A0A5K4F5W1_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F5W1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 34 aa.

>A0A5K4F5W1_SCHMA|A0A5K4F5W1
MTNYAWICDFIVSTFDFRSLSRVYSFLFSHREFL
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

 

Download Structure   PDB   PAE   Table  
Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M55.9Low86.1Confident243 Ų243115.5 Ų115.5100%1.19759%0.586SS**  0122.40-74.8170.9173.700107.7N3M1-N3 PolarHBondContact O-N 3.23Å
2T75.8Confident86.7Confident94 Ų94114.2 Ų114.258%0.57759%0.587SS**  trans-71.9116.2177.8-53.70000108.7Y4T2-Y4 HydrophobicContact CG2-CE1 4.21Å; T2-Y4 HydrophobicContact CG2-CE2 4.25Å; T2-Y4 VanDerWaalsContact O-CD2 3.26Å; T2-Y4 WeakPolarHBondContact O-CD2 2.96Å; T2-Y4 PolarHBondContact O-N 3.31Å; T2-Y4 VanDerWaalsContact O-N 3.14Å
3N84.2Confident87Confident101 Ų101109.1 Ų109.154%0.5457%0.568SS.*  trans-75.998.4177.1-176.2-16.5000108.5M1 A5 W6M1-N3 PolarHBondContact O-N 3.23Å; N3-A5 VanDerWaalsContact C-N 3.26Å; N3-A5 PolarHBondContact O-N 3.02Å; N3-A5 VanDerWaalsContact OD1-CB 3.29Å; N3-A5 WeakPolarHBondContact OD1-CB 3.45Å; N3-A5 PolarHBondContact OD1-N 3.24Å; N3-A5 VanDerWaalsContact OD1-N 3.09Å; N3-W6 PolarHBondContact O-NE1 2.97Å
4Y87.5Confident87.2Confident157 Ų157105.8 Ų105.862%0.61656%0.555SS**  trans-75.7-12.5179.6-70.6-80.5000113.5T2 W6 I7 C8T2-Y4 HydrophobicContact CG2-CE1 4.21Å; T2-Y4 HydrophobicContact CG2-CE2 4.25Å; T2-Y4 VanDerWaalsContact O-CD2 3.26Å; T2-Y4 WeakPolarHBondContact O-CD2 2.96Å; T2-Y4 PolarHBondContact O-N 3.31Å; T2-Y4 VanDerWaalsContact O-N 3.14Å; Y4-W6 PolarHBondContact O-N 3.04Å; Y4-I7 HydrophobicContact CD1-CD1 4.26Å; Y4-I7 PolarHBondContact O-N 3.33Å; Y4-C8 PolarHBondContact O-N 2.86Å; Y4-C8 PolarHBondContact O-SG 2.97Å; Y4-C8 VanDerWaalsContact O-SG 3.37Å
5A90.2Very high87.3Confident66 Ų66107.9 Ų107.955%0.54556%0.558SS.*Hα-helixtrans-63.6-43-175.700000112N3 I7 C8 D9N3-A5 VanDerWaalsContact C-N 3.26Å; N3-A5 PolarHBondContact O-N 3.02Å; N3-A5 VanDerWaalsContact OD1-CB 3.29Å; N3-A5 WeakPolarHBondContact OD1-CB 3.45Å; N3-A5 PolarHBondContact OD1-N 3.24Å; N3-A5 VanDerWaalsContact OD1-N 3.09Å; A5-I7 VanDerWaalsContact C-N 3.31Å; A5-I7 PolarHBondContact O-N 3.49Å; A5-C8 PolarHBondContact O-N 2.89Å; A5-D9 WeakPolarHBondContact O-CB 3.3Å; A5-D9 PolarHBondContact O-N 3.47Å
6W93.6Very high87.1Confident157 Ų157107.3 Ų107.360%0.59556%0.556SS**Hα-helixtrans-67.7-31.8177.774.9-95.2000112.4N3 Y4 F10N3-W6 PolarHBondContact O-NE1 2.97Å; Y4-W6 PolarHBondContact O-N 3.04Å; W6-F10 WeakPolarHBondContact O-CB 3.33Å; W6-F10 PolarHBondContact O-N 3.36Å
7I92.7Very high87.2Confident51 Ų51109.1 Ų109.126%0.26256%0.559SS.*Hα-helixtrans-69.2-45.1177.3-58.7177.5000109.7Y4 A5 F10 I11Y4-I7 HydrophobicContact CD1-CD1 4.26Å; Y4-I7 PolarHBondContact O-N 3.33Å; A5-I7 VanDerWaalsContact C-N 3.31Å; A5-I7 PolarHBondContact O-N 3.49Å; I7-F10 PolarHBondContact O-N 2.94Å; I7-I11 HydrophobicContact CG2-CD1 3.75Å; I7-I11 HydrophobicContact CG2-CG1 4.35Å; I7-I11 WeakPolarHBondContact O-CB 3.11Å; I7-I11 WeakPolarHBondContact O-CG1 3.01Å; I7-I11 PolarHBondContact O-N 3.29Å
8C92.6Very high87.2Confident76 Ų76113.1 Ų113.151%0.51457%0.566SS.*Hα-helixtrans-61.1-46176.3-67.70000111.6Y4 A5 I11 V12Y4-C8 PolarHBondContact O-N 2.86Å; Y4-C8 PolarHBondContact O-SG 2.97Å; Y4-C8 VanDerWaalsContact O-SG 3.37Å; A5-C8 PolarHBondContact O-N 2.89Å; C8-I11 PolarHBondContact O-N 3.45Å; C8-V12 WeakPolarHBondContact O-CB 3.25Å; C8-V12 VanDerWaalsContact O-CG2 3.31Å; C8-V12 WeakPolarHBondContact O-CG2 3.43Å; C8-V12 PolarHBondContact O-N 2.86Å
9D89.8Confident87.3Confident118 Ų118110.6 Ų110.663%0.63156%0.56SS**Hα-helixtrans-61.4-46.1177.2-171.8-100.8000111.7A5 I11 V12 S13A5-D9 WeakPolarHBondContact O-CB 3.3Å; A5-D9 PolarHBondContact O-N 3.47Å; D9-I11 PolarHBondContact O-N 2.86Å; D9-V12 PolarHBondContact O-N 3.48Å; D9-S13 WeakPolarHBondContact O-CB 3.49Å; D9-S13 PolarHBondContact O-N 2.88Å
10F92.1Very high87.2Confident129 Ų129108.6 Ų108.657%0.56655%0.551SS**Hα-helixtrans-59.6-45.1175.7178.5-97.3000112.5W6 I7 T14W6-F10 WeakPolarHBondContact O-CB 3.33Å; W6-F10 PolarHBondContact O-N 3.36Å; I7-F10 PolarHBondContact O-N 2.94Å; F10-T14 VanDerWaalsContact O-CB 3.28Å; F10-T14 WeakPolarHBondContact O-CB 3.45Å; F10-T14 PolarHBondContact O-N 3.13Å; F10-T14 PolarHBondContact O-OG1 3.31Å
11I92.8Very high87.2Confident78 Ų78107.1 Ų107.140%0.455%0.55SS.*Hα-helixtrans-63.2-52.5177.9-71.9172.1000110.2I7 C8 D9 S13 T14 F15I7-I11 HydrophobicContact CG2-CD1 3.75Å; I7-I11 HydrophobicContact CG2-CG1 4.35Å; I7-I11 WeakPolarHBondContact O-CB 3.11Å; I7-I11 WeakPolarHBondContact O-CG1 3.01Å; I7-I11 PolarHBondContact O-N 3.29Å; C8-I11 PolarHBondContact O-N 3.45Å; D9-I11 PolarHBondContact O-N 2.86Å; I11-S13 PolarHBondContact O-N 2.95Å; I11-T14 PolarHBondContact O-N 3.47Å; I11-F15 HydrophobicContact CG2-CD2 3.59Å; I11-F15 HydrophobicContact CG2-CE2 3.67Å; I11-F15 VanDerWaalsContact O-CD2 3.27Å; I11-F15 WeakPolarHBondContact O-CD2 3.39Å; I11-F15 PolarHBondContact O-N 3.38Å
12V93.1Very high88.8Confident100 Ų100104.6 Ų104.661%0.60653%0.527SS*.Hα-helixtrans-59-47.9-179.6170.50000110.8C8 D9 T14 F15 D16C8-V12 WeakPolarHBondContact O-CB 3.25Å; C8-V12 VanDerWaalsContact O-CG2 3.31Å; C8-V12 WeakPolarHBondContact O-CG2 3.43Å; C8-V12 PolarHBondContact O-N 2.86Å; D9-V12 PolarHBondContact O-N 3.48Å; V12-T14 VanDerWaalsContact C-N 3.34Å; V12-T14 PolarHBondContact O-N 3.06Å; V12-F15 PolarHBondContact O-N 3.19Å; V12-D16 WeakPolarHBondContact O-CB 3.29Å; V12-D16 PolarHBondContact O-N 3.17Å
13S90.4Very high89.5Confident48 Ų48104 Ų10434%0.33652%0.523SS..Hα-helixtrans-57.1-47.3176.6-175.90000111.2D9 I11 F15 D16 F17D9-S13 WeakPolarHBondContact O-CB 3.49Å; D9-S13 PolarHBondContact O-N 2.88Å; I11-S13 PolarHBondContact O-N 2.95Å; S13-F15 PolarHBondContact O-N 3.26Å; S13-D16 PolarHBondContact O-N 2.91Å; S13-F17 WeakPolarHBondContact O-CB 3.37Å; S13-F17 WeakPolarHBondContact O-CD2 3.47Å; S13-F17 PolarHBondContact O-N 3.49Å; S13-F17 WeakPolarHBondContact OG-CD2 3.24Å; S13-F17 VanDerWaalsContact OG-CE2 3.3Å; S13-F17 WeakPolarHBondContact OG-CE2 3.32Å
14T90.9Very high89.6Confident63 Ų63106.5 Ų106.539%0.38753%0.526SS..Hα-helixtrans-61.6-42.1178.5-60.10000112.5F10 I11 V12 R18F10-T14 VanDerWaalsContact O-CB 3.28Å; F10-T14 WeakPolarHBondContact O-CB 3.45Å; F10-T14 PolarHBondContact O-N 3.13Å; F10-T14 PolarHBondContact O-OG1 3.31Å; I11-T14 PolarHBondContact O-N 3.47Å; V12-T14 VanDerWaalsContact C-N 3.34Å; V12-T14 PolarHBondContact O-N 3.06Å; T14-R18 PolarHBondContact O-N 3.09Å; T14-R18 VanDerWaalsContact O-N 3.09Å
15F87.6Confident89.8Confident138 Ų138102.8 Ų102.861%0.60552%0.524SS*.Hα-helixtrans-67.1-41.4177.5-89.8-76.7000112.3I11 V12 S13 S19I11-F15 HydrophobicContact CG2-CD2 3.59Å; I11-F15 HydrophobicContact CG2-CE2 3.67Å; I11-F15 VanDerWaalsContact O-CD2 3.27Å; I11-F15 WeakPolarHBondContact O-CD2 3.39Å; I11-F15 PolarHBondContact O-N 3.38Å; V12-F15 PolarHBondContact O-N 3.19Å; S13-F15 PolarHBondContact O-N 3.26Å; F15-S19 WeakPolarHBondContact O-CB 3.34Å; F15-S19 PolarHBondContact O-N 2.78Å; F15-S19 PolarHBondContact O-OG 3.02Å
16D84.6Confident89.7Confident98 Ų98105.6 Ų105.652%0.52452%0.524SS..Hα-helixtrans-61.4-50.8175.2-172-95.9000110.4V12 S13 R18 S19 L20V12-D16 WeakPolarHBondContact O-CB 3.29Å; V12-D16 PolarHBondContact O-N 3.17Å; S13-D16 PolarHBondContact O-N 2.91Å; D16-R18 PolarHBondContact O-N 3.32Å; D16-S19 PolarHBondContact O-N 2.79Å; D16-S19 VanDerWaalsContact O-N 3.17Å; D16-L20 WeakPolarHBondContact O-CB 3.13Å; D16-L20 PolarHBondContact O-N 3.31Å
17F88.3Confident89.5Confident138 Ų138102.8 Ų102.861%0.60552%0.52SS*.Hα-helixtrans-56.9-45.4178.4-86.4-65.4000113.3S13 S21S13-F17 WeakPolarHBondContact O-CB 3.37Å; S13-F17 WeakPolarHBondContact O-CD2 3.47Å; S13-F17 PolarHBondContact O-N 3.49Å; S13-F17 WeakPolarHBondContact OG-CD2 3.24Å; S13-F17 VanDerWaalsContact OG-CE2 3.3Å; S13-F17 WeakPolarHBondContact OG-CE2 3.32Å; F17-S21 VanDerWaalsContact O-CB 3.24Å; F17-S21 WeakPolarHBondContact O-CB 3.3Å; F17-S21 PolarHBondContact O-N 2.91Å
18R88.5Confident89.2Confident181 Ų181106.5 Ų106.568%0.68353%0.534SS*.Hα-helixtrans-66.9-41.1179.2-178.4175.3-75.7-112.5-1.1111.7T14 D16 R22T14-R18 PolarHBondContact O-N 3.09Å; T14-R18 VanDerWaalsContact O-N 3.09Å; D16-R18 PolarHBondContact O-N 3.32Å; R18-R22 WeakPolarHBondContact O-CG 3.48Å; R18-R22 PolarHBondContact O-N 3.21Å
19S87.9Confident89Confident66 Ų66106.2 Ų106.246%0.46253%0.533SS..Hα-helixtrans-68.6-44.9180-56.80000110.7F15 D16 S21 R22 V23F15-S19 WeakPolarHBondContact O-CB 3.34Å; F15-S19 PolarHBondContact O-N 2.78Å; F15-S19 PolarHBondContact O-OG 3.02Å; D16-S19 PolarHBondContact O-N 2.79Å; D16-S19 VanDerWaalsContact O-N 3.17Å; S19-S21 PolarHBondContact O-N 2.73Å; S19-R22 WeakPolarHBondContact O-CB 3.11Å; S19-R22 PolarHBondContact O-N 3.45Å; S19-V23 WeakPolarHBondContact O-CG2 3.49Å; S19-V23 PolarHBondContact O-N 3.24Å
20L85.3Confident88.8Confident70 Ų70105.1 Ų105.137%0.36652%0.524SS..Hα-helixtrans-60.5-45.2176.4-17465.3000111.7D16 R22 V23 Y24D16-L20 WeakPolarHBondContact O-CB 3.13Å; D16-L20 PolarHBondContact O-N 3.31Å; L20-R22 VanDerWaalsContact C-N 3.27Å; L20-R22 PolarHBondContact O-N 2.92Å; L20-V23 PolarHBondContact O-N 3.41Å; L20-V23 VanDerWaalsContact O-N 3.13Å; L20-Y24 HydrophobicContact CD1-CD2 3.9Å; L20-Y24 HydrophobicContact CD1-CE2 3.47Å; L20-Y24 VanDerWaalsContact CD1-CE2 3.47Å; L20-Y24 HydrophobicContact CD2-CD2 4.46Å; L20-Y24 HydrophobicContact CD2-CE2 3.93Å; L20-Y24 HydrophobicContact CG-CD2 3.68Å; L20-Y24 HydrophobicContact CG-CE2 3.49Å; L20-Y24 VanDerWaalsContact CG-CE2 3.49Å; L20-Y24 WeakPolarHBondContact O-CD2 3.33Å; L20-Y24 PolarHBondContact O-N 2.94Å
21S88.6Confident87.9Confident77 Ų77108.6 Ų108.654%0.53853%0.534SS..Hα-helixtrans-58.3-38.3176.1176.10000112.3F17 S19 S25F17-S21 VanDerWaalsContact O-CB 3.24Å; F17-S21 WeakPolarHBondContact O-CB 3.3Å; F17-S21 PolarHBondContact O-N 2.91Å; S19-S21 PolarHBondContact O-N 2.73Å; S21-S25 WeakPolarHBondContact O-CB 3.44Å; S21-S25 PolarHBondContact O-N 2.85Å
22R88.8Confident86.9Confident190 Ų190111.5 Ų111.572%0.71755%0.545SS*.Hα-helixtrans-67.5-42.1175-67.7174.475.4171.85.6112.2R18 S19 L20 S25 F26R18-R22 WeakPolarHBondContact O-CG 3.48Å; R18-R22 PolarHBondContact O-N 3.21Å; S19-R22 WeakPolarHBondContact O-CB 3.11Å; S19-R22 PolarHBondContact O-N 3.45Å; L20-R22 VanDerWaalsContact C-N 3.27Å; L20-R22 PolarHBondContact O-N 2.92Å; R22-S25 PolarHBondContact O-N 3.4Å; R22-F26 WeakPolarHBondContact O-CB 3.28Å; R22-F26 PolarHBondContact O-N 3.43Å
23V90.5Very high85.7Confident81 Ų81115.6 Ų115.649%0.49156%0.555SS.*Hα-helixtrans-62.3-47.3176174.50000110.4S19 L20 S25 F26 L27S19-V23 WeakPolarHBondContact O-CG2 3.49Å; S19-V23 PolarHBondContact O-N 3.24Å; L20-V23 PolarHBondContact O-N 3.41Å; L20-V23 VanDerWaalsContact O-N 3.13Å; V23-S25 PolarHBondContact O-N 3.44Å; V23-F26 PolarHBondContact O-N 2.92Å; V23-L27 HydrophobicContact CG1-CD1 3.85Å; V23-L27 HydrophobicContact CG1-CG 4.26Å; V23-L27 WeakPolarHBondContact O-CB 3.18Å; V23-L27 VanDerWaalsContact O-CG 3.29Å; V23-L27 WeakPolarHBondContact O-CG 3.48Å; V23-L27 PolarHBondContact O-N 3.36Å
24Y86.5Confident84.1Confident154 Ų154122.9 Ų122.960%0.60459%0.589SS**Hα-helixtrans-60.9-44.7177.2-85.4-65.9000112.6L20 F26 L27 F28L20-Y24 HydrophobicContact CD1-CD2 3.9Å; L20-Y24 HydrophobicContact CD1-CE2 3.47Å; L20-Y24 VanDerWaalsContact CD1-CE2 3.47Å; L20-Y24 HydrophobicContact CD2-CD2 4.46Å; L20-Y24 HydrophobicContact CD2-CE2 3.93Å; L20-Y24 HydrophobicContact CG-CD2 3.68Å; L20-Y24 HydrophobicContact CG-CE2 3.49Å; L20-Y24 VanDerWaalsContact CG-CE2 3.49Å; L20-Y24 WeakPolarHBondContact O-CD2 3.33Å; L20-Y24 PolarHBondContact O-N 2.94Å; Y24-F26 VanDerWaalsContact C-N 3.34Å; Y24-F26 PolarHBondContact O-N 2.91Å; Y24-L27 PolarHBondContact O-N 3.42Å; Y24-F28 VanDerWaalsContact O-CB 3.25Å; Y24-F28 WeakPolarHBondContact O-CB 3.22Å; Y24-F28 PolarHBondContact O-N 2.9Å
25S90.2Very high83.8Confident80 Ų80125.9 Ų125.956%0.55960%0.599SS**Hα-helixtrans-61.8-42.2177.1-179.40000111.8S21 R22 V23 F28 S29S21-S25 WeakPolarHBondContact O-CB 3.44Å; S21-S25 PolarHBondContact O-N 2.85Å; R22-S25 PolarHBondContact O-N 3.4Å; V23-S25 PolarHBondContact O-N 3.44Å; S25-F28 PolarHBondContact O-N 2.88Å; S25-S29 VanDerWaalsContact O-CB 3.3Å; S25-S29 WeakPolarHBondContact O-CB 3.39Å; S25-S29 PolarHBondContact O-N 3.22Å
26F89.7Confident83.6Confident124 Ų124125.2 Ų125.254%0.54460%0.599SS.*Hα-helixtrans-63.5-47.5175.9-179.6-92.6000112.3R22 V23 Y24 F28 S29 H30R22-F26 WeakPolarHBondContact O-CB 3.28Å; R22-F26 PolarHBondContact O-N 3.43Å; V23-F26 PolarHBondContact O-N 2.92Å; Y24-F26 VanDerWaalsContact C-N 3.34Å; Y24-F26 PolarHBondContact O-N 2.91Å; F26-F28 VanDerWaalsContact C-N 3.34Å; F26-F28 PolarHBondContact O-N 3.42Å; F26-S29 PolarHBondContact O-N 3Å; F26-H30 AromaticContact CD1-ND1 3.8Å; F26-H30 AromaticContact CD2-CE1 3.66Å; F26-H30 AromaticContact CD2-ND1 3.95Å; F26-H30 AromaticContact CE1-CE1 3.49Å; F26-H30 VanDerWaalsContact CE1-CE1 3.49Å; F26-H30 WeakPolarHBondContact CE1-CE1 3.2Å; F26-H30 AromaticContact CE1-ND1 3.62Å; F26-H30 AromaticContact CE1-NE2 3.89Å; F26-H30 AromaticContact CE2-CE1 3.11Å; F26-H30 WeakPolarHBondContact CE2-CE1 3.27Å; F26-H30 AromaticContact CE2-ND1 3.81Å; F26-H30 AromaticContact CE2-NE2 3.88Å; F26-H30 AromaticContact CG-ND1 3.97Å; F26-H30 AromaticContact CZ-CE1 3.01Å; F26-H30 WeakPolarHBondContact CZ-CE1 3.31Å; F26-H30 AromaticContact CZ-ND1 3.64Å; F26-H30 AromaticContact CZ-NE2 3.39Å; F26-H30 WeakPolarHBondContact CZ-NE2 3.48Å; F26-H30 PolarHBondContact O-N 3Å; F26-H30 PolarHBondContact O-ND1 3.45Å
27L88.9Confident83.5Confident98 Ų98126.7 Ų126.751%0.51360%0.603SS.*Hα-helixtrans-63.2-40.8178.4-71.6175.5000111.7V23 Y24 H30 R31V23-L27 HydrophobicContact CG1-CD1 3.85Å; V23-L27 HydrophobicContact CG1-CG 4.26Å; V23-L27 WeakPolarHBondContact O-CB 3.18Å; V23-L27 VanDerWaalsContact O-CG 3.29Å; V23-L27 WeakPolarHBondContact O-CG 3.48Å; V23-L27 PolarHBondContact O-N 3.36Å; Y24-L27 PolarHBondContact O-N 3.42Å; L27-H30 PolarHBondContact O-N 3.39Å; L27-R31 WeakPolarHBondContact O-CB 3.47Å; L27-R31 PolarHBondContact O-N 3.37Å
28F85.4Confident83.3Confident129 Ų129126.1 Ų126.157%0.56660%0.603SS**Hα-helixtrans-63-48.3175.3-176.9-101.2000111Y24 S25 F26 H30 R31 E32Y24-F28 VanDerWaalsContact O-CB 3.25Å; Y24-F28 WeakPolarHBondContact O-CB 3.22Å; Y24-F28 PolarHBondContact O-N 2.9Å; S25-F28 PolarHBondContact O-N 2.88Å; F26-F28 VanDerWaalsContact C-N 3.34Å; F26-F28 PolarHBondContact O-N 3.42Å; F28-H30 PolarHBondContact O-N 2.95Å; F28-R31 PolarHBondContact O-N 3.14Å; F28-E32 WeakPolarHBondContact CD1-OE2 3.29Å; F28-E32 HydrophobicContact CE1-CG 4.09Å; F28-E32 WeakPolarHBondContact CE1-OE2 3.26Å; F28-E32 HydrophobicContact CE2-CG 4.48Å; F28-E32 HydrophobicContact CZ-CG 4.04Å; F28-E32 PolarHBondContact O-N 3.46Å
29S88.6Confident82.9Confident71 Ų71122.6 Ų122.650%0.49760%0.598SS.*Hα-helixtrans-59.2-32.6176.3176.20000113.2S25 F26S25-S29 VanDerWaalsContact O-CB 3.3Å; S25-S29 WeakPolarHBondContact O-CB 3.39Å; S25-S29 PolarHBondContact O-N 3.22Å; F26-S29 PolarHBondContact O-N 3Å
30H85.3Confident82.6Confident94 Ų94126.4 Ų126.444%0.43561%0.607SS.*Hα-helixtrans-77.2-34.2174.7-78.563.2000112.6F26 L27 F28 F33 L34F26-H30 AromaticContact CD1-ND1 3.8Å; F26-H30 AromaticContact CD2-CE1 3.66Å; F26-H30 AromaticContact CD2-ND1 3.95Å; F26-H30 AromaticContact CE1-CE1 3.49Å; F26-H30 VanDerWaalsContact CE1-CE1 3.49Å; F26-H30 WeakPolarHBondContact CE1-CE1 3.2Å; F26-H30 AromaticContact CE1-ND1 3.62Å; F26-H30 AromaticContact CE1-NE2 3.89Å; F26-H30 AromaticContact CE2-CE1 3.11Å; F26-H30 WeakPolarHBondContact CE2-CE1 3.27Å; F26-H30 AromaticContact CE2-ND1 3.81Å; F26-H30 AromaticContact CE2-NE2 3.88Å; F26-H30 AromaticContact CG-ND1 3.97Å; F26-H30 AromaticContact CZ-CE1 3.01Å; F26-H30 WeakPolarHBondContact CZ-CE1 3.31Å; F26-H30 AromaticContact CZ-ND1 3.64Å; F26-H30 AromaticContact CZ-NE2 3.39Å; F26-H30 WeakPolarHBondContact CZ-NE2 3.48Å; F26-H30 PolarHBondContact O-N 3Å; F26-H30 PolarHBondContact O-ND1 3.45Å; L27-H30 PolarHBondContact O-N 3.39Å; F28-H30 PolarHBondContact O-N 2.95Å; H30-F33 PolarHBondContact O-N 3.09Å; H30-L34 PolarHBondContact O-N 3.32Å
31R73.5Confident82.4Confident203 Ų203130.4 Ų130.477%0.76662%0.624SS**Hα-helixtrans-72-30.9179.6-165.8177.7-179.9170.90.3112.4L27 F28 F33L27-R31 WeakPolarHBondContact O-CB 3.47Å; L27-R31 PolarHBondContact O-N 3.37Å; F28-R31 PolarHBondContact O-N 3.14Å; R31-F33 VanDerWaalsContact C-N 3.27Å
32E71.5Confident81.9Confident139 Ų139134.5 Ų134.565%0.6563%0.631SS**THydrogen-bonded Turntrans-72.7-19.4171.3-70-174.2112.500113.1F28F28-E32 WeakPolarHBondContact CD1-OE2 3.29Å; F28-E32 HydrophobicContact CE1-CG 4.09Å; F28-E32 WeakPolarHBondContact CE1-OE2 3.26Å; F28-E32 HydrophobicContact CE2-CG 4.48Å; F28-E32 HydrophobicContact CZ-CG 4.04Å; F28-E32 PolarHBondContact O-N 3.46Å
33F67.8Low81.4Confident186 Ų186129.9 Ų129.982%0.81662%0.624SS**THydrogen-bonded Turntrans-84.1-24.4176.7-174-97.7000113.4H30 R31H30-F33 PolarHBondContact O-N 3.09Å; R31-F33 VanDerWaalsContact C-N 3.27Å
34L58.5Low80.5Confident200 Ų200134.4 Ų134.4100%1.04764%0.636SS**  trans-84.60176.1-69176000111.6H30H30-L34 PolarHBondContact O-N 3.32Å

Retrieved 34 of 34 residues in 48.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).