4.09Å; V7-Y42 PolarHBondContact O-N 3.18Å; I9-Y42 PolarHBondContact N-O 3.43Å; T40-Y42 HydrophobicContact CG2-CD2 4.49Å; T40-Y42 HydrophobicContact CG2-CE1 4.31Å; T40-Y42 HydrophobicContact CG2-CE2 3.68Å; T40-Y42 WeakPolarHBondContact CG2-OH 3.49Å; Y42-H44 WeakPolarHBondContact CB-NE2 3.41Å; Y42-H44 PolarHBondContact O-CD2 3.4Å
43	L	93.9	Very high	91.1	Very high	36 Å²	36	57.6 Å²	57.6	19%	0.188	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	127.6	175.8	-89.8	166.9	0	0	0	111.4	I9 K24 L27 Q31	I9-L43 HydrophobicContact CB-CD2 3.98Å; I9-L43 HydrophobicContact CB-CG 4.49Å; I9-L43 HydrophobicContact CG2-CD2 3.76Å; K24-L43 HydrophobicContact CB-CD1 4.16Å; K24-L43 HydrophobicContact CD-CD1 4.02Å; K24-L43 HydrophobicContact CG-CD1 4.08Å; L27-L43 HydrophobicContact CB-CD2 4.09Å; L27-L43 HydrophobicContact CD1-CD2 3.48Å; L27-L43 VanDerWaalsContact CD1-CD2 3.48Å; L27-L43 HydrophobicContact CG-CD2 4.41Å; Q31-L43 HydrophobicContact CG-CD1 4.25Å; Q31-L43 HydrophobicContact CG-CG 4.49Å
44	H	94.1	Very high	91.2	Very high	72 Å²	72	57.8 Å²	57.8	33%	0.333	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.3	119.5	176	-58.4	-79.3	0	0	0	109.9	H8 I9 C10 H11 Y42 T46	H8-H44 AromaticContact CG-NE2 3.77Å; H8-H44 AromaticContact ND1-CD2 3.84Å; H8-H44 AromaticContact ND1-CE1 3.84Å; H8-H44 AromaticContact ND1-NE2 3.03Å; H8-H44 PolarHBondContact ND1-NE2 3.48Å; I9-H44 PolarHBondContact O-N 3.05Å; C10-H44 WeakPolarHBondContact CA-O 3.34Å; H11-H44 PolarHBondContact N-O 3.13Å; Y42-H44 WeakPolarHBondContact CB-NE2 3.41Å; Y42-H44 PolarHBondContact O-CD2 3.4Å; H44-T46 PolarHBondContact O-N 2.97Å
45	D	91.9	Very high	91.3	Very high	83 Å²	83	57.8 Å²	57.8	44%	0.444	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.2	109.5	172.7	-66.4	-58.1	0	0	0	108.2	H11 N22 K24	H11-D45 IonicContact CE1-OD1 3.9Å; H11-D45 PolarHBondContact CE1-OD1 3.34Å; H11-D45 VanDerWaalsContact CE1-OD1 3.23Å; H11-D45 IonicContact NE2-OD1 2.73Å; H11-D45 PolarHBondContact NE2-OD1 3.26Å; N22-D45 HydrophobicContact CB-CB 4.27Å; N22-D45 VanDerWaalsContact CB-OD1 3.3Å; N22-D45 WeakPolarHBondContact CB-OD1 3.5Å; K24-D45 WeakPolarHBondContact CE-OD1 3.46Å; K24-D45 WeakPolarHBondContact CE-OD2 3.37Å; K24-D45 IonicContact NZ-OD1 3.8Å; K24-D45 IonicContact NZ-OD2 2.81Å; K24-D45 PolarHBondContact NZ-OD2 3.48Å
46	T	88.6	Confident	91.4	Very high	36 Å²	36	58 Å²	58	22%	0.221	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.4	120.5	179.6	-40.8	0	0	0	0	109.8	H11 N22 H44 D48 L49	H11-T46 PolarHBondContact O-N 3.09Å; N22-T46 PolarHBondContact ND2-O 3.36Å; H44-T46 PolarHBondContact O-N 2.97Å; T46-D48 VanDerWaalsContact C-N 3.27Å; T46-D48 PolarHBondContact O-N 3.46Å; T46-L49 HydrophobicContact CG2-CB 4.42Å; T46-L49 HydrophobicContact CG2-CD1 3.97Å; T46-L49 HydrophobicContact CG2-CG 3.85Å
47	S	78.8	Confident	91.4	Very high	74 Å²	74	52.9 Å²	52.9	52%	0.517	28%	0.275	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.6	-26.4	-179.3	48.9	0	0	0	0	113.6
48	D	85.6	Confident	91.2	Very high	146 Å²	146	52.8 Å²	52.8	78%	0.781	28%	0.278	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.9	-12.1	-168.8	-51.5	-17	0	0	0	111.9	T46	T46-D48 VanDerWaalsContact C-N 3.27Å; T46-D48 PolarHBondContact O-N 3.46Å
49	L	85	Confident	91	Very high	35 Å²	35	60.3 Å²	60.3	18%	0.183	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	134.9	174.7	-64.3	177.4	0	0	0	110.2	C10 G12 K13 T46 V52 E54	C10-L49 HydrophobicContact CB-CD1 4.5Å; G12-L49 CarbonylContact C-O 3.58Å; G12-L49 WeakPolarHBondContact CA-O 3.48Å; K13-L49 PolarHBondContact N-O 2.77Å; T46-L49 HydrophobicContact CG2-CB 4.42Å; T46-L49 HydrophobicContact CG2-CD1 3.97Å; T46-L49 HydrophobicContact CG2-CG 3.85Å; L49-V52 HydrophobicContact CD2-CB 4.48Å; L49-V52 HydrophobicContact CD2-CG1 4.44Å; L49-E54 HydrophobicContact CD1-CG 4.45Å
50	Y	91	Very high	91	Very high	120 Å²	120	64.7 Å²	64.7	47%	0.471	33%	0.325	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	123.3	172.4	-176.7	-96.8	0	0	0	109.6	K13 C20 V52	K13-Y50 CarbonylContact O-C 3.54Å; K13-Y50 WeakPolarHBondContact O-CD2 3.45Å; C20-Y50 VanDerWaalsContact SG-CE2 3.59Å; Y50-V52 WeakPolarHBondContact O-CG2 3.25Å; Y50-V52 PolarHBondContact O-N 3.09Å
51	E	90.8	Very high	90.9	Very high	51 Å²	51	65.3 Å²	65.3	24%	0.238	33%	0.329	C	S	.	.	S	Bend	trans	57.9	-3.2	-176.9	-74.1	176.2	-170.7	0	0	116.2	K13 K66 V67	K13-E51 PolarHBondContact O-N 2.95Å; E51-K66 CarbonylContact O-C 3.53Å; E51-K66 WeakPolarHBondContact O-CA 3.39Å; E51-K66 WeakPolarHBondContact O-CB 3.35Å; E51-V67 PolarHBondContact O-N 3.37Å
52	V	93.5	Very high	90.9	Very high	37 Å²	37	65.8 Å²	65.8	22%	0.224	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.1	143	-176.7	173.9	0	0	0	0	111.6	G12 L49 Y50 E54 Q64 C65	G12-V52 PolarHBondContact N-O 2.94Å; L49-V52 HydrophobicContact CD2-CB 4.48Å; L49-V52 HydrophobicContact CD2-CG1 4.44Å; Y50-V52 WeakPolarHBondContact O-CG2 3.25Å; Y50-V52 PolarHBondContact O-N 3.09Å; V52-E54 HydrophobicContact CG1-CG 4.14Å; V52-Q64 HydrophobicContact CG1-CG 3.61Å; V52-C65 CarbonylContact C-O 3.53Å
53	T	94.7	Very high	90.9	Very high	0 Å²	0	62.6 Å²	62.6	0%	0	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	125.4	165.4	-57.9	0	0	0	0	108.8	I9 C10 H11 L27 I55 Q64 C65 V67 F70	I9-T53 HydrophobicContact CG2-CG2 3.79Å; C10-T53 CarbonylContact O-C 3.59Å; C10-T53 WeakPolarHBondContact O-CA 3.37Å; H11-T53 HydrophobicContact CB-CG2 4.23Å; L27-T53 HydrophobicContact CD2-CG2 4.09Å; T53-I55 HydrophobicContact CG2-CD1 4.02Å; T53-Q64 WeakPolarHBondContact O-CA 3.27Å; T53-C65 PolarHBondContact N-O 3.32Å; T53-C65 PolarHBondContact O-N 3.28Å; T53-V67 WeakPolarHBondContact OG1-CG2 3.5Å; T53-F70 HydrophobicContact CG2-CE2 4.07Å; T53-F70 HydrophobicContact CG2-CZ 4.41Å
54	E	95	Very high	91	Very high	32 Å²	32	66.2 Å²	66.2	15%	0.15	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	132.1	171.7	-68.3	-178.9	169.8	0	0	109.4	C10 L49 V52 K56 Q64	C10-E54 HydrophobicContact CB-CB 4.32Å; C10-E54 PolarHBondContact N-O 3.26Å; C10-E54 PolarHBondContact O-N 2.96Å; L49-E54 HydrophobicContact CD1-CG 4.45Å; V52-E54 HydrophobicContact CG1-CG 4.14Å; E54-K56 WeakPolarHBondContact OE2-CE 3.49Å; E54-K56 IonicContact OE2-NZ 3.39Å; E54-K56 PolarHBondContact OE2-NZ 2.9Å; E54-Q64 HydrophobicContact CG-CG 3.96Å; E54-Q64 PolarHBondContact OE1-NE2 3.05Å
55	I	94.9	Very high	91	Very high	0 Å²	0	63.6 Å²	63.6	0%	0	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.7	121.1	171.8	-51.1	-60.1	0	0	0	106.9	V7 I9 L30 T53 V61 V62 H63 I85 V89	V7-I55 HydrophobicContact CG1-CG2 3.58Å; I9-I55 HydrophobicContact CB-CD1 4.19Å; I9-I55 HydrophobicContact CG1-CD1 3.91Å; I9-I55 HydrophobicContact CG2-CD1 3.83Å; L30-I55 HydrophobicContact CD2-CD1 3.62Å; T53-I55 HydrophobicContact CG2-CD1 4.02Å; I55-V61 WeakPolarHBondContact O-CA 3.45Å; I55-V62 HydrophobicContact CB-CG2 3.95Å; I55-V62 HydrophobicContact CG2-CG2 3.68Å; I55-V62 WeakPolarHBondContact O-CG2 3.42Å; I55-V62 PolarHBondContact O-N 3.14Å; I55-H63 HydrophobicContact CB-CB 4.25Å; I55-H63 HydrophobicContact CG1-CB 4.29Å; I55-H63 PolarHBondContact N-O 2.8Å; I55-H63 PolarHBondContact O-N 2.96Å; I55-I85 HydrophobicContact CB-CG2 4.45Å; I55-I85 HydrophobicContact CD1-CG2 4.42Å; I55-I85 HydrophobicContact CG1-CD1 4.27Å; I55-I85 HydrophobicContact CG1-CG1 4.49Å; I55-I85 HydrophobicContact CG1-CG2 3.89Å; I55-I85 HydrophobicContact CG2-CG2 4.08Å; I55-V89 HydrophobicContact CG2-CG2 4.02Å
56	K	93.4	Very high	91	Very high	62 Å²	62	64.6 Å²	64.6	27%	0.27	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.1	137.8	178.7	-61.5	177.2	-177.5	179.6	0	111	H8 E54 E60 V61	H8-K56 HydrophobicContact CB-CB 4.16Å; H8-K56 PolarHBondContact N-O 2.83Å; H8-K56 PolarHBondContact O-N 3.08Å; E54-K56 WeakPolarHBondContact OE2-CE 3.49Å; E54-K56 IonicContact OE2-NZ 3.39Å; E54-K56 PolarHBondContact OE2-NZ 2.9Å; K56-E60 CarbonylContact C-O 3.37Å; K56-E60 WeakPolarHBondContact CA-O 3.34Å; K56-V61 HydrophobicContact CD-CG2 4.21Å; K56-V61 HydrophobicContact CG-CG2 3.84Å
57	V	91.9	Very high	91.2	Very high	2 Å²	2	62.9 Å²	62.9	1%	0.012	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.1	128	173.6	-176.9	0	0	0	0	106.3	A5 V7 E59 E60 V62 V89	A5-V57 HydrophobicContact CB-CG1 4.07Å; V7-V57 HydrophobicContact CG1-CG2 4.41Å; V7-V57 HydrophobicContact CG2-CG2 4.21Å; V57-E59 VanDerWaalsContact C-N 3.28Å; V57-E59 PolarHBondContact O-N 2.92Å; V57-E60 PolarHBondContact N-O 3.44Å; V57-E60 PolarHBondContact O-N 3.4Å; V57-V62 HydrophobicContact CB-CG1 4.02Å; V57-V62 HydrophobicContact CG2-CG1 4.03Å; V57-V62 HydrophobicContact CG2-CG2 3.97Å; V57-V89 HydrophobicContact CG2-CB 4.49Å; V57-V89 HydrophobicContact CG2-CG1 4.11Å; V57-V89 HydrophobicContact CG2-CG2 4Å
58	N	87.5	Confident	91.7	Very high	104 Å²	104	61.8 Å²	61.8	56%	0.556	31%	0.306	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.6	46.9	-175.4	-59.8	-27.3	0	0	0	113.2	E60	N58-E60 PolarHBondContact O-N 3.16Å
59	E	86.4	Confident	92.1	Very high	190 Å²	190	58.6 Å²	58.6	89%	0.888	29%	0.289	S	S	*	.	T	Hydrogen-bonded Turn	trans	65.7	-3.4	-178.3	-51	-173.2	145.1	0	0	116.3	V57	V57-E59 VanDerWaalsContact C-N 3.28Å; V57-E59 PolarHBondContact O-N 2.92Å
60	E	91.4	Very high	92.4	Very high	98 Å²	98	56.9 Å²	56.9	46%	0.458	28%	0.28	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	139.4	176	-66.8	-164.1	160.7	0	0	112.3	K56 V57 N58 V62 Y93	K56-E60 CarbonylContact C-O 3.37Å; K56-E60 WeakPolarHBondContact CA-O 3.34Å; V57-E60 PolarHBondContact N-O 3.44Å; V57-E60 PolarHBondContact O-N 3.4Å; N58-E60 PolarHBondContact O-N 3.16Å; E60-V62 PolarHBondContact O-N 2.87Å; E60-Y93 PolarHBondContact OE1-OH 3.4Å; E60-Y93 WeakPolarHBondContact OE2-CE2 3.07Å; E60-Y93 PolarHBondContact OE2-OH 3.44Å
61	V	92.7	Very high	92.4	Very high	76 Å²	76	56.9 Å²	56.9	46%	0.461	28%	0.284	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.3	108.6	174.9	179.5	0	0	0	0	109.5	I55 K56	I55-V61 WeakPolarHBondContact O-CA 3.45Å; K56-V61 HydrophobicContact CD-CG2 4.21Å; K56-V61 HydrophobicContact CG-CG2 3.84Å
62	V	93.7	Very high	92.1	Very high	32 Å²	32	60 Å²	60	19%	0.194	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.6	-27.4	178.6	-61	0	0	0	0	112.3	I55 V57 E60 V89 A92	I55-V62 HydrophobicContact CB-CG2 3.95Å; I55-V62 HydrophobicContact CG2-CG2 3.68Å; I55-V62 WeakPolarHBondContact O-CG2 3.42Å; I55-V62 PolarHBondContact O-N 3.14Å; V57-V62 HydrophobicContact CB-CG1 4.02Å; V57-V62 HydrophobicContact CG2-CG1 4.03Å; V57-V62 HydrophobicContact CG2-CG2 3.97Å; E60-V62 PolarHBondContact O-N 2.87Å; V62-V89 HydrophobicContact CG2-CG2 4.09Å; V62-A92 HydrophobicContact CB-CB 4.38Å; V62-A92 HydrophobicContact CG1-CB 3.49Å; V62-A92 VanDerWaalsContact CG1-CB 3.49Å
63	H	94.8	Very high	91.6	Very high	29 Å²	29	59.6 Å²	59.6	13%	0.134	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.5	149.4	177.3	-163.3	49.9	0	0	0	112.2	I55 I85 K88	I55-H63 HydrophobicContact CB-CB 4.25Å; I55-H63 HydrophobicContact CG1-CB 4.29Å; I55-H63 PolarHBondContact N-O 2.8Å; I55-H63 PolarHBondContact O-N 2.96Å; H63-I85 HydrophobicContact CB-CG1 4.45Å; H63-I85 WeakPolarHBondContact CD2-CG1 3.49Å; H63-K88 HydrophobicContact CB-CD 4.18Å; H63-K88 PolarHBondContact ND1-NZ 3.03Å
64	Q	94.5	Very high	91.2	Very high	111 Å²	111	62.3 Å²	62.3	52%	0.519	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	132.7	173.7	-169.8	-178.1	49.7	0	0	108.4	V52 T53 E54	V52-Q64 HydrophobicContact CG1-CG 3.61Å; T53-Q64 WeakPolarHBondContact O-CA 3.27Å; E54-Q64 HydrophobicContact CG-CG 3.96Å; E54-Q64 PolarHBondContact OE1-NE2 3.05Å
65	C	94.5	Very high	90.8	Very high	17 Å²	17	64 Å²	64	12%	0.115	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-152	177.3	-179.2	57.6	0	0	0	0	109.8	V52 T53 F70 L81	V52-C65 CarbonylContact C-O 3.53Å; T53-C65 PolarHBondContact N-O 3.32Å; T53-C65 PolarHBondContact O-N 3.28Å; C65-F70 WeakPolarHBondContact SG-CE2 3.48Å; C65-L81 HydrophobicContact CB-CD1 4.39Å; C65-L81 HydrophobicContact CB-CD2 4.21Å
66	K	93.1	Very high	90.5	Very high	104 Å²	104	64.3 Å²	64.3	45%	0.452	34%	0.341	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.7	144.4	172.6	-58.3	179.4	178.3	-176.4	0	111.3	E51 T68 D69	E51-K66 CarbonylContact O-C 3.53Å; E51-K66 WeakPolarHBondContact O-CA 3.39Å; E51-K66 WeakPolarHBondContact O-CB 3.35Å; K66-T68 PolarHBondContact O-N 2.76Å; K66-T68 VanDerWaalsContact O-N 3.12Å; K66-D69 WeakPolarHBondContact CB-OD2 3.46Å; K66-D69 PolarHBondContact N-OD2 2.72Å; K66-D69 WeakPolarHBondContact O-CB 3.19Å; K66-D69 PolarHBondContact O-N 3.08Å
67	V	91.2	Very high	90.1	Very high	0 Å²	0	67.2 Å²	67.2	0%	0	36%	0.356	C	S	.	.	T	Hydrogen-bonded Turn	trans	-54.5	-33.9	172.8	178.1	0	0	0	0	111	H11 Y14 R26 E51 T53 D69	H11-V67 HydrophobicContact CB-CG2 4.12Å; Y14-V67 HydrophobicContact CD1-CB 4.11Å; Y14-V67 HydrophobicContact CD1-CG1 3.51Å; Y14-V67 HydrophobicContact CE1-CB 4.47Å; Y14-V67 HydrophobicContact CE1-CG1 3.41Å; Y14-V67 VanDerWaalsContact CE1-CG1 3.41Å; Y14-V67 HydrophobicContact CG-CB 4.47Å; Y14-V67 HydrophobicContact CG-CG1 4.18Å; R26-V67 WeakPolarHBondContact CD-O 3.42Å; E51-V67 PolarHBondContact O-N 3.37Å; T53-V67 WeakPolarHBondContact OG1-CG2 3.5Å; V67-D69 VanDerWaalsContact C-N 3.31Å
68	T	90.7	Very high	89.9	Confident	51 Å²	51	75 Å²	75	31%	0.313	40%	0.397	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.6	-14.8	-179	51.6	0	0	0	0	114.2	Y14 R26 K66 F70	Y14-T68 HydrophobicContact CD2-CG2 3.92Å; Y14-T68 HydrophobicContact CE2-CG2 4.49Å; R26-T68 PolarHBondContact NH1-O 2.78Å; R26-T68 VanDerWaalsContact NH1-O 3.14Å; K66-T68 PolarHBondContact O-N 2.76Å; K66-T68 VanDerWaalsContact O-N 3.12Å; T68-F70 VanDerWaalsContact C-N 3.32Å
69	D	93.2	Very high	90.1	Very high	79 Å²	79	70.4 Å²	70.4	42%	0.422	37%	0.372	S	S	.	.	T	Hydrogen-bonded Turn	trans	-75.1	-27.2	179.4	-60.2	-19.3	0	0	0	111.1	K66 V67 L81	K66-D69 WeakPolarHBondContact CB-OD2 3.46Å; K66-D69 PolarHBondContact N-OD2 2.72Å; K66-D69 WeakPolarHBondContact O-CB 3.19Å; K66-D69 PolarHBondContact O-N 3.08Å; V67-D69 VanDerWaalsContact C-N 3.31Å; D69-L81 HydrophobicContact CB-CD2 3.82Å
70	F	92.6	Very high	90.4	Very high	0 Å²	0	65.7 Å²	65.7	0%	0	36%	0.358	C	S	.	.	S	Bend	trans	-66.3	141	172.5	-69.2	-81	0	0	0	112.2	R26 L27 L30 T53 C65 T68 D79 L81 I85	R26-F70 HydrophobicContact CB-CB 3.86Å; R26-F70 PolarHBondContact NH1-O 3.14Å; R26-F70 WeakPolarHBondContact O-CB 3.5Å; L27-F70 HydrophobicContact CD2-CD2 3.63Å; L27-F70 HydrophobicContact CD2-CE1 4.44Å; L27-F70 HydrophobicContact CD2-CE2 3.53Å; L27-F70 HydrophobicContact CD2-CG 4.13Å; L27-F70 HydrophobicContact CD2-CZ 3.97Å; L30-F70 HydrophobicContact CB-CE1 4.04Å; L30-F70 HydrophobicContact CD2-CE1 3.76Å; L30-F70 HydrophobicContact CD2-CZ 3.83Å; L30-F70 HydrophobicContact CG-CE1 4.33Å; T53-F70 HydrophobicContact CG2-CE2 4.07Å; T53-F70 HydrophobicContact CG2-CZ 4.41Å; C65-F70 WeakPolarHBondContact SG-CE2 3.48Å; T68-F70 VanDerWaalsContact C-N 3.32Å; F70-D79 WeakPolarHBondContact CA-OD2 3.49Å; F70-L81 HydrophobicContact CD1-CD2 3.8Å; F70-L81 HydrophobicContact CD1-CG 4.49Å; F70-L81 HydrophobicContact CD2-CD2 4.01Å; F70-L81 HydrophobicContact CE1-CD2 3.74Å; F70-L81 HydrophobicContact CE1-CG 4.2Å; F70-L81 HydrophobicContact CE2-CD2 3.97Å; F70-L81 HydrophobicContact CG-CD2 3.93Å; F70-L81 HydrophobicContact CZ-CD2 3.83Å; F70-L81 HydrophobicContact CZ-CG 4.49Å; F70-I85 HydrophobicContact CE1-CD1 3.59Å; F70-I85 HydrophobicContact CZ-CD1 3.49Å; F70-I85 VanDerWaalsContact CZ-CD1 3.49Å
71	Q	90	Very high	90.5	Very high	120 Å²	120	62.3 Å²	62.3	56%	0.561	34%	0.343	S	S	*	.	P	Polyproline II helix	trans	-68.9	154.2	170	-64.6	-59.6	-35.7	0	0	111.3	G73 D79	Q71-G73 PolarHBondContact O-N 2.98Å; Q71-D79 HydrophobicContact CB-CB 4.22Å; Q71-D79 HydrophobicContact CG-CB 4.2Å; Q71-D79 PolarHBondContact N-OD2 2.97Å
72	F	84.4	Confident	90.5	Very high	115 Å²	115	58.7 Å²	58.7	50%	0.504	32%	0.321	S	S	.	.	S	Bend	trans	-80.1	117.5	-176.3	-122.3	-81	0	0	0	111.1	F25 R26	F25-F72 HydrophobicContact CB-CD1 3.92Å; F25-F72 HydrophobicContact CB-CE1 3.4Å; F25-F72 VanDerWaalsContact CB-CE1 3.4Å; F25-F72 HydrophobicContact CB-CZ 4.23Å; F25-F72 HydrophobicContact CG-CE1 4.11Å; R26-F72 HydrophobicContact CG-CD1 4.42Å; R26-F72 HydrophobicContact CG-CD2 3.63Å; R26-F72 HydrophobicContact CG-CE2 3.77Å; R26-F72 HydrophobicContact CG-CG 3.98Å; R26-F72 HydrophobicContact CG-CZ 4.23Å; R26-F72 VanDerWaalsContact CZ-CD2 3.43Å; R26-F72 VanDerWaalsContact NE-CE2 3.28Å
73	G	82.1	Confident	90.4	Very high	29 Å²	29	63.8 Å²	63.8	30%	0.299	34%	0.34	S	S	.	.	S	Bend	trans	63	-166.5	171.1	0	0	0	0	0	115.1	F25 Q71	F25-G73 PolarHBondContact O-N 3.12Å; F25-G73 VanDerWaalsContact O-N 3.16Å; Q71-G73 PolarHBondContact O-N 2.98Å
74	G	86.5	Confident	90.4	Very high	57 Å²	57	66.3 Å²	66.3	59%	0.588	35%	0.354	S	S	*	.	S	Bend	trans	81.2	-165.1	-179.1	0	0	0	0	0	113.5	G29	G29-G74 WeakPolarHBondContact CA-O 3.35Å
75	D	87.7	Confident	90.3	Very high	68 Å²	68	61 Å²	61	36%	0.364	33%	0.329	S	S	.	.			trans	-90.7	0.2	-178.1	61.8	1.4	0	0	0	113.6	Q33 K36 E77	Q33-D75 WeakPolarHBondContact CG-O 3.33Å; Q33-D75 PolarHBondContact NE2-O 3.47Å; K36-D75 IonicContact NZ-OD2 3.23Å; D75-E77 PolarHBondContact O-N 3.43Å; D75-E77 PolarHBondContact OD1-N 2.84Å; D75-E77 VanDerWaalsContact OD1-N 3.08Å
76	G	87.7	Confident	90.3	Very high	6 Å²	6	60.5 Å²	60.5	6%	0.062	33%	0.326	C	S	.	.	S	Bend	trans	72.8	1.6	-179.7	0	0	0	0	0	115.6	L78 D79	G76-L78 VanDerWaalsContact C-N 3.3Å; G76-L78 PolarHBondContact O-N 3.28Å; G76-D79 PolarHBondContact O-N 2.84Å; G76-D79 VanDerWaalsContact O-N 3.15Å
77	E	86.3	Confident	90.2	Very high	124 Å²	124	59.6 Å²	59.6	58%	0.579	33%	0.326	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	-34.5	-174.2	-75	-172.5	-178.8	0	0	112.9	K36 D75	K36-E77 IonicContact NZ-OE1 3.04Å; K36-E77 PolarHBondContact NZ-OE1 2.9Å; D75-E77 PolarHBondContact O-N 3.43Å; D75-E77 PolarHBondContact OD1-N 2.84Å; D75-E77 VanDerWaalsContact OD1-N 3.08Å
78	L	87.7	Confident	90.3	Very high	164 Å²	164	63.8 Å²	63.8	86%	0.859	34%	0.344	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.1	1.1	179.4	-59.1	-179.6	0	0	0	113.2	G76 P80	G76-L78 VanDerWaalsContact C-N 3.3Å; G76-L78 PolarHBondContact O-N 3.28Å; L78-P80 WeakPolarHBondContact O-CD 3.46Å
79	D	91	Very high	90.3	Very high	9 Å²	9	61.3 Å²	61.3	5%	0.048	33%	0.329	C	S	.	.			trans	-92.1	108.8	176.4	-170.5	-17.4	0	0	0	110.1	F70 Q71 G76 L81 C82 K83	F70-D79 WeakPolarHBondContact CA-OD2 3.49Å; Q71-D79 HydrophobicContact CB-CB 4.22Å; Q71-D79 HydrophobicContact CG-CB 4.2Å; Q71-D79 PolarHBondContact N-OD2 2.97Å; G76-D79 PolarHBondContact O-N 2.84Å; G76-D79 VanDerWaalsContact O-N 3.15Å; D79-L81 PolarHBondContact O-N 2.78Å; D79-L81 VanDerWaalsContact O-N 3.17Å; D79-L81 VanDerWaalsContact OD1-CB 3.25Å; D79-L81 WeakPolarHBondContact OD1-CB 3.06Å; D79-L81 PolarHBondContact OD1-N 3.37Å; D79-C82 HydrophobicContact CB-CB 4.13Å; D79-C82 WeakPolarHBondContact O-CB 3.33Å; D79-C82 PolarHBondContact O-N 2.82Å; D79-C82 VanDerWaalsContact O-N 3.12Å; D79-K83 PolarHBondContact O-N 3.03Å
80	P	91.8	Very high	90.2	Very high	90 Å²	90	59.2 Å²	59.2	58%	0.584	32%	0.318	S	S	*	.	H	α-helix	trans	-59.7	-30.1	180	-19.7	32.1	0	0	0	112.6	L78 C82 K83 I84	L78-P80 WeakPolarHBondContact O-CD 3.46Å; P80-C82 VanDerWaalsContact C-N 3.34Å; P80-K83 PolarHBondContact O-N 2.95Å; P80-I84 VanDerWaalsContact O-CG1 3.3Å; P80-I84 WeakPolarHBondContact O-CG1 3.11Å; P80-I84 PolarHBondContact O-N 2.81Å
81	L	93.5	Very high	89.9	Confident	27 Å²	27	64.7 Å²	64.7	14%	0.141	35%	0.351	C	S	.	.	H	α-helix	trans	-67.8	-38.7	-179.3	-165.3	69.7	0	0	0	110.9	C65 D69 F70 D79 K83 I84 I85	C65-L81 HydrophobicContact CB-CD1 4.39Å; C65-L81 HydrophobicContact CB-CD2 4.21Å; D69-L81 HydrophobicContact CB-CD2 3.82Å; F70-L81 HydrophobicContact CD1-CD2 3.8Å; F70-L81 HydrophobicContact CD1-CG 4.49Å; F70-L81 HydrophobicContact CD2-CD2 4.01Å; F70-L81 HydrophobicContact CE1-CD2 3.74Å; F70-L81 HydrophobicContact CE1-CG 4.2Å; F70-L81 HydrophobicContact CE2-CD2 3.97Å; F70-L81 HydrophobicContact CG-CD2 3.93Å; F70-L81 HydrophobicContact CZ-CD2 3.83Å; F70-L81 HydrophobicContact CZ-CG 4.49Å; D79-L81 PolarHBondContact O-N 2.78Å; D79-L81 VanDerWaalsContact O-N 3.17Å; D79-L81 VanDerWaalsContact OD1-CB 3.25Å; D79-L81 WeakPolarHBondContact OD1-CB 3.06Å; D79-L81 PolarHBondContact OD1-N 3.37Å; L81-K83 VanDerWaalsContact C-N 3.34Å; L81-K83 PolarHBondContact O-N 3.04Å; L81-I84 PolarHBondContact O-N 3.02Å; L81-I85 HydrophobicContact CG-CD1 4.07Å; L81-I85 VanDerWaalsContact O-CG1 3.27Å; L81-I85 WeakPolarHBondContact O-CG1 3.44Å; L81-I85 PolarHBondContact O-N 2.77Å
82	C	93.6	Very high	89.5	Confident	0 Å²	0	59.7 Å²	59.7	0%	0	33%	0.33	C	S	.	.	H	α-helix	trans	-59.7	-46.6	175.6	-69.4	0	0	0	0	110.8	L30 Q33 D79 P80 I84 I85 V86	L30-C82 HydrophobicContact CD1-CB 4.34Å; Q33-C82 HydrophobicContact CG-CB 4.07Å; D79-C82 HydrophobicContact CB-CB 4.13Å; D79-C82 WeakPolarHBondContact O-CB 3.33Å; D79-C82 PolarHBondContact O-N 2.82Å; D79-C82 VanDerWaalsContact O-N 3.12Å; P80-C82 VanDerWaalsContact C-N 3.34Å; C82-I84 PolarHBondContact O-N 2.76Å; C82-I85 PolarHBondContact O-N 2.97Å; C82-V86 VanDerWaalsContact O-CG2 3.3Å; C82-V86 WeakPolarHBondContact O-CG2 3.14Å; C82-V86 PolarHBondContact O-N 3.31Å
83	K	92.2	Very high	88.5	Confident	139 Å²	139	63 Å²	63	60%	0.604	34%	0.341	S	S	*	.	H	α-helix	trans	-61.6	-45	177.5	-172.8	170.8	-177.3	173	0	112.7	D79 P80 L81 I85 V86 D87	D79-K83 PolarHBondContact O-N 3.03Å; P80-K83 PolarHBondContact O-N 2.95Å; L81-K83 VanDerWaalsContact C-N 3.34Å; L81-K83 PolarHBondContact O-N 3.04Å; K83-I85 VanDerWaalsContact C-N 3.3Å; K83-I85 PolarHBondContact O-N 3.23Å; K83-V86 PolarHBondContact O-N 3.03Å; K83-D87 PolarHBondContact O-N 2.86Å
84	I	93.8	Very high	88.8	Confident	82 Å²	82	64.8 Å²	64.8	42%	0.421	34%	0.343	S	S	.	.	H	α-helix	trans	-60.1	-41.9	177.1	-68.8	164.2	0	0	0	111.1	P80 L81 C82 K88	P80-I84 VanDerWaalsContact O-CG1 3.3Å; P80-I84 WeakPolarHBondContact O-CG1 3.11Å; P80-I84 PolarHBondContact O-N 2.81Å; L81-I84 PolarHBondContact O-N 3.02Å; C82-I84 PolarHBondContact O-N 2.76Å; I84-K88 HydrophobicContact CG2-CD 4.42Å; I84-K88 WeakPolarHBondContact O-CB 3.14Å; I84-K88 WeakPolarHBondContact O-CG 3.35Å; I84-K88 PolarHBondContact O-N 3.27Å
85	I	93.8	Very high	89	Confident	0 Å²	0	65.2 Å²	65.2	0%	0	33%	0.33	C	S	.	.	H	α-helix	trans	-66.4	-46.6	179.2	-70.6	165.6	0	0	0	110.7	L30 I55 H63 F70 L81 C82 K83 D87 K88 V89	L30-I85 HydrophobicContact CD1-CB 3.92Å; L30-I85 HydrophobicContact CD1-CD1 4.1Å; L30-I85 HydrophobicContact CD1-CG2 3.7Å; L30-I85 HydrophobicContact CD2-CD1 4Å; L30-I85 HydrophobicContact CD2-CG2 4.35Å; I55-I85 HydrophobicContact CB-CG2 4.45Å; I55-I85 HydrophobicContact CD1-CG2 4.42Å; I55-I85 HydrophobicContact CG1-CD1 4.27Å; I55-I85 HydrophobicContact CG1-CG1 4.49Å; I55-I85 HydrophobicContact CG1-CG2 3.89Å; I55-I85 HydrophobicContact CG2-CG2 4.08Å; H63-I85 HydrophobicContact CB-CG1 4.45Å; H63-I85 WeakPolarHBondContact CD2-CG1 3.49Å; F70-I85 HydrophobicContact CE1-CD1 3.59Å; F70-I85 HydrophobicContact CZ-CD1 3.49Å; F70-I85 VanDerWaalsContact CZ-CD1 3.49Å; L81-I85 HydrophobicContact CG-CD1 4.07Å; L81-I85 VanDerWaalsContact O-CG1 3.27Å; L81-I85 WeakPolarHBondContact O-CG1 3.44Å; L81-I85 PolarHBondContact O-N 2.77Å; C82-I85 PolarHBondContact O-N 2.97Å; K83-I85 VanDerWaalsContact C-N 3.3Å; K83-I85 PolarHBondContact O-N 3.23Å; I85-D87 VanDerWaalsContact C-N 3.35Å; I85-D87 PolarHBondContact O-N 2.82Å; I85-K88 WeakPolarHBondContact O-CB 3.18Å; I85-K88 PolarHBondContact O-N 2.77Å; I85-V89 HydrophobicContact CG2-CG2 4.23Å; I85-V89 WeakPolarHBondContact O-CG2 3.45Å; I85-V89 PolarHBondContact O-N 2.79Å
86	V	92.6	Very high	89	Confident	7 Å²	7	65 Å²	65	4%	0.042	33%	0.329	C	S	.	.	H	α-helix	trans	-57.2	-48.2	176.7	165.8	0	0	0	0	110.9	Q33 L34 E37 C82 K83 K88 V89 N90	Q33-V86 HydrophobicContact CB-CG2 3.95Å; L34-V86 HydrophobicContact CD2-CG2 3.99Å; L34-V86 HydrophobicContact CG-CG2 4.4Å; E37-V86 HydrophobicContact CG-CG1 3.68Å; C82-V86 VanDerWaalsContact O-CG2 3.3Å; C82-V86 WeakPolarHBondContact O-CG2 3.14Å; C82-V86 PolarHBondContact O-N 3.31Å; K83-V86 PolarHBondContact O-N 3.03Å; V86-K88 VanDerWaalsContact C-N 3.29Å; V86-K88 PolarHBondContact O-N 3.47Å; V86-V89 PolarHBondContact O-N 2.87Å; V86-N90 WeakPolarHBondContact O-CB 3.34Å; V86-N90 PolarHBondContact O-N 3.39Å; V86-N90 PolarHBondContact O-ND2 2.93Å
87	D	92.5	Very high	89.1	Confident	84 Å²	84	68.5 Å²	68.5	45%	0.449	34%	0.344	S	S	.	.	H	α-helix	trans	-59.8	-40	177.7	-76.8	-16.8	0	0	0	111.6	K83 I85 N90 T91	K83-D87 PolarHBondContact O-N 2.86Å; I85-D87 VanDerWaalsContact C-N 3.35Å; I85-D87 PolarHBondContact O-N 2.82Å; D87-N90 PolarHBondContact O-N 3.29Å; D87-T91 WeakPolarHBondContact O-CB 3.36Å; D87-T91 PolarHBondContact O-N 3.11Å; D87-T91 PolarHBondContact O-OG1 3.24Å
88	K	92.6	Very high	89.3	Confident	88 Å²	88	65 Å²	65	38%	0.383	33%	0.33	S	S	.	.	H	α-helix	trans	-66.5	-43.3	175.4	-77.7	-176	176.5	-170.4	0	112.8	H63 I84 I85 V86 N90 T91 A92	H63-K88 HydrophobicContact CB-CD 4.18Å; H63-K88 PolarHBondContact ND1-NZ 3.03Å; I84-K88 HydrophobicContact CG2-CD 4.42Å; I84-K88 WeakPolarHBondContact O-CB 3.14Å; I84-K88 WeakPolarHBondContact O-CG 3.35Å; I84-K88 PolarHBondContact O-N 3.27Å; I85-K88 WeakPolarHBondContact O-CB 3.18Å; I85-K88 PolarHBondContact O-N 2.77Å; V86-K88 VanDerWaalsContact C-N 3.29Å; V86-K88 PolarHBondContact O-N 3.47Å; K88-N90 VanDerWaalsContact C-N 3.32Å; K88-T91 PolarHBondContact O-N 2.75Å; K88-A92 WeakPolarHBondContact O-CB 3.3Å; K88-A92 PolarHBondContact O-N 3.22Å
89	V	91.9	Very high	89.4	Confident	0 Å²	0	58.4 Å²	58.4	0%	0	29%	0.294	C	S	.	.	H	α-helix	trans	-62	-42.7	175.8	168.4	0	0	0	0	110.4	V7 L34 I55 V57 V62 I85 V86 T91 A92	V7-V89 HydrophobicContact CG1-CG2 4.35Å; V7-V89 HydrophobicContact CG2-CG1 3.79Å; L34-V89 HydrophobicContact CD2-CB 4.4Å; L34-V89 HydrophobicContact CD2-CG1 4.33Å; L34-V89 HydrophobicContact CD2-CG2 4.19Å; I55-V89 HydrophobicContact CG2-CG2 4.02Å; V57-V89 HydrophobicContact CG2-CB 4.49Å; V57-V89 HydrophobicContact CG2-CG1 4.11Å; V57-V89 HydrophobicContact CG2-CG2 4Å; V62-V89 HydrophobicContact CG2-CG2 4.09Å; I85-V89 HydrophobicContact CG2-CG2 4.23Å; I85-V89 WeakPolarHBondContact O-CG2 3.45Å; I85-V89 PolarHBondContact O-N 2.79Å; V86-V89 PolarHBondContact O-N 2.87Å; V89-T91 VanDerWaalsContact C-N 3.25Å; V89-T91 PolarHBondContact O-N 3.27Å; V89-A92 PolarHBondContact O-N 2.98Å
90	N	89.2	Confident	89.3	Confident	34 Å²	34	61.9 Å²	61.9	18%	0.182	31%	0.312	C	S	.	.	H	α-helix	trans	-64.3	-29.8	177.4	-84.1	-32.2	0	0	0	113.5	P2 H39 V86 D87 K88	P2-N90 WeakPolarHBondContact CD-O 3.06Å; H39-N90 PolarHBondContact NE2-OD1 3.4Å; V86-N90 WeakPolarHBondContact O-CB 3.34Å; V86-N90 PolarHBondContact O-N 3.39Å; V86-N90 PolarHBondContact O-ND2 2.93Å; D87-N90 PolarHBondContact O-N 3.29Å; K88-N90 VanDerWaalsContact C-N 3.32Å
91	T	88.1	Confident	89.1	Confident	115 Å²	115	59.8 Å²	59.8	71%	0.706	29%	0.291	S	S	*	.	H	α-helix	trans	-88.3	-18.9	178.1	-49	0	0	0	0	112.4	D87 K88 V89 Y93	D87-T91 WeakPolarHBondContact O-CB 3.36Å; D87-T91 PolarHBondContact O-N 3.11Å; D87-T91 PolarHBondContact O-OG1 3.24Å; K88-T91 PolarHBondContact O-N 2.75Å; V89-T91 VanDerWaalsContact C-N 3.25Å; V89-T91 PolarHBondContact O-N 3.27Å; T91-Y93 PolarHBondContact O-N 3.02Å
92	A	81.7	Confident	88.7	Confident	15 Å²	15	62.5 Å²	62.5	12%	0.124	30%	0.303	C	S	.	.			trans	-76.1	91.4	177.6	0	0	0	0	0	110.2	P2 V62 K88 V89	P2-A92 WeakPolarHBondContact CG-O 3.21Å; V62-A92 HydrophobicContact CB-CB 4.38Å; V62-A92 HydrophobicContact CG1-CB 3.49Å; V62-A92 VanDerWaalsContact CG1-CB 3.49Å; K88-A92 WeakPolarHBondContact O-CB 3.3Å; K88-A92 PolarHBondContact O-N 3.22Å; V89-A92 PolarHBondContact O-N 2.98Å
93	Y	62.8	Low	88.3	Confident	186 Å²	186	68.2 Å²	68.2	73%	0.729	33%	0.331	S	S	*	.			trans	67.7	0	177.1	-59.5	-89.1	0	0	0	115.2	P2 E60 T91	P2-Y93 VanDerWaalsContact CB-O 3.28Å; P2-Y93 WeakPolarHBondContact CB-O 2.99Å; P2-Y93 VanDerWaalsContact CD-O 3.24Å; P2-Y93 WeakPolarHBondContact CD-O 3.49Å; P2-Y93 WeakPolarHBondContact CG-O 3.46Å; E60-Y93 PolarHBondContact OE1-OH 3.4Å; E60-Y93 WeakPolarHBondContact OE2-CE2 3.07Å; E60-Y93 PolarHBondContact OE2-OH 3.44Å; T91-Y93 PolarHBondContact O-N 3.02Å

Retrieved 93 of 93 residues in 71.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).