A0A5K4F5Y6_SCHMA Loading...

Transposase

AlphaFold DB , UniProt , Accession A0A5K4F5Y6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 107 aa.

						>A0A5K4F5Y6_SCHMA|A0A5K4F5Y6
MDTKGLRKLIEDKANDAIEGIQRCRDTYRREMAECKHFVIDKVSTFFADLEMRSQKQENVDDGIIQGLIVELMEQLENIDTLLSEIHMCRDTLSKLNEMLTGKVDSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.8	Low	90.8	Very high	177 Å²	177	114.7 Å²	114.7	87%	0.872	57%	0.566	S	S	*	*				0	125.4	0	-157.9	178.6	-170.8	0	0	106.8	L6 L9	M1-L6 HydrophobicContact SD-CB 4.48Å; M1-L6 HydrophobicContact SD-CD1 4.46Å; M1-L9 HydrophobicContact CE-CB 4.3Å; M1-L9 HydrophobicContact CE-CD2 3.93Å
2	D	85.2	Confident	91.3	Very high	103 Å²	103	111.1 Å²	111.1	55%	0.551	55%	0.551	S	S	*	*			trans	-78.9	162.8	176.3	73.8	2.9	0	0	0	110.6	K4 G5 L6	D2-K4 PolarHBondContact O-N 3.48Å; D2-K4 PolarHBondContact OD1-N 3.43Å; D2-G5 PolarHBondContact O-N 2.91Å; D2-G5 PolarHBondContact OD1-N 2.72Å; D2-L6 PolarHBondContact O-N 3.08Å; D2-L6 VanDerWaalsContact O-N 3.16Å
3	T	89.6	Confident	91.8	Very high	123 Å²	123	112.7 Å²	112.7	76%	0.755	55%	0.553	S	S	*	*	H	α-helix	trans	-63.1	-28.1	-177.8	49.9	0	0	0	0	112.6	R7	T3-R7 WeakPolarHBondContact O-CB 3.39Å; T3-R7 PolarHBondContact O-N 3.28Å
4	K	91.1	Very high	92.2	Very high	165 Å²	165	107.9 Å²	107.9	72%	0.717	54%	0.54	S	S	*	.	H	α-helix	trans	-67.7	-45.6	176.2	-70.4	-176.1	177.8	180	0	111.6	D2 L6 R7 K8	D2-K4 PolarHBondContact O-N 3.48Å; D2-K4 PolarHBondContact OD1-N 3.43Å; K4-L6 VanDerWaalsContact C-N 3.35Å; K4-R7 PolarHBondContact O-N 3.34Å; K4-K8 PolarHBondContact O-N 3.27Å
5	G	93.9	Very high	92.6	Very high	27 Å²	27	106.4 Å²	106.4	28%	0.278	53%	0.534	S	S	.	.	H	α-helix	trans	-63.9	-39.8	176.8	0	0	0	0	0	112.2	D2 L9	D2-G5 PolarHBondContact O-N 2.91Å; D2-G5 PolarHBondContact OD1-N 2.72Å; G5-L9 PolarHBondContact O-N 3.48Å
6	L	94.6	Very high	93	Very high	86 Å²	86	106.2 Å²	106.2	45%	0.45	54%	0.535	S	S	.	.	H	α-helix	trans	-64.5	-43.7	174.3	-178.1	62.2	0	0	0	111.8	M1 D2 K4 L9 I10	M1-L6 HydrophobicContact SD-CB 4.48Å; M1-L6 HydrophobicContact SD-CD1 4.46Å; D2-L6 PolarHBondContact O-N 3.08Å; D2-L6 VanDerWaalsContact O-N 3.16Å; K4-L6 VanDerWaalsContact C-N 3.35Å; L6-L9 PolarHBondContact O-N 3.32Å; L6-I10 HydrophobicContact CD1-CD1 4.3Å; L6-I10 HydrophobicContact CG-CD1 4.12Å; L6-I10 WeakPolarHBondContact O-CG1 3.47Å; L6-I10 PolarHBondContact O-N 3.26Å; L6-I10 VanDerWaalsContact O-N 3.08Å
7	R	94.8	Very high	93.3	Very high	173 Å²	173	103.1 Å²	103.1	65%	0.653	53%	0.53	S	S	*	.	H	α-helix	trans	-59.6	-48.1	176.9	-179.1	-179	-72.7	177	-4.6	111.3	T3 K4 L9 I10 E11	T3-R7 WeakPolarHBondContact O-CB 3.39Å; T3-R7 PolarHBondContact O-N 3.28Å; K4-R7 PolarHBondContact O-N 3.34Å; R7-L9 VanDerWaalsContact C-N 3.34Å; R7-L9 PolarHBondContact O-N 3Å; R7-I10 PolarHBondContact O-N 3.28Å; R7-I10 VanDerWaalsContact O-N 3.14Å; R7-E11 WeakPolarHBondContact CD-OE1 3.37Å; R7-E11 HydrophobicContact CG-CG 4.44Å; R7-E11 VanDerWaalsContact CG-OE1 3.32Å; R7-E11 WeakPolarHBondContact CG-OE1 3.34Å; R7-E11 WeakPolarHBondContact O-CG 3.41Å; R7-E11 PolarHBondContact O-N 3.46Å
8	K	96	Very high	93.6	Very high	129 Å²	129	102.1 Å²	102.1	56%	0.561	53%	0.525	S	S	*	.	H	α-helix	trans	-59.3	-44.1	178.3	-173.4	178.1	178	-177.3	0	111.9	K4 I10 E11 D12	K4-K8 PolarHBondContact O-N 3.27Å; K8-I10 VanDerWaalsContact C-N 3.28Å; K8-I10 PolarHBondContact O-N 3.27Å; K8-E11 PolarHBondContact O-N 3.44Å; K8-D12 WeakPolarHBondContact O-CB 3.32Å; K8-D12 VanDerWaalsContact O-CG 3.23Å; K8-D12 PolarHBondContact O-N 2.89Å
9	L	96.8	Very high	93.8	Very high	73 Å²	73	102.2 Å²	102.2	38%	0.382	52%	0.523	S	S	.	.	H	α-helix	trans	-60.7	-37.6	177	-178.5	65.5	0	0	0	112.4	M1 G5 L6 R7 K13	M1-L9 HydrophobicContact CE-CB 4.3Å; M1-L9 HydrophobicContact CE-CD2 3.93Å; G5-L9 PolarHBondContact O-N 3.48Å; L6-L9 PolarHBondContact O-N 3.32Å; R7-L9 VanDerWaalsContact C-N 3.34Å; R7-L9 PolarHBondContact O-N 3Å; L9-K13 WeakPolarHBondContact O-CB 3.4Å; L9-K13 WeakPolarHBondContact O-CG 3.32Å; L9-K13 PolarHBondContact O-N 2.92Å; L9-K13 VanDerWaalsContact O-N 3.09Å
10	I	96.5	Very high	94	Very high	105 Å²	105	98.5 Å²	98.5	54%	0.538	51%	0.511	S	S	.	.	H	α-helix	trans	-69	-43.5	176.3	-68.1	168.6	0	0	0	110.6	L6 R7 K8 K13 A14	L6-I10 HydrophobicContact CD1-CD1 4.3Å; L6-I10 HydrophobicContact CG-CD1 4.12Å; L6-I10 WeakPolarHBondContact O-CG1 3.47Å; L6-I10 PolarHBondContact O-N 3.26Å; L6-I10 VanDerWaalsContact O-N 3.08Å; R7-I10 PolarHBondContact O-N 3.28Å; R7-I10 VanDerWaalsContact O-N 3.14Å; K8-I10 VanDerWaalsContact C-N 3.28Å; K8-I10 PolarHBondContact O-N 3.27Å; I10-K13 PolarHBondContact O-N 2.93Å; I10-A14 VanDerWaalsContact O-CB 3.32Å; I10-A14 WeakPolarHBondContact O-CB 3.46Å; I10-A14 PolarHBondContact O-N 3.43Å
11	E	97.1	Very high	94.3	Very high	101 Å²	101	99.3 Å²	99.3	47%	0.472	52%	0.515	S	S	.	.	H	α-helix	trans	-60.9	-47.7	176.4	-73.6	169.3	-175.3	0	0	111.4	R7 K8 K13 A14 N15	R7-E11 WeakPolarHBondContact CD-OE1 3.37Å; R7-E11 HydrophobicContact CG-CG 4.44Å; R7-E11 VanDerWaalsContact CG-OE1 3.32Å; R7-E11 WeakPolarHBondContact CG-OE1 3.34Å; R7-E11 WeakPolarHBondContact O-CG 3.41Å; R7-E11 PolarHBondContact O-N 3.46Å; K8-E11 PolarHBondContact O-N 3.44Å; E11-K13 PolarHBondContact O-N 2.97Å; E11-A14 PolarHBondContact O-N 3.48Å; E11-N15 WeakPolarHBondContact O-CB 3.39Å; E11-N15 VanDerWaalsContact O-CG 3.25Å; E11-N15 PolarHBondContact O-N 3.08Å; E11-N15 PolarHBondContact O-ND2 3.49Å
12	D	97.6	Very high	96	Very high	71 Å²	71	95 Å²	95	38%	0.38	49%	0.493	S	S	.	.	H	α-helix	trans	-59.6	-47.3	177.8	-67.1	-18.6	0	0	0	110.5	K8 A14 N15 D16	K8-D12 WeakPolarHBondContact O-CB 3.32Å; K8-D12 VanDerWaalsContact O-CG 3.23Å; K8-D12 PolarHBondContact O-N 2.89Å; D12-A14 VanDerWaalsContact C-N 3.35Å; D12-A14 PolarHBondContact O-N 3.3Å; D12-N15 PolarHBondContact O-N 3.37Å; D12-D16 VanDerWaalsContact O-CG 3.32Å; D12-D16 PolarHBondContact O-N 3.41Å
13	K	97.7	Very high	96.6	Very high	132 Å²	132	98 Å²	98	57%	0.574	50%	0.496	S	S	*	.	H	α-helix	trans	-63.5	-37.2	176.4	-77.8	-176.2	175.5	-169.8	0	113.5	L9 I10 E11 A17	L9-K13 WeakPolarHBondContact O-CB 3.4Å; L9-K13 WeakPolarHBondContact O-CG 3.32Å; L9-K13 PolarHBondContact O-N 2.92Å; L9-K13 VanDerWaalsContact O-N 3.09Å; I10-K13 PolarHBondContact O-N 2.93Å; E11-K13 PolarHBondContact O-N 2.97Å; K13-A17 WeakPolarHBondContact O-CB 3.47Å; K13-A17 PolarHBondContact O-N 2.89Å
14	A	97.7	Very high	97	Very high	45 Å²	45	96.3 Å²	96.3	37%	0.372	49%	0.488	S	S	.	.	H	α-helix	trans	-67.1	-42.2	177.2	0	0	0	0	0	110.7	I10 E11 D12 A17 I18	I10-A14 VanDerWaalsContact O-CB 3.32Å; I10-A14 WeakPolarHBondContact O-CB 3.46Å; I10-A14 PolarHBondContact O-N 3.43Å; E11-A14 PolarHBondContact O-N 3.48Å; D12-A14 VanDerWaalsContact C-N 3.35Å; D12-A14 PolarHBondContact O-N 3.3Å; A14-A17 PolarHBondContact O-N 2.92Å; A14-I18 VanDerWaalsContact O-CG1 3.24Å; A14-I18 WeakPolarHBondContact O-CG1 3.4Å; A14-I18 PolarHBondContact O-N 3.34Å
15	N	98.1	Very high	97.4	Very high	86 Å²	86	95.1 Å²	95.1	46%	0.46	48%	0.479	S	S	.	.	H	α-helix	trans	-63.7	-47	176.1	-69.3	-27.3	0	0	0	111.4	E11 D12 A17 I18 E19	E11-N15 WeakPolarHBondContact O-CB 3.39Å; E11-N15 VanDerWaalsContact O-CG 3.25Å; E11-N15 PolarHBondContact O-N 3.08Å; E11-N15 PolarHBondContact O-ND2 3.49Å; D12-N15 PolarHBondContact O-N 3.37Å; N15-A17 VanDerWaalsContact C-N 3.28Å; N15-A17 PolarHBondContact O-N 3.27Å; N15-I18 PolarHBondContact O-N 2.9Å; N15-I18 VanDerWaalsContact O-N 3.12Å; N15-E19 WeakPolarHBondContact O-CG 3.44Å; N15-E19 PolarHBondContact O-N 2.91Å
16	D	98.2	Very high	97.6	Very high	103 Å²	103	98 Å²	98	55%	0.551	49%	0.488	S	S	*	.	H	α-helix	trans	-57.7	-41.8	175.9	-71.8	-17.5	0	0	0	111.8	D12 E19 G20	D12-D16 VanDerWaalsContact O-CG 3.32Å; D12-D16 PolarHBondContact O-N 3.41Å; D16-E19 PolarHBondContact O-N 3.24Å; D16-G20 PolarHBondContact O-N 3.21Å
17	A	98.2	Very high	97.8	Very high	53 Å²	53	96.2 Å²	96.2	44%	0.438	48%	0.481	S	S	.	.	H	α-helix	trans	-65.9	-42.1	176.8	0	0	0	0	0	111.9	K13 A14 N15 G20 I21	K13-A17 WeakPolarHBondContact O-CB 3.47Å; K13-A17 PolarHBondContact O-N 2.89Å; A14-A17 PolarHBondContact O-N 2.92Å; N15-A17 VanDerWaalsContact C-N 3.28Å; N15-A17 PolarHBondContact O-N 3.27Å; A17-G20 PolarHBondContact O-N 3.5Å; A17-I21 VanDerWaalsContact O-CG1 3.27Å; A17-I21 WeakPolarHBondContact O-CG1 3.37Å; A17-I21 PolarHBondContact O-N 3.4Å
18	I	98.3	Very high	97.9	Very high	86 Å²	86	95.3 Å²	95.3	44%	0.441	48%	0.479	S	S	.	.	H	α-helix	trans	-62.2	-45.6	176.2	-71.3	164.6	0	0	0	110.5	A14 N15 G20 I21 Q22	A14-I18 VanDerWaalsContact O-CG1 3.24Å; A14-I18 WeakPolarHBondContact O-CG1 3.4Å; A14-I18 PolarHBondContact O-N 3.34Å; N15-I18 PolarHBondContact O-N 2.9Å; N15-I18 VanDerWaalsContact O-N 3.12Å; I18-G20 VanDerWaalsContact C-N 3.33Å; I18-G20 PolarHBondContact O-N 3.12Å; I18-I21 PolarHBondContact O-N 3.39Å; I18-Q22 VanDerWaalsContact O-CG 3.32Å; I18-Q22 WeakPolarHBondContact O-CG 3.37Å; I18-Q22 PolarHBondContact O-N 3.05Å
19	E	98.3	Very high	98.1	Very high	104 Å²	104	98.3 Å²	98.3	49%	0.486	49%	0.487	S	S	.	.	H	α-helix	trans	-63.5	-39.1	176.3	-71.9	-176.4	-175.1	0	0	112.1	N15 D16 Q22 R23	N15-E19 WeakPolarHBondContact O-CG 3.44Å; N15-E19 PolarHBondContact O-N 2.91Å; D16-E19 PolarHBondContact O-N 3.24Å; E19-Q22 PolarHBondContact O-N 3.4Å; E19-R23 WeakPolarHBondContact O-CG 3.36Å; E19-R23 PolarHBondContact O-N 3.47Å
20	G	98.5	Very high	98.1	Very high	28 Å²	28	101.4 Å²	101.4	29%	0.289	49%	0.493	S	S	.	.	H	α-helix	trans	-60.1	-46.2	172.8	0	0	0	0	0	112.4	D16 A17 I18 R23 C24	D16-G20 PolarHBondContact O-N 3.21Å; A17-G20 PolarHBondContact O-N 3.5Å; I18-G20 VanDerWaalsContact C-N 3.33Å; I18-G20 PolarHBondContact O-N 3.12Å; G20-R23 PolarHBondContact O-N 2.94Å; G20-C24 WeakPolarHBondContact O-CB 3.33Å; G20-C24 PolarHBondContact O-N 3.47Å
21	I	98.4	Very high	98.2	Very high	115 Å²	115	101.7 Å²	101.7	59%	0.59	49%	0.492	S	S	*	.	H	α-helix	trans	-63.5	-42.3	177.2	-70.9	166	0	0	0	110.9	A17 I18 C24 R25	A17-I21 VanDerWaalsContact O-CG1 3.27Å; A17-I21 WeakPolarHBondContact O-CG1 3.37Å; A17-I21 PolarHBondContact O-N 3.4Å; I18-I21 PolarHBondContact O-N 3.39Å; I21-C24 PolarHBondContact O-N 2.94Å; I21-R25 WeakPolarHBondContact O-CB 3.27Å; I21-R25 PolarHBondContact O-N 2.86Å
22	Q	98.4	Very high	98.3	Very high	88 Å²	88	101.9 Å²	101.9	41%	0.411	49%	0.494	S	S	.	.	H	α-helix	trans	-62.9	-46.9	178	-72.6	177	1.4	0	0	111.6	I18 E19 C24 R25 D26	I18-Q22 VanDerWaalsContact O-CG 3.32Å; I18-Q22 WeakPolarHBondContact O-CG 3.37Å; I18-Q22 PolarHBondContact O-N 3.05Å; E19-Q22 PolarHBondContact O-N 3.4Å; Q22-C24 VanDerWaalsContact C-N 3.33Å; Q22-C24 PolarHBondContact O-N 3.01Å; Q22-R25 PolarHBondContact O-N 3.48Å; Q22-D26 WeakPolarHBondContact O-CB 3.47Å; Q22-D26 PolarHBondContact O-N 3.39Å
23	R	98.5	Very high	98.4	Very high	166 Å²	166	100.6 Å²	100.6	63%	0.626	49%	0.493	S	S	*	.	H	α-helix	trans	-59.8	-41.7	175.5	-75.2	-174.9	-73.7	-176	-6.3	112.7	E19 G20 D26 T27	E19-R23 WeakPolarHBondContact O-CG 3.36Å; E19-R23 PolarHBondContact O-N 3.47Å; G20-R23 PolarHBondContact O-N 2.94Å; R23-D26 PolarHBondContact O-N 3.17Å; R23-T27 WeakPolarHBondContact O-CB 3.44Å; R23-T27 PolarHBondContact O-N 3.02Å; R23-T27 PolarHBondContact O-OG1 2.91Å
24	C	98.4	Very high	98.4	Very high	86 Å²	86	99.7 Å²	99.7	58%	0.581	49%	0.491	S	S	*	.	H	α-helix	trans	-62.4	-48.3	176	-177.2	0	0	0	0	111.2	G20 I21 Q22 D26 T27 Y28	G20-C24 WeakPolarHBondContact O-CB 3.33Å; G20-C24 PolarHBondContact O-N 3.47Å; I21-C24 PolarHBondContact O-N 2.94Å; Q22-C24 VanDerWaalsContact C-N 3.33Å; Q22-C24 PolarHBondContact O-N 3.01Å; C24-D26 VanDerWaalsContact C-N 3.34Å; C24-D26 PolarHBondContact O-N 3.38Å; C24-T27 PolarHBondContact O-N 3.4Å; C24-Y28 WeakPolarHBondContact O-CB 3.35Å; C24-Y28 PolarHBondContact O-N 2.89Å
25	R	98.5	Very high	98.4	Very high	141 Å²	141	100.8 Å²	100.8	53%	0.532	50%	0.496	S	S	.	.	H	α-helix	trans	-58.9	-44.4	177.7	-178.4	-171	65.7	-162.6	-4.4	112.1	I21 Q22 T27 Y28 R29	I21-R25 WeakPolarHBondContact O-CB 3.27Å; I21-R25 PolarHBondContact O-N 2.86Å; Q22-R25 PolarHBondContact O-N 3.48Å; R25-T27 VanDerWaalsContact C-N 3.33Å; R25-Y28 PolarHBondContact O-N 3.34Å; R25-R29 WeakPolarHBondContact O-CB 3.37Å; R25-R29 PolarHBondContact O-N 2.96Å
26	D	98.6	Very high	98.4	Very high	87 Å²	87	103.1 Å²	103.1	47%	0.465	50%	0.502	S	S	.	.	H	α-helix	trans	-70	-35.3	-177.7	-63.8	-12.4	0	0	0	111.1	Q22 R23 C24 R30	Q22-D26 WeakPolarHBondContact O-CB 3.47Å; Q22-D26 PolarHBondContact O-N 3.39Å; R23-D26 PolarHBondContact O-N 3.17Å; C24-D26 VanDerWaalsContact C-N 3.34Å; C24-D26 PolarHBondContact O-N 3.38Å; D26-R30 PolarHBondContact O-N 3.17Å; D26-R30 VanDerWaalsContact O-N 3.14Å
27	T	98.6	Very high	98.5	Very high	49 Å²	49	104.4 Å²	104.4	30%	0.301	50%	0.504	S	S	.	.	H	α-helix	trans	-63.9	-51.9	172	-60.3	0	0	0	0	111.3	R23 C24 R25 R29 R30 E31	R23-T27 WeakPolarHBondContact O-CB 3.44Å; R23-T27 PolarHBondContact O-N 3.02Å; R23-T27 PolarHBondContact O-OG1 2.91Å; C24-T27 PolarHBondContact O-N 3.4Å; R25-T27 VanDerWaalsContact C-N 3.33Å; T27-R29 VanDerWaalsContact C-N 3.28Å; T27-R29 PolarHBondContact O-N 3.01Å; T27-R30 PolarHBondContact O-N 3.02Å; T27-R30 VanDerWaalsContact O-N 3.12Å; T27-E31 HydrophobicContact CG2-CG 4.37Å; T27-E31 WeakPolarHBondContact CG2-OE1 3.33Å; T27-E31 WeakPolarHBondContact O-CG 3.33Å; T27-E31 PolarHBondContact O-N 2.98Å
28	Y	98.5	Very high	98.5	Very high	153 Å²	153	107.8 Å²	107.8	60%	0.6	51%	0.509	S	S	*	.	H	α-helix	trans	-57.5	-41.8	177.5	-179.9	-96.2	0	0	0	112.1	C24 R25 R30 E31 M32	C24-Y28 WeakPolarHBondContact O-CB 3.35Å; C24-Y28 PolarHBondContact O-N 2.89Å; R25-Y28 PolarHBondContact O-N 3.34Å; Y28-R30 VanDerWaalsContact C-N 3.32Å; Y28-R30 PolarHBondContact O-N 3.35Å; Y28-E31 PolarHBondContact O-N 3.39Å; Y28-M32 HydrophobicContact CE1-CB 4.49Å; Y28-M32 WeakPolarHBondContact O-CB 3.37Å; Y28-M32 PolarHBondContact O-N 3.22Å
29	R	98.5	Very high	98.5	Very high	193 Å²	193	107.3 Å²	107.3	73%	0.728	51%	0.51	S	S	*	.	H	α-helix	trans	-61.9	-40.7	178.6	-174.1	176.6	-178.6	163.3	1.4	112.1	R25 T27 A33	R25-R29 WeakPolarHBondContact O-CB 3.37Å; R25-R29 PolarHBondContact O-N 2.96Å; T27-R29 VanDerWaalsContact C-N 3.28Å; T27-R29 PolarHBondContact O-N 3.01Å; R29-A33 WeakPolarHBondContact O-CB 3.33Å; R29-A33 PolarHBondContact O-N 3.37Å; R29-A33 VanDerWaalsContact O-N 3.12Å
30	R	98.5	Very high	98.5	Very high	138 Å²	138	106.4 Å²	106.4	52%	0.521	51%	0.508	S	S	.	.	H	α-helix	trans	-67.7	-50.8	176.9	171.6	174.4	46.2	124.3	3	111.3	D26 T27 Y28 M32 A33 E34	D26-R30 PolarHBondContact O-N 3.17Å; D26-R30 VanDerWaalsContact O-N 3.14Å; T27-R30 PolarHBondContact O-N 3.02Å; T27-R30 VanDerWaalsContact O-N 3.12Å; Y28-R30 VanDerWaalsContact C-N 3.32Å; Y28-R30 PolarHBondContact O-N 3.35Å; R30-M32 VanDerWaalsContact C-N 3.28Å; R30-M32 PolarHBondContact O-N 3.47Å; R30-A33 WeakPolarHBondContact O-CB 3.5Å; R30-A33 PolarHBondContact O-N 3.03Å; R30-E34 VanDerWaalsContact CG-OE1 3.29Å; R30-E34 WeakPolarHBondContact CG-OE1 3.45Å; R30-E34 WeakPolarHBondContact O-CG 3.43Å; R30-E34 PolarHBondContact O-N 3.08Å
31	E	98.5	Very high	98.5	Very high	110 Å²	110	109.2 Å²	109.2	51%	0.514	52%	0.516	S	S	.	.	H	α-helix	trans	-60.1	-39.7	178.9	-70.3	176.4	177.2	0	0	111.7	T27 Y28 A33 E34 C35	T27-E31 HydrophobicContact CG2-CG 4.37Å; T27-E31 WeakPolarHBondContact CG2-OE1 3.33Å; T27-E31 WeakPolarHBondContact O-CG 3.33Å; T27-E31 PolarHBondContact O-N 2.98Å; Y28-E31 PolarHBondContact O-N 3.39Å; E31-A33 VanDerWaalsContact C-N 3.34Å; E31-A33 PolarHBondContact O-N 3.01Å; E31-E34 PolarHBondContact O-N 3.39Å; E31-C35 VanDerWaalsContact O-CB 3.29Å; E31-C35 WeakPolarHBondContact O-CB 3.31Å; E31-C35 PolarHBondContact O-N 3.34Å
32	M	98.4	Very high	98.5	Very high	105 Å²	105	109 Å²	109	52%	0.517	51%	0.511	S	S	.	.	H	α-helix	trans	-66	-37.1	176	-171.6	62.9	-173.8	0	0	112.1	Y28 R30 K36	Y28-M32 HydrophobicContact CE1-CB 4.49Å; Y28-M32 WeakPolarHBondContact O-CB 3.37Å; Y28-M32 PolarHBondContact O-N 3.22Å; R30-M32 VanDerWaalsContact C-N 3.28Å; R30-M32 PolarHBondContact O-N 3.47Å; M32-K36 WeakPolarHBondContact O-CB 3.38Å; M32-K36 PolarHBondContact O-N 3.32Å
33	A	98.5	Very high	98.5	Very high	44 Å²	44	108 Å²	108	36%	0.364	51%	0.511	S	S	.	.	H	α-helix	trans	-66.9	-43.9	174.9	0	0	0	0	0	111.4	R29 R30 E31 K36 H37	R29-A33 WeakPolarHBondContact O-CB 3.33Å; R29-A33 PolarHBondContact O-N 3.37Å; R29-A33 VanDerWaalsContact O-N 3.12Å; R30-A33 WeakPolarHBondContact O-CB 3.5Å; R30-A33 PolarHBondContact O-N 3.03Å; E31-A33 VanDerWaalsContact C-N 3.34Å; E31-A33 PolarHBondContact O-N 3.01Å; A33-K36 PolarHBondContact O-N 3.47Å; A33-H37 PolarHBondContact O-CD2 2.99Å; A33-H37 PolarHBondContact O-N 3.37Å
34	E	98.5	Very high	98.5	Very high	113 Å²	113	103.3 Å²	103.3	53%	0.528	50%	0.503	S	S	.	.	H	α-helix	trans	-61.8	-45.1	175.6	-71.1	171.3	-166.2	0	0	111.5	R30 E31 K36 H37 F38	R30-E34 VanDerWaalsContact CG-OE1 3.29Å; R30-E34 WeakPolarHBondContact CG-OE1 3.45Å; R30-E34 WeakPolarHBondContact O-CG 3.43Å; R30-E34 PolarHBondContact O-N 3.08Å; E31-E34 PolarHBondContact O-N 3.39Å; E34-K36 PolarHBondContact O-N 3.24Å; E34-H37 PolarHBondContact O-N 3.17Å; E34-F38 WeakPolarHBondContact O-CB 3.3Å; E34-F38 PolarHBondContact O-N 3.45Å
35	C	98.5	Very high	98.5	Very high	69 Å²	69	102.2 Å²	102.2	47%	0.466	49%	0.494	S	S	.	.	H	α-helix	trans	-59.8	-45.7	174.7	-178.1	0	0	0	0	111.5	E31 H37 F38 V39	E31-C35 VanDerWaalsContact O-CB 3.29Å; E31-C35 WeakPolarHBondContact O-CB 3.31Å; E31-C35 PolarHBondContact O-N 3.34Å; C35-H37 VanDerWaalsContact C-N 3.34Å; C35-H37 PolarHBondContact O-N 2.92Å; C35-F38 PolarHBondContact O-N 3.42Å; C35-V39 WeakPolarHBondContact O-CG2 3.42Å; C35-V39 PolarHBondContact O-N 2.99Å
36	K	98.5	Very high	98.5	Very high	134 Å²	134	101.4 Å²	101.4	58%	0.583	50%	0.495	S	S	*	.	H	α-helix	trans	-58.8	-45.9	175.4	-178.8	-176.9	176	-176.4	0	111.4	M32 A33 E34 V39 I40	M32-K36 WeakPolarHBondContact O-CB 3.38Å; M32-K36 PolarHBondContact O-N 3.32Å; A33-K36 PolarHBondContact O-N 3.47Å; E34-K36 PolarHBondContact O-N 3.24Å; K36-V39 PolarHBondContact O-N 2.97Å; K36-I40 HydrophobicContact CG-CD1 3.9Å; K36-I40 VanDerWaalsContact O-CG1 3.29Å; K36-I40 WeakPolarHBondContact O-CG1 3.45Å; K36-I40 PolarHBondContact O-N 3.19Å
37	H	98.5	Very high	98.5	Very high	131 Å²	131	103 Å²	103	61%	0.606	50%	0.498	S	S	*	.	H	α-helix	trans	-62.6	-44.5	177.9	-79.1	-59.3	0	0	0	112	A33 E34 C35 V39 I40 D41	A33-H37 PolarHBondContact O-CD2 2.99Å; A33-H37 PolarHBondContact O-N 3.37Å; E34-H37 PolarHBondContact O-N 3.17Å; C35-H37 VanDerWaalsContact C-N 3.34Å; C35-H37 PolarHBondContact O-N 2.92Å; H37-V39 PolarHBondContact O-N 3.31Å; H37-I40 PolarHBondContact O-N 3.05Å; H37-D41 WeakPolarHBondContact O-CB 3.29Å; H37-D41 PolarHBondContact O-N 3.29Å
38	F	98.6	Very high	98.5	Very high	123 Å²	123	103.1 Å²	103.1	54%	0.539	50%	0.504	S	S	.	.	H	α-helix	trans	-58.7	-46.9	175.8	175.4	-96	0	0	0	111.9	E34 C35 I40 D41 K42	E34-F38 WeakPolarHBondContact O-CB 3.3Å; E34-F38 PolarHBondContact O-N 3.45Å; C35-F38 PolarHBondContact O-N 3.42Å; F38-I40 PolarHBondContact O-N 2.93Å; F38-D41 PolarHBondContact O-N 3.5Å; F38-K42 HydrophobicContact CD1-CG 4.29Å; F38-K42 HydrophobicContact CD2-CG 4.45Å; F38-K42 HydrophobicContact CE1-CG 3.87Å; F38-K42 HydrophobicContact CE2-CD 4.35Å; F38-K42 HydrophobicContact CE2-CG 4.06Å; F38-K42 HydrophobicContact CZ-CD 4.24Å; F38-K42 HydrophobicContact CZ-CG 3.75Å; F38-K42 WeakPolarHBondContact O-CG 3.36Å; F38-K42 PolarHBondContact O-N 2.97Å
39	V	98.6	Very high	98.5	Very high	76 Å²	76	99.6 Å²	99.6	46%	0.461	50%	0.495	S	S	.	.	H	α-helix	trans	-62.7	-43.9	178.8	171.6	0	0	0	0	111	C35 K36 H37 D41 K42 V43	C35-V39 WeakPolarHBondContact O-CG2 3.42Å; C35-V39 PolarHBondContact O-N 2.99Å; K36-V39 PolarHBondContact O-N 2.97Å; H37-V39 PolarHBondContact O-N 3.31Å; V39-D41 VanDerWaalsContact C-N 3.34Å; V39-D41 PolarHBondContact O-N 3.02Å; V39-K42 PolarHBondContact O-N 2.98Å; V39-V43 HydrophobicContact CG1-CG2 4.28Å; V39-V43 WeakPolarHBondContact O-CB 3.41Å; V39-V43 VanDerWaalsContact O-CG2 3.27Å; V39-V43 WeakPolarHBondContact O-CG2 3.45Å; V39-V43 PolarHBondContact O-N 2.95Å
40	I	98.6	Very high	98.5	Very high	85 Å²	85	94.6 Å²	94.6	44%	0.436	48%	0.482	S	S	.	.	H	α-helix	trans	-60.5	-44.9	177.4	-71.3	169.2	0	0	0	111	K36 H37 F38 V43 S44	K36-I40 HydrophobicContact CG-CD1 3.9Å; K36-I40 VanDerWaalsContact O-CG1 3.29Å; K36-I40 WeakPolarHBondContact O-CG1 3.45Å; K36-I40 PolarHBondContact O-N 3.19Å; H37-I40 PolarHBondContact O-N 3.05Å; F38-I40 PolarHBondContact O-N 2.93Å; I40-V43 PolarHBondContact O-N 3.49Å; I40-S44 WeakPolarHBondContact O-CB 3.42Å; I40-S44 PolarHBondContact O-N 3.45Å; I40-S44 PolarHBondContact O-OG 3.45Å
41	D	98.6	Very high	98.5	Very high	88 Å²	88	94.6 Å²	94.6	47%	0.471	49%	0.488	S	S	.	.	H	α-helix	trans	-61.4	-44.5	178.1	-178.5	68.4	0	0	0	112.2	H37 F38 V39 S44 T45	H37-D41 WeakPolarHBondContact O-CB 3.29Å; H37-D41 PolarHBondContact O-N 3.29Å; F38-D41 PolarHBondContact O-N 3.5Å; V39-D41 VanDerWaalsContact C-N 3.34Å; V39-D41 PolarHBondContact O-N 3.02Å; D41-S44 PolarHBondContact O-N 3.19Å; D41-T45 WeakPolarHBondContact O-CB 3.44Å; D41-T45 PolarHBondContact O-N 3.28Å; D41-T45 PolarHBondContact O-OG1 3.25Å
42	K	98.4	Very high	98.5	Very high	109 Å²	109	95.4 Å²	95.4	47%	0.474	49%	0.493	S	S	.	.	H	α-helix	trans	-65.9	-41.2	177.3	-67.6	-55.1	176.4	-159.4	0	113	F38 V39 S44 F46	F38-K42 HydrophobicContact CD1-CG 4.29Å; F38-K42 HydrophobicContact CD2-CG 4.45Å; F38-K42 HydrophobicContact CE1-CG 3.87Å; F38-K42 HydrophobicContact CE2-CD 4.35Å; F38-K42 HydrophobicContact CE2-CG 4.06Å; F38-K42 HydrophobicContact CZ-CD 4.24Å; F38-K42 HydrophobicContact CZ-CG 3.75Å; F38-K42 WeakPolarHBondContact O-CG 3.36Å; F38-K42 PolarHBondContact O-N 2.97Å; V39-K42 PolarHBondContact O-N 2.98Å; K42-S44 VanDerWaalsContact C-N 3.35Å; K42-F46 WeakPolarHBondContact O-CB 3.35Å; K42-F46 PolarHBondContact O-N 3.07Å
43	V	98.6	Very high	98.5	Very high	68 Å²	68	99.2 Å²	99.2	41%	0.412	50%	0.502	S	S	.	.	H	α-helix	trans	-65.2	-41.6	175.9	170.2	0	0	0	0	110.7	V39 I40 F46 F47	V39-V43 HydrophobicContact CG1-CG2 4.28Å; V39-V43 WeakPolarHBondContact O-CB 3.41Å; V39-V43 VanDerWaalsContact O-CG2 3.27Å; V39-V43 WeakPolarHBondContact O-CG2 3.45Å; V39-V43 PolarHBondContact O-N 2.95Å; I40-V43 PolarHBondContact O-N 3.49Å; V43-F46 PolarHBondContact O-N 3.44Å; V43-F47 HydrophobicContact CG1-CD2 3.64Å; V43-F47 HydrophobicContact CG1-CE2 3.53Å; V43-F47 VanDerWaalsContact O-CD2 3.23Å; V43-F47 WeakPolarHBondContact O-CD2 3.44Å; V43-F47 PolarHBondContact O-N 3.19Å
44	S	98.4	Very high	98.5	Very high	67 Å²	67	100.8 Å²	100.8	47%	0.469	51%	0.511	S	S	.	.	H	α-helix	trans	-65.4	-44.5	179.3	-55.8	0	0	0	0	111.3	I40 D41 K42 F46 F47 A48	I40-S44 WeakPolarHBondContact O-CB 3.42Å; I40-S44 PolarHBondContact O-N 3.45Å; I40-S44 PolarHBondContact O-OG 3.45Å; D41-S44 PolarHBondContact O-N 3.19Å; K42-S44 VanDerWaalsContact C-N 3.35Å; S44-F46 VanDerWaalsContact C-N 3.35Å; S44-F46 PolarHBondContact O-N 2.82Å; S44-F47 PolarHBondContact O-N 2.87Å; S44-A48 PolarHBondContact O-N 3.16Å
45	T	98.4	Very high	98.5	Very high	64 Å²	64	100.9 Å²	100.9	39%	0.393	51%	0.511	S	S	.	.	H	α-helix	trans	-59.9	-45.2	174.2	-56.5	0	0	0	0	111.3	D41 F47 A48 D49	D41-T45 WeakPolarHBondContact O-CB 3.44Å; D41-T45 PolarHBondContact O-N 3.28Å; D41-T45 PolarHBondContact O-OG1 3.25Å; T45-F47 VanDerWaalsContact C-N 3.35Å; T45-F47 PolarHBondContact O-N 3.36Å; T45-A48 PolarHBondContact O-N 3.08Å; T45-D49 PolarHBondContact O-N 3.48Å
46	F	98.5	Very high	98.5	Very high	124 Å²	124	104.8 Å²	104.8	54%	0.544	52%	0.52	S	S	.	.	H	α-helix	trans	-59.5	-43.9	178	173.1	-96.2	0	0	0	112.4	K42 V43 S44 D49 L50	K42-F46 WeakPolarHBondContact O-CB 3.35Å; K42-F46 PolarHBondContact O-N 3.07Å; V43-F46 PolarHBondContact O-N 3.44Å; S44-F46 VanDerWaalsContact C-N 3.35Å; S44-F46 PolarHBondContact O-N 2.82Å; F46-D49 PolarHBondContact O-N 2.91Å; F46-L50 WeakPolarHBondContact O-CB 3.34Å; F46-L50 PolarHBondContact O-N 2.88Å
47	F	98.5	Very high	98.4	Very high	121 Å²	121	103.4 Å²	103.4	53%	0.531	52%	0.516	S	S	.	.	H	α-helix	trans	-69.3	-37.5	178	-80.4	-62.4	0	0	0	112.7	V43 S44 T45 D49 L50 E51	V43-F47 HydrophobicContact CG1-CD2 3.64Å; V43-F47 HydrophobicContact CG1-CE2 3.53Å; V43-F47 VanDerWaalsContact O-CD2 3.23Å; V43-F47 WeakPolarHBondContact O-CD2 3.44Å; V43-F47 PolarHBondContact O-N 3.19Å; S44-F47 PolarHBondContact O-N 2.87Å; T45-F47 VanDerWaalsContact C-N 3.35Å; T45-F47 PolarHBondContact O-N 3.36Å; F47-D49 VanDerWaalsContact C-N 3.35Å; F47-L50 HydrophobicContact CD1-CD2 4.35Å; F47-L50 PolarHBondContact O-N 2.85Å; F47-E51 WeakPolarHBondContact O-CB 3.43Å; F47-E51 PolarHBondContact O-N 3.21Å
48	A	98.5	Very high	98.4	Very high	51 Å²	51	102.5 Å²	102.5	42%	0.421	51%	0.512	S	S	.	.	H	α-helix	trans	-62.3	-42	174.1	0	0	0	0	0	112	S44 T45 L50 E51 M52	S44-A48 PolarHBondContact O-N 3.16Å; T45-A48 PolarHBondContact O-N 3.08Å; A48-L50 VanDerWaalsContact C-N 3.33Å; A48-L50 PolarHBondContact O-N 3.22Å; A48-E51 PolarHBondContact O-N 3.16Å; A48-M52 WeakPolarHBondContact O-CB 3.27Å; A48-M52 PolarHBondContact O-N 3.1Å
49	D	98.4	Very high	98.4	Very high	78 Å²	78	101.4 Å²	101.4	42%	0.417	51%	0.512	S	S	.	.	H	α-helix	trans	-64.3	-38	174.8	-77.2	-10.7	0	0	0	111.9	T45 F46 F47 R53	T45-D49 PolarHBondContact O-N 3.48Å; F46-D49 PolarHBondContact O-N 2.91Å; F47-D49 VanDerWaalsContact C-N 3.35Å; D49-R53 VanDerWaalsContact O-CG 3.29Å; D49-R53 WeakPolarHBondContact O-CG 3.44Å; D49-R53 PolarHBondContact O-N 3.42Å; D49-R53 VanDerWaalsContact O-N 3.08Å
50	L	98.3	Very high	98.4	Very high	88 Å²	88	101.1 Å²	101.1	46%	0.461	51%	0.51	S	S	.	.	H	α-helix	trans	-67.2	-44.1	177.3	-171.9	68.5	0	0	0	111.5	F46 F47 A48 R53 S54	F46-L50 WeakPolarHBondContact O-CB 3.34Å; F46-L50 PolarHBondContact O-N 2.88Å; F47-L50 HydrophobicContact CD1-CD2 4.35Å; F47-L50 PolarHBondContact O-N 2.85Å; A48-L50 VanDerWaalsContact C-N 3.33Å; A48-L50 PolarHBondContact O-N 3.22Å; L50-R53 PolarHBondContact O-N 2.98Å; L50-S54 PolarHBondContact O-N 3.48Å
51	E	98.5	Very high	98.4	Very high	139 Å²	139	100.4 Å²	100.4	65%	0.65	51%	0.507	S	S	*	.	H	α-helix	trans	-61.2	-45.4	176.3	-175	172.6	-164.8	0	0	111.1	F47 A48 R53 S54 Q55	F47-E51 WeakPolarHBondContact O-CB 3.43Å; F47-E51 PolarHBondContact O-N 3.21Å; A48-E51 PolarHBondContact O-N 3.16Å; E51-R53 VanDerWaalsContact C-N 3.31Å; E51-R53 PolarHBondContact O-N 3.37Å; E51-S54 WeakPolarHBondContact O-CB 3.23Å; E51-S54 PolarHBondContact O-N 3.46Å; E51-S54 VanDerWaalsContact O-N 3.14Å; E51-Q55 PolarHBondContact O-N 3.02Å
52	M	98.4	Very high	98.4	Very high	126 Å²	126	99.9 Å²	99.9	62%	0.621	50%	0.504	S	S	*	.	H	α-helix	trans	-59.5	-41	175.7	-171.9	-169.6	-57.7	0	0	112.2	A48 K56	A48-M52 WeakPolarHBondContact O-CB 3.27Å; A48-M52 PolarHBondContact O-N 3.1Å; M52-K56 WeakPolarHBondContact O-CB 3.36Å; M52-K56 PolarHBondContact O-N 3.5Å
53	R	98.3	Very high	98.4	Very high	185 Å²	185	96.6 Å²	96.6	70%	0.698	50%	0.501	S	S	*	.	H	α-helix	trans	-66.5	-41.2	175.7	-73	174.6	-173	-161.8	3.6	111.9	D49 L50 E51 K56 Q57	D49-R53 VanDerWaalsContact O-CG 3.29Å; D49-R53 WeakPolarHBondContact O-CG 3.44Å; D49-R53 PolarHBondContact O-N 3.42Å; D49-R53 VanDerWaalsContact O-N 3.08Å; L50-R53 PolarHBondContact O-N 2.98Å; E51-R53 VanDerWaalsContact C-N 3.31Å; E51-R53 PolarHBondContact O-N 3.37Å; R53-K56 PolarHBondContact O-N 2.93Å; R53-Q57 PolarHBondContact O-N 3.38Å
54	S	98.3	Very high	98.4	Very high	78 Å²	78	97.9 Å²	97.9	55%	0.545	51%	0.505	S	S	.	.	H	α-helix	trans	-60.7	-50.1	176.8	-169	0	0	0	0	111	L50 E51 K56 Q57 E58	L50-S54 PolarHBondContact O-N 3.48Å; E51-S54 WeakPolarHBondContact O-CB 3.23Å; E51-S54 PolarHBondContact O-N 3.46Å; E51-S54 VanDerWaalsContact O-N 3.14Å; S54-K56 VanDerWaalsContact C-N 3.29Å; S54-K56 PolarHBondContact O-N 3.38Å; S54-Q57 PolarHBondContact O-N 3.02Å; S54-Q57 VanDerWaalsContact O-N 3.1Å; S54-E58 PolarHBondContact O-N 3.3Å
55	Q	98.4	Very high	98.4	Very high	114 Å²	114	99 Å²	99	53%	0.533	50%	0.504	S	S	.	.	H	α-helix	trans	-63.6	-36.7	179.3	-169.9	174.9	21.8	0	0	112	E51 Q57 E58 N59	E51-Q55 PolarHBondContact O-N 3.02Å; Q55-Q57 VanDerWaalsContact C-N 3.33Å; Q55-Q57 PolarHBondContact O-N 3.19Å; Q55-E58 PolarHBondContact O-N 3.43Å; Q55-N59 VanDerWaalsContact O-CG 3.23Å; Q55-N59 PolarHBondContact O-N 2.91Å; Q55-N59 PolarHBondContact O-ND2 3.14Å
56	K	98.3	Very high	98.4	Very high	152 Å²	152	102.3 Å²	102.3	66%	0.661	52%	0.515	S	S	*	.	H	α-helix	trans	-63.2	-40.5	174.1	-172.9	179.4	179.8	-178	0	111.8	M52 R53 S54 V60	M52-K56 WeakPolarHBondContact O-CB 3.36Å; M52-K56 PolarHBondContact O-N 3.5Å; R53-K56 PolarHBondContact O-N 2.93Å; S54-K56 VanDerWaalsContact C-N 3.29Å; S54-K56 PolarHBondContact O-N 3.38Å; K56-V60 WeakPolarHBondContact O-CG2 3.29Å; K56-V60 PolarHBondContact O-N 3.48Å
57	Q	98.2	Very high	98.4	Very high	104 Å²	104	98.4 Å²	98.4	49%	0.486	51%	0.51	S	S	.	.	H	α-helix	trans	-67.7	-44.4	177.4	-173.8	60	46.3	0	0	111.2	R53 S54 Q55 N59 V60 D61	R53-Q57 PolarHBondContact O-N 3.38Å; S54-Q57 PolarHBondContact O-N 3.02Å; S54-Q57 VanDerWaalsContact O-N 3.1Å; Q55-Q57 VanDerWaalsContact C-N 3.33Å; Q55-Q57 PolarHBondContact O-N 3.19Å; Q57-N59 VanDerWaalsContact C-N 3.32Å; Q57-N59 PolarHBondContact O-N 3.02Å; Q57-V60 WeakPolarHBondContact O-CB 3.35Å; Q57-V60 PolarHBondContact O-N 3.01Å; Q57-D61 PolarHBondContact NE2-OD1 2.88Å; Q57-D61 PolarHBondContact O-N 3Å
58	E	98.4	Very high	98.4	Very high	113 Å²	113	97.4 Å²	97.4	53%	0.528	51%	0.51	S	S	.	.	H	α-helix	trans	-55.9	-46.2	175.9	-174	175.8	-166.4	0	0	111.4	S54 Q55 V60 D61 D62	S54-E58 PolarHBondContact O-N 3.3Å; Q55-E58 PolarHBondContact O-N 3.43Å; E58-V60 VanDerWaalsContact C-N 3.28Å; E58-V60 PolarHBondContact O-N 3.26Å; E58-D61 PolarHBondContact O-N 3.08Å; E58-D62 WeakPolarHBondContact O-CB 3.29Å; E58-D62 PolarHBondContact O-N 2.98Å
59	N	98.2	Very high	98.4	Very high	100 Å²	100	99.2 Å²	99.2	54%	0.535	51%	0.511	S	S	.	.	H	α-helix	trans	-62.4	-32.9	176	-70.2	-28.8	0	0	0	113.5	Q55 Q57 G63	Q55-N59 VanDerWaalsContact O-CG 3.23Å; Q55-N59 PolarHBondContact O-N 2.91Å; Q55-N59 PolarHBondContact O-ND2 3.14Å; Q57-N59 VanDerWaalsContact C-N 3.32Å; Q57-N59 PolarHBondContact O-N 3.02Å; N59-G63 PolarHBondContact O-N 3.01Å; N59-G63 VanDerWaalsContact O-N 3.16Å
60	V	98.3	Very high	98.4	Very high	70 Å²	70	100 Å²	100	42%	0.424	52%	0.519	S	S	.	.	H	α-helix	trans	-70.3	-45.5	175.4	168.4	0	0	0	0	110	K56 Q57 E58 G63 I64	K56-V60 WeakPolarHBondContact O-CG2 3.29Å; K56-V60 PolarHBondContact O-N 3.48Å; Q57-V60 WeakPolarHBondContact O-CB 3.35Å; Q57-V60 PolarHBondContact O-N 3.01Å; E58-V60 VanDerWaalsContact C-N 3.28Å; E58-V60 PolarHBondContact O-N 3.26Å; V60-G63 PolarHBondContact O-N 3.42Å; V60-I64 HydrophobicContact CG1-CD1 3.99Å; V60-I64 WeakPolarHBondContact O-CG1 3.45Å; V60-I64 PolarHBondContact O-N 3.33Å
61	D	98.5	Very high	98.4	Very high	70 Å²	70	100.8 Å²	100.8	37%	0.374	52%	0.52	S	S	.	.	H	α-helix	trans	-63.8	-42.9	180	-64.8	-15.4	0	0	0	110.8	Q57 E58 G63 I64 I65	Q57-D61 PolarHBondContact NE2-OD1 2.88Å; Q57-D61 PolarHBondContact O-N 3Å; E58-D61 PolarHBondContact O-N 3.08Å; D61-G63 VanDerWaalsContact C-N 3.32Å; D61-G63 PolarHBondContact O-N 2.89Å; D61-I64 WeakPolarHBondContact O-CB 3.44Å; D61-I64 PolarHBondContact O-N 3.35Å; D61-I64 VanDerWaalsContact O-N 3.16Å; D61-I65 VanDerWaalsContact O-CG1 3.31Å; D61-I65 WeakPolarHBondContact O-CG1 3.33Å; D61-I65 PolarHBondContact O-N 3.48Å
62	D	98.5	Very high	98.4	Very high	77 Å²	77	98.9 Å²	98.9	41%	0.412	51%	0.514	S	S	.	.	H	α-helix	trans	-59.1	-42.4	173.3	-81.7	-8.9	0	0	0	111.9	E58 I64 I65 Q66	E58-D62 WeakPolarHBondContact O-CB 3.29Å; E58-D62 PolarHBondContact O-N 2.98Å; D62-I64 VanDerWaalsContact C-N 3.34Å; D62-I64 PolarHBondContact O-N 3.23Å; D62-I65 PolarHBondContact O-N 2.96Å; D62-Q66 WeakPolarHBondContact O-CB 3.41Å; D62-Q66 VanDerWaalsContact O-CG 3.3Å; D62-Q66 WeakPolarHBondContact O-CG 3.44Å; D62-Q66 PolarHBondContact O-N 2.98Å
63	G	98.4	Very high	98.4	Very high	39 Å²	39	98.8 Å²	98.8	40%	0.402	51%	0.513	S	S	.	.	H	α-helix	trans	-62.2	-40.1	175.4	0	0	0	0	0	112.8	N59 V60 D61 G67	N59-G63 PolarHBondContact O-N 3.01Å; N59-G63 VanDerWaalsContact O-N 3.16Å; V60-G63 PolarHBondContact O-N 3.42Å; D61-G63 VanDerWaalsContact C-N 3.32Å; D61-G63 PolarHBondContact O-N 2.89Å; G63-G67 PolarHBondContact O-N 3.46Å; G63-G67 VanDerWaalsContact O-N 3.07Å
64	I	98.4	Very high	98.4	Very high	96 Å²	96	95.6 Å²	95.6	49%	0.492	51%	0.506	S	S	.	.	H	α-helix	trans	-65.7	-47.6	175.6	-67.4	165.6	0	0	0	110.3	V60 D61 D62 Q66 G67 L68	V60-I64 HydrophobicContact CG1-CD1 3.99Å; V60-I64 WeakPolarHBondContact O-CG1 3.45Å; V60-I64 PolarHBondContact O-N 3.33Å; D61-I64 WeakPolarHBondContact O-CB 3.44Å; D61-I64 PolarHBondContact O-N 3.35Å; D61-I64 VanDerWaalsContact O-N 3.16Å; D62-I64 VanDerWaalsContact C-N 3.34Å; D62-I64 PolarHBondContact O-N 3.23Å; I64-Q66 VanDerWaalsContact C-N 3.34Å; I64-Q66 PolarHBondContact O-N 3.46Å; I64-G67 PolarHBondContact O-N 2.95Å; I64-L68 HydrophobicContact CG2-CD1 4.1Å; I64-L68 HydrophobicContact CG2-CG 4.5Å; I64-L68 WeakPolarHBondContact O-CG 3.48Å; I64-L68 PolarHBondContact O-N 2.92Å
65	I	98.4	Very high	98.4	Very high	91 Å²	91	96.9 Å²	96.9	47%	0.467	50%	0.504	S	S	.	.	H	α-helix	trans	-60.1	-45.3	179.4	-70.2	166.6	0	0	0	110.5	D61 D62 G67 L68 I69	D61-I65 VanDerWaalsContact O-CG1 3.31Å; D61-I65 WeakPolarHBondContact O-CG1 3.33Å; D61-I65 PolarHBondContact O-N 3.48Å; D62-I65 PolarHBondContact O-N 2.96Å; I65-G67 VanDerWaalsContact C-N 3.33Å; I65-G67 PolarHBondContact O-N 3.29Å; I65-L68 PolarHBondContact O-N 3.35Å; I65-I69 HydrophobicContact CG2-CD1 3.84Å; I65-I69 HydrophobicContact CG2-CG1 4.44Å; I65-I69 WeakPolarHBondContact O-CG1 3.21Å; I65-I69 PolarHBondContact O-N 2.97Å
66	Q	98.3	Very high	98.4	Very high	132 Å²	132	95.8 Å²	95.8	62%	0.617	50%	0.501	S	S	*	.	H	α-helix	trans	-59.5	-43.5	176.1	-76.2	178.2	2.7	0	0	111.9	D62 I64 L68 I69 V70	D62-Q66 WeakPolarHBondContact O-CB 3.41Å; D62-Q66 VanDerWaalsContact O-CG 3.3Å; D62-Q66 WeakPolarHBondContact O-CG 3.44Å; D62-Q66 PolarHBondContact O-N 2.98Å; I64-Q66 VanDerWaalsContact C-N 3.34Å; I64-Q66 PolarHBondContact O-N 3.46Å; Q66-L68 PolarHBondContact O-N 3.32Å; Q66-I69 PolarHBondContact O-N 3.31Å; Q66-V70 WeakPolarHBondContact O-CG2 3.47Å; Q66-V70 PolarHBondContact O-N 3.34Å; Q66-V70 VanDerWaalsContact O-N 3.08Å
67	G	98.4	Very high	98.4	Very high	42 Å²	42	94.9 Å²	94.9	43%	0.433	50%	0.499	S	S	.	.	H	α-helix	trans	-58.7	-46.2	175.1	0	0	0	0	0	112.7	G63 I64 I65 I69 V70 E71	G63-G67 PolarHBondContact O-N 3.46Å; G63-G67 VanDerWaalsContact O-N 3.07Å; I64-G67 PolarHBondContact O-N 2.95Å; I65-G67 VanDerWaalsContact C-N 3.33Å; I65-G67 PolarHBondContact O-N 3.29Å; G67-I69 VanDerWaalsContact C-N 3.34Å; G67-I69 PolarHBondContact O-N 2.9Å; G67-V70 PolarHBondContact O-N 2.9Å; G67-E71 PolarHBondContact O-N 2.87Å
68	L	98.4	Very high	98.4	Very high	100 Å²	100	94.1 Å²	94.1	52%	0.524	50%	0.498	S	S	.	.	H	α-helix	trans	-64.5	-36.3	177.7	-69.4	172.8	0	0	0	112.7	I64 I65 Q66 E71 L72	I64-L68 HydrophobicContact CG2-CD1 4.1Å; I64-L68 HydrophobicContact CG2-CG 4.5Å; I64-L68 WeakPolarHBondContact O-CG 3.48Å; I64-L68 PolarHBondContact O-N 2.92Å; I65-L68 PolarHBondContact O-N 3.35Å; Q66-L68 PolarHBondContact O-N 3.32Å; L68-E71 PolarHBondContact O-N 3.4Å; L68-L72 WeakPolarHBondContact O-CB 3.4Å; L68-L72 PolarHBondContact O-N 3.47Å
69	I	98.4	Very high	98.4	Very high	90 Å²	90	92.8 Å²	92.8	46%	0.462	49%	0.494	S	S	.	.	H	α-helix	trans	-64.5	-43.2	175.9	-72	168.6	0	0	0	110.5	I65 Q66 G67 L72 M73	I65-I69 HydrophobicContact CG2-CD1 3.84Å; I65-I69 HydrophobicContact CG2-CG1 4.44Å; I65-I69 WeakPolarHBondContact O-CG1 3.21Å; I65-I69 PolarHBondContact O-N 2.97Å; Q66-I69 PolarHBondContact O-N 3.31Å; G67-I69 VanDerWaalsContact C-N 3.34Å; G67-I69 PolarHBondContact O-N 2.9Å; I69-L72 PolarHBondContact O-N 3Å; I69-M73 HydrophobicContact CG2-SD 4.23Å; I69-M73 WeakPolarHBondContact O-CG 3.29Å; I69-M73 PolarHBondContact O-N 3.47Å
70	V	98.4	Very high	98.4	Very high	94 Å²	94	93.2 Å²	93.2	57%	0.57	50%	0.496	S	S	*	.	H	α-helix	trans	-62.8	-46.4	177.4	172.2	0	0	0	0	110.9	Q66 G67 L72 M73 E74	Q66-V70 WeakPolarHBondContact O-CG2 3.47Å; Q66-V70 PolarHBondContact O-N 3.34Å; Q66-V70 VanDerWaalsContact O-N 3.08Å; G67-V70 PolarHBondContact O-N 2.9Å; V70-L72 VanDerWaalsContact C-N 3.31Å; V70-L72 PolarHBondContact O-N 3.31Å; V70-M73 PolarHBondContact O-N 3.4Å; V70-E74 PolarHBondContact O-N 2.91Å
71	E	98.4	Very high	98.3	Very high	104 Å²	104	93.2 Å²	93.2	49%	0.486	50%	0.496	S	S	.	.	H	α-helix	trans	-60.2	-42.1	176.6	-173.9	-179.9	176.1	0	0	111.7	G67 L68 M73 E74 Q75	G67-E71 PolarHBondContact O-N 2.87Å; L68-E71 PolarHBondContact O-N 3.4Å; E71-M73 VanDerWaalsContact C-N 3.35Å; E71-M73 PolarHBondContact O-N 2.72Å; E71-E74 PolarHBondContact O-N 2.93Å; E71-Q75 WeakPolarHBondContact O-CG 3.48Å; E71-Q75 PolarHBondContact O-N 3.31Å
72	L	98.5	Very high	98.3	Very high	99 Å²	99	94.5 Å²	94.5	52%	0.518	50%	0.503	S	S	.	.	H	α-helix	trans	-62.2	-42	176.1	179.2	62.7	0	0	0	111.8	L68 I69 V70 Q75 L76	L68-L72 WeakPolarHBondContact O-CB 3.4Å; L68-L72 PolarHBondContact O-N 3.47Å; I69-L72 PolarHBondContact O-N 3Å; V70-L72 VanDerWaalsContact C-N 3.31Å; V70-L72 PolarHBondContact O-N 3.31Å; L72-Q75 PolarHBondContact O-N 2.86Å; L72-L76 HydrophobicContact CG-CD1 4.32Å; L72-L76 WeakPolarHBondContact O-CG 3.35Å; L72-L76 PolarHBondContact O-N 2.87Å
73	M	98.1	Very high	98.3	Very high	125 Å²	125	95.5 Å²	95.5	62%	0.616	51%	0.508	S	S	*	.	H	α-helix	trans	-63	-41.9	177.2	-73.2	179.1	65.3	0	0	111.8	I69 V70 E71 Q75 L76 E77	I69-M73 HydrophobicContact CG2-SD 4.23Å; I69-M73 WeakPolarHBondContact O-CG 3.29Å; I69-M73 PolarHBondContact O-N 3.47Å; V70-M73 PolarHBondContact O-N 3.4Å; E71-M73 VanDerWaalsContact C-N 3.35Å; E71-M73 PolarHBondContact O-N 2.72Å; M73-Q75 VanDerWaalsContact C-N 3.35Å; M73-Q75 PolarHBondContact O-N 2.95Å; M73-L76 PolarHBondContact O-N 3.44Å; M73-E77 PolarHBondContact O-N 3.43Å
74	E	98.4	Very high	98.3	Very high	118 Å²	118	97 Å²	97	55%	0.551	51%	0.512	S	S	*	.	H	α-helix	trans	-62.5	-41.7	175.3	-175.7	179.4	-179.8	0	0	111.6	V70 E71 L76 E77 N78	V70-E74 PolarHBondContact O-N 2.91Å; E71-E74 PolarHBondContact O-N 2.93Å; E74-L76 VanDerWaalsContact C-N 3.34Å; E74-L76 PolarHBondContact O-N 3.29Å; E74-E77 PolarHBondContact O-N 2.84Å; E74-N78 PolarHBondContact O-N 3.24Å; E74-N78 PolarHBondContact O-ND2 3.48Å; E74-N78 VanDerWaalsContact O-ND2 3.08Å
75	Q	98.4	Very high	98.3	Very high	105 Å²	105	97.4 Å²	97.4	49%	0.491	51%	0.512	S	S	.	.	H	α-helix	trans	-63.2	-39.6	174.7	-71.7	-170.3	1.3	0	0	112.5	E71 L72 M73 N78 I79	E71-Q75 WeakPolarHBondContact O-CG 3.48Å; E71-Q75 PolarHBondContact O-N 3.31Å; L72-Q75 PolarHBondContact O-N 2.86Å; M73-Q75 VanDerWaalsContact C-N 3.35Å; M73-Q75 PolarHBondContact O-N 2.95Å; Q75-N78 PolarHBondContact O-N 3.47Å; Q75-I79 WeakPolarHBondContact O-CG1 3.27Å; Q75-I79 PolarHBondContact O-N 3.42Å
76	L	98.5	Very high	98.3	Very high	91 Å²	91	98.4 Å²	98.4	48%	0.476	52%	0.517	S	S	.	.	H	α-helix	trans	-65.4	-41.5	176.5	-71.9	171.7	0	0	0	111.9	L72 M73 E74 N78 I79 D80	L72-L76 HydrophobicContact CG-CD1 4.32Å; L72-L76 WeakPolarHBondContact O-CG 3.35Å; L72-L76 PolarHBondContact O-N 2.87Å; M73-L76 PolarHBondContact O-N 3.44Å; E74-L76 VanDerWaalsContact C-N 3.34Å; E74-L76 PolarHBondContact O-N 3.29Å; L76-N78 VanDerWaalsContact C-N 3.32Å; L76-N78 PolarHBondContact O-N 3.12Å; L76-I79 WeakPolarHBondContact O-CB 3.47Å; L76-I79 PolarHBondContact O-N 3.07Å; L76-D80 PolarHBondContact O-N 2.93Å
77	E	98.3	Very high	98.2	Very high	133 Å²	133	96.6 Å²	96.6	62%	0.621	51%	0.508	S	S	*	.	H	α-helix	trans	-62.6	-39.5	175.4	-175.1	173.9	-170.1	0	0	112.1	M73 E74 D80 T81	M73-E77 PolarHBondContact O-N 3.43Å; E74-E77 PolarHBondContact O-N 2.84Å; E77-D80 PolarHBondContact O-N 2.92Å; E77-T81 PolarHBondContact O-N 3.08Å; E77-T81 PolarHBondContact O-OG1 3.45Å
78	N	98.2	Very high	98.2	Very high	87 Å²	87	100.5 Å²	100.5	47%	0.465	52%	0.517	S	S	.	.	H	α-helix	trans	-63.4	-41.4	173.3	-74.6	-40.7	0	0	0	111.8	E74 Q75 L76 T81 L82	E74-N78 PolarHBondContact O-N 3.24Å; E74-N78 PolarHBondContact O-ND2 3.48Å; E74-N78 VanDerWaalsContact O-ND2 3.08Å; Q75-N78 PolarHBondContact O-N 3.47Å; L76-N78 VanDerWaalsContact C-N 3.32Å; L76-N78 PolarHBondContact O-N 3.12Å; N78-T81 PolarHBondContact O-N 2.91Å; N78-L82 WeakPolarHBondContact O-CG 3.42Å; N78-L82 PolarHBondContact O-N 2.91Å
79	I	98.3	Very high	98.1	Very high	85 Å²	85	99.5 Å²	99.5	44%	0.436	52%	0.517	S	S	.	.	H	α-helix	trans	-62.1	-45.7	175	-71.7	165.7	0	0	0	110.7	Q75 L76 T81 L82 L83	Q75-I79 WeakPolarHBondContact O-CG1 3.27Å; Q75-I79 PolarHBondContact O-N 3.42Å; L76-I79 WeakPolarHBondContact O-CB 3.47Å; L76-I79 PolarHBondContact O-N 3.07Å; I79-T81 VanDerWaalsContact C-N 3.29Å; I79-T81 PolarHBondContact O-N 3.34Å; I79-L82 PolarHBondContact O-N 3.36Å; I79-L83 HydrophobicContact CG2-CD1 4.01Å; I79-L83 HydrophobicContact CG2-CG 4.33Å; I79-L83 WeakPolarHBondContact O-CG 3.4Å; I79-L83 PolarHBondContact O-N 3.27Å
80	D	98	Very high	98.1	Very high	110 Å²	110	101.6 Å²	101.6	59%	0.588	52%	0.519	S	S	*	.	H	α-helix	trans	-60.9	-39.3	178.5	-79.4	-17.2	0	0	0	111.8	L76 E77 L83 S84	L76-D80 PolarHBondContact O-N 2.93Å; E77-D80 PolarHBondContact O-N 2.92Å; D80-L83 PolarHBondContact O-N 3.3Å; D80-S84 PolarHBondContact O-N 3.01Å
81	T	98.1	Very high	98.1	Very high	69 Å²	69	100 Å²	100	42%	0.423	51%	0.508	S	S	.	.	H	α-helix	trans	-62.2	-48.4	174.6	-60.1	0	0	0	0	111.5	E77 N78 I79 L83 S84 E85	E77-T81 PolarHBondContact O-N 3.08Å; E77-T81 PolarHBondContact O-OG1 3.45Å; N78-T81 PolarHBondContact O-N 2.91Å; I79-T81 VanDerWaalsContact C-N 3.29Å; I79-T81 PolarHBondContact O-N 3.34Å; T81-L83 VanDerWaalsContact C-N 3.32Å; T81-L83 PolarHBondContact O-N 2.86Å; T81-S84 WeakPolarHBondContact O-CB 3.36Å; T81-S84 PolarHBondContact O-N 3.14Å; T81-S84 VanDerWaalsContact O-N 3.17Å; T81-E85 PolarHBondContact O-N 3.32Å
82	L	98.2	Very high	98	Very high	97 Å²	97	99.2 Å²	99.2	51%	0.508	51%	0.51	S	S	.	.	H	α-helix	trans	-61.8	-39.1	177.1	-71	170.7	0	0	0	112.2	N78 I79 S84 E85 I86	N78-L82 WeakPolarHBondContact O-CG 3.42Å; N78-L82 PolarHBondContact O-N 2.91Å; I79-L82 PolarHBondContact O-N 3.36Å; L82-S84 VanDerWaalsContact C-N 3.32Å; L82-S84 PolarHBondContact O-N 3.4Å; L82-E85 PolarHBondContact O-N 2.88Å; L82-I86 VanDerWaalsContact O-CG1 3.27Å; L82-I86 WeakPolarHBondContact O-CG1 3.32Å; L82-I86 PolarHBondContact O-N 3.41Å
83	L	98.3	Very high	97.9	Very high	99 Å²	99	100.2 Å²	100.2	52%	0.518	52%	0.516	S	S	.	.	H	α-helix	trans	-62.9	-39.9	175.8	-74.9	174.4	0	0	0	111.7	I79 D80 T81 I86 H87	I79-L83 HydrophobicContact CG2-CD1 4.01Å; I79-L83 HydrophobicContact CG2-CG 4.33Å; I79-L83 WeakPolarHBondContact O-CG 3.4Å; I79-L83 PolarHBondContact O-N 3.27Å; D80-L83 PolarHBondContact O-N 3.3Å; T81-L83 VanDerWaalsContact C-N 3.32Å; T81-L83 PolarHBondContact O-N 2.86Å; L83-I86 PolarHBondContact O-N 3.37Å; L83-H87 PolarHBondContact O-N 3.12Å
84	S	98.1	Very high	97.7	Very high	70 Å²	70	97 Å²	97	49%	0.49	51%	0.505	S	S	.	.	H	α-helix	trans	-62.5	-46.2	174.7	-172.1	0	0	0	0	111.7	D80 T81 L82 I86 H87 M88	D80-S84 PolarHBondContact O-N 3.01Å; T81-S84 WeakPolarHBondContact O-CB 3.36Å; T81-S84 PolarHBondContact O-N 3.14Å; T81-S84 VanDerWaalsContact O-N 3.17Å; L82-S84 VanDerWaalsContact C-N 3.32Å; L82-S84 PolarHBondContact O-N 3.4Å; S84-I86 PolarHBondContact O-N 2.89Å; S84-H87 WeakPolarHBondContact O-CB 3.4Å; S84-H87 PolarHBondContact O-N 3.26Å; S84-H87 VanDerWaalsContact O-N 3.17Å; S84-M88 PolarHBondContact O-N 2.9Å
85	E	98	Very high	97.5	Very high	105 Å²	105	97.9 Å²	97.9	49%	0.491	51%	0.507	S	S	.	.	H	α-helix	trans	-60.9	-44.3	176.5	-69.8	179.5	175.2	0	0	112.2	T81 L82 H87 M88 C89	T81-E85 PolarHBondContact O-N 3.32Å; L82-E85 PolarHBondContact O-N 2.88Å; E85-H87 VanDerWaalsContact C-N 3.28Å; E85-H87 PolarHBondContact O-N 2.9Å; E85-M88 WeakPolarHBondContact O-CB 3.5Å; E85-M88 PolarHBondContact O-N 2.9Å; E85-C89 PolarHBondContact O-N 2.99Å; E85-C89 PolarHBondContact O-SG 3.21Å
86	I	97.8	Very high	97.3	Very high	111 Å²	111	97.4 Å²	97.4	57%	0.569	51%	0.507	S	S	*	.	H	α-helix	trans	-59.3	-42.4	175.3	-71.4	166.2	0	0	0	110.6	L82 L83 S84 C89 R90	L82-I86 VanDerWaalsContact O-CG1 3.27Å; L82-I86 WeakPolarHBondContact O-CG1 3.32Å; L82-I86 PolarHBondContact O-N 3.41Å; L83-I86 PolarHBondContact O-N 3.37Å; S84-I86 PolarHBondContact O-N 2.89Å; I86-C89 PolarHBondContact O-N 3.49Å; I86-R90 WeakPolarHBondContact O-CB 3.34Å; I86-R90 PolarHBondContact O-N 2.88Å
87	H	97.5	Very high	97.1	Very high	95 Å²	95	97.6 Å²	97.6	44%	0.44	51%	0.509	S	S	.	.	H	α-helix	trans	-61.9	-45	177.5	-156.1	101.6	0	0	0	111.4	L83 S84 E85 R90 D91	L83-H87 PolarHBondContact O-N 3.12Å; S84-H87 WeakPolarHBondContact O-CB 3.4Å; S84-H87 PolarHBondContact O-N 3.26Å; S84-H87 VanDerWaalsContact O-N 3.17Å; E85-H87 VanDerWaalsContact C-N 3.28Å; E85-H87 PolarHBondContact O-N 2.9Å; H87-R90 PolarHBondContact CD2-NH2 3.48Å; H87-R90 PolarHBondContact CE1-NH2 3.12Å; H87-R90 PolarHBondContact NE2-NH2 2.93Å; H87-R90 WeakPolarHBondContact O-CB 3.24Å; H87-R90 PolarHBondContact O-N 3.4Å; H87-D91 IonicContact CD2-OD1 3.39Å; H87-D91 IonicContact CD2-OD2 3.88Å; H87-D91 PolarHBondContact CD2-OD2 3.24Å; H87-D91 IonicContact NE2-OD2 3.86Å; H87-D91 VanDerWaalsContact O-CG 3.3Å; H87-D91 PolarHBondContact O-N 3.32Å
88	M	97.5	Very high	96.8	Very high	123 Å²	123	95.5 Å²	95.5	61%	0.606	50%	0.499	S	S	*	.	H	α-helix	trans	-59.7	-47.1	175	-73.3	-179	52.9	0	0	111.7	S84 E85 R90 D91 T92	S84-M88 PolarHBondContact O-N 2.9Å; E85-M88 WeakPolarHBondContact O-CB 3.5Å; E85-M88 PolarHBondContact O-N 2.9Å; M88-R90 VanDerWaalsContact C-N 3.32Å; M88-R90 PolarHBondContact O-N 3.03Å; M88-D91 PolarHBondContact O-N 2.98Å; M88-T92 PolarHBondContact O-N 3.4Å; M88-T92 PolarHBondContact O-OG1 3.43Å; M88-T92 VanDerWaalsContact O-OG1 3.12Å
89	C	97.5	Very high	96.4	Very high	80 Å²	80	98.1 Å²	98.1	54%	0.541	51%	0.51	S	S	.	.	H	α-helix	trans	-58.2	-44.5	176.4	-75	0	0	0	0	111.9	E85 I86 T92 L93	E85-C89 PolarHBondContact O-N 2.99Å; E85-C89 PolarHBondContact O-SG 3.21Å; I86-C89 PolarHBondContact O-N 3.49Å; C89-T92 PolarHBondContact O-N 2.92Å; C89-L93 WeakPolarHBondContact O-CB 3.32Å; C89-L93 WeakPolarHBondContact O-CG 3.38Å; C89-L93 PolarHBondContact O-N 3.47Å
90	R	97.8	Very high	96	Very high	133 Å²	133	100.6 Å²	100.6	50%	0.502	52%	0.524	S	S	.	.	H	α-helix	trans	-59.8	-46.6	176.7	-174.6	-159.6	69.2	-172.3	-0.7	111.2	I86 H87 M88 L93 S94	I86-R90 WeakPolarHBondContact O-CB 3.34Å; I86-R90 PolarHBondContact O-N 2.88Å; H87-R90 PolarHBondContact CD2-NH2 3.48Å; H87-R90 PolarHBondContact CE1-NH2 3.12Å; H87-R90 PolarHBondContact NE2-NH2 2.93Å; H87-R90 WeakPolarHBondContact O-CB 3.24Å; H87-R90 PolarHBondContact O-N 3.4Å; M88-R90 VanDerWaalsContact C-N 3.32Å; M88-R90 PolarHBondContact O-N 3.03Å; R90-L93 PolarHBondContact O-N 2.89Å; R90-S94 PolarHBondContact O-N 3.34Å
91	D	97.3	Very high	95.6	Very high	61 Å²	61	99.5 Å²	99.5	33%	0.326	52%	0.521	S	S	.	.	H	α-helix	trans	-65.8	-39.5	-179.3	-69.4	-4.3	0	0	0	111.7	H87 M88 S94 K95	H87-D91 IonicContact CD2-OD1 3.39Å; H87-D91 IonicContact CD2-OD2 3.88Å; H87-D91 PolarHBondContact CD2-OD2 3.24Å; H87-D91 IonicContact NE2-OD2 3.86Å; H87-D91 VanDerWaalsContact O-CG 3.3Å; H87-D91 PolarHBondContact O-N 3.32Å; M88-D91 PolarHBondContact O-N 2.98Å; D91-S94 PolarHBondContact O-N 3.2Å; D91-K95 WeakPolarHBondContact O-CG 3.48Å; D91-K95 PolarHBondContact O-N 3.14Å; D91-K95 VanDerWaalsContact O-N 3.08Å
92	T	96.4	Very high	94.1	Very high	87 Å²	87	98.6 Å²	98.6	53%	0.534	53%	0.526	S	S	.	.	H	α-helix	trans	-61.9	-46.5	172.7	-61.4	0	0	0	0	111.6	M88 C89 S94 K95 L96	M88-T92 PolarHBondContact O-N 3.4Å; M88-T92 PolarHBondContact O-OG1 3.43Å; M88-T92 VanDerWaalsContact O-OG1 3.12Å; C89-T92 PolarHBondContact O-N 2.92Å; T92-S94 VanDerWaalsContact C-N 3.35Å; T92-S94 PolarHBondContact O-N 2.92Å; T92-K95 PolarHBondContact O-N 3.09Å; T92-L96 WeakPolarHBondContact O-CB 3.32Å; T92-L96 PolarHBondContact O-N 3.36Å
93	L	96.3	Very high	92.3	Very high	121 Å²	121	101.9 Å²	101.9	63%	0.634	54%	0.536	S	S	*	.	H	α-helix	trans	-63.1	-39.8	177.7	-75.1	172.4	0	0	0	112.1	C89 R90 L96 N97	C89-L93 WeakPolarHBondContact O-CB 3.32Å; C89-L93 WeakPolarHBondContact O-CG 3.38Å; C89-L93 PolarHBondContact O-N 3.47Å; R90-L93 PolarHBondContact O-N 2.89Å; L93-L96 PolarHBondContact O-N 2.91Å; L93-N97 WeakPolarHBondContact O-CB 3.49Å; L93-N97 PolarHBondContact O-N 3.08Å
94	S	95.4	Very high	90.3	Very high	56 Å²	56	102.3 Å²	102.3	39%	0.392	54%	0.542	S	S	.	.	H	α-helix	trans	-60.5	-48.3	176.3	-164.5	0	0	0	0	111.3	R90 D91 T92 L96 N97 E98	R90-S94 PolarHBondContact O-N 3.34Å; D91-S94 PolarHBondContact O-N 3.2Å; T92-S94 VanDerWaalsContact C-N 3.35Å; T92-S94 PolarHBondContact O-N 2.92Å; S94-L96 VanDerWaalsContact C-N 3.34Å; S94-L96 PolarHBondContact O-N 3.33Å; S94-N97 PolarHBondContact O-N 3.06Å; S94-E98 WeakPolarHBondContact O-CG 3.49Å; S94-E98 PolarHBondContact O-N 2.9Å
95	K	94.2	Very high	87.9	Confident	138 Å²	138	106.1 Å²	106.1	60%	0.6	56%	0.557	S	S	*	*	H	α-helix	trans	-60.3	-43.8	176.4	-71.8	175.3	-176.2	176.6	0	112	D91 T92 N97 E98 M99	D91-K95 WeakPolarHBondContact O-CG 3.48Å; D91-K95 PolarHBondContact O-N 3.14Å; D91-K95 VanDerWaalsContact O-N 3.08Å; T92-K95 PolarHBondContact O-N 3.09Å; K95-N97 VanDerWaalsContact C-N 3.32Å; K95-N97 PolarHBondContact O-N 2.84Å; K95-E98 PolarHBondContact O-N 3.26Å; K95-M99 VanDerWaalsContact O-CG 3.32Å; K95-M99 WeakPolarHBondContact O-CG 3.46Å; K95-M99 PolarHBondContact O-N 3.46Å
96	L	94.1	Very high	85.4	Confident	95 Å²	95	106.3 Å²	106.3	50%	0.497	57%	0.57	S	S	.	*	H	α-helix	trans	-65	-39.1	-179.8	-150.5	144	0	0	0	111	T92 L93 S94 M99 L100	T92-L96 WeakPolarHBondContact O-CB 3.32Å; T92-L96 PolarHBondContact O-N 3.36Å; L93-L96 PolarHBondContact O-N 2.91Å; S94-L96 VanDerWaalsContact C-N 3.34Å; S94-L96 PolarHBondContact O-N 3.33Å; L96-M99 PolarHBondContact O-N 3.42Å; L96-L100 HydrophobicContact CD2-CD1 3.77Å; L96-L100 HydrophobicContact CD2-CG 4.39Å; L96-L100 WeakPolarHBondContact O-CG 3.45Å; L96-L100 PolarHBondContact O-N 3.24Å; L96-L100 VanDerWaalsContact O-N 3.08Å
97	N	93.1	Very high	82.6	Confident	94 Å²	94	110.5 Å²	110.5	50%	0.503	61%	0.609	S	S	.	*	H	α-helix	trans	-65.9	-41.2	173.7	-175.1	61.3	0	0	0	112.7	L93 S94 K95 M99 L100 T101	L93-N97 WeakPolarHBondContact O-CB 3.49Å; L93-N97 PolarHBondContact O-N 3.08Å; S94-N97 PolarHBondContact O-N 3.06Å; K95-N97 VanDerWaalsContact C-N 3.32Å; K95-N97 PolarHBondContact O-N 2.84Å; N97-M99 VanDerWaalsContact C-N 3.33Å; N97-M99 PolarHBondContact O-N 3.43Å; N97-L100 PolarHBondContact O-N 3.03Å; N97-T101 WeakPolarHBondContact O-CB 3.32Å; N97-T101 WeakPolarHBondContact O-CG2 3.47Å; N97-T101 PolarHBondContact O-N 3.27Å; N97-T101 PolarHBondContact O-OG1 3.28Å
98	E	92.7	Very high	81.8	Confident	89 Å²	89	111.3 Å²	111.3	42%	0.416	62%	0.618	S	S	.	*	H	α-helix	trans	-60.6	-41.6	174.3	-75.3	166.2	-166.2	0	0	112.1	S94 K95 G102 K103	S94-E98 WeakPolarHBondContact O-CG 3.49Å; S94-E98 PolarHBondContact O-N 2.9Å; K95-E98 PolarHBondContact O-N 3.26Å; E98-G102 PolarHBondContact O-N 3.31Å; E98-K103 PolarHBondContact O-N 3Å
99	M	91	Very high	81	Confident	143 Å²	143	110.7 Å²	110.7	70%	0.704	62%	0.619	S	S	*	*	H	α-helix	trans	-63.5	-39.9	175.2	-69.6	174.8	70.2	0	0	112.3	K95 L96 N97	K95-M99 VanDerWaalsContact O-CG 3.32Å; K95-M99 WeakPolarHBondContact O-CG 3.46Å; K95-M99 PolarHBondContact O-N 3.46Å; L96-M99 PolarHBondContact O-N 3.42Å; N97-M99 VanDerWaalsContact C-N 3.33Å; N97-M99 PolarHBondContact O-N 3.43Å
100	L	89.9	Confident	80.1	Confident	137 Å²	137	112.4 Å²	112.4	72%	0.717	62%	0.623	S	S	*	*	H	α-helix	trans	-75.3	-34.2	180	-72	172.2	0	0	0	113.2	L96 N97 G102	L96-L100 HydrophobicContact CD2-CD1 3.77Å; L96-L100 HydrophobicContact CD2-CG 4.39Å; L96-L100 WeakPolarHBondContact O-CG 3.45Å; L96-L100 PolarHBondContact O-N 3.24Å; L96-L100 VanDerWaalsContact O-N 3.08Å; N97-L100 PolarHBondContact O-N 3.03Å; L100-G102 VanDerWaalsContact C-N 3.32Å
101	T	88	Confident	79	Confident	86 Å²	86	111.2 Å²	111.2	53%	0.528	63%	0.63	S	S	.	*	H	α-helix	trans	-87.9	1.6	-177.2	55.2	0	0	0	0	113.7	N97 K103	N97-T101 WeakPolarHBondContact O-CB 3.32Å; N97-T101 WeakPolarHBondContact O-CG2 3.47Å; N97-T101 PolarHBondContact O-N 3.27Å; N97-T101 PolarHBondContact O-OG1 3.28Å; T101-K103 PolarHBondContact O-N 3.16Å
102	G	67.3	Low	77.9	Confident	51 Å²	51	114.3 Å²	114.3	53%	0.526	65%	0.649	S	S	.	*	T	Hydrogen-bonded Turn	trans	74.1	20.9	171.7	0	0	0	0	0	115	E98 L100 V104	E98-G102 PolarHBondContact O-N 3.31Å; L100-G102 VanDerWaalsContact C-N 3.32Å; G102-V104 PolarHBondContact O-N 2.73Å
103	K	59.3	Low	76.6	Confident	165 Å²	165	116.1 Å²	116.1	72%	0.717	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.5	4.8	178	-88	-170.6	175.3	-177	0	114.9	E98 T101 D105	E98-K103 PolarHBondContact O-N 3Å; T101-K103 PolarHBondContact O-N 3.16Å; K103-D105 VanDerWaalsContact C-N 3.27Å; K103-D105 PolarHBondContact O-N 3.41Å
104	V	56.4	Low	75.2	Confident	108 Å²	108	115.8 Å²	115.8	66%	0.655	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.3	-9.7	178.1	-177.6	0	0	0	0	112.6	G102	G102-V104 PolarHBondContact O-N 2.73Å
105	D	47.9	Very low	73.7	Confident	151 Å²	151	120.4 Å²	120.4	81%	0.807	68%	0.679	S	S	*	*			trans	-115.5	78.4	172.7	-66.3	-36.9	0	0	0	111.4	K103	K103-D105 VanDerWaalsContact C-N 3.27Å; K103-D105 PolarHBondContact O-N 3.41Å
106	S	45.3	Very low	72	Confident	108 Å²	108	118.9 Å²	118.9	76%	0.755	69%	0.685	S	S	*	*			trans	-139.8	114.1	152.6	-65.5	0	0	0	0	106.6
107	S	38.9	Very low	70	Confident	200 Å²	200	121.1 Å²	121.1	100%	1.399	70%	0.702	S	S	*	*			trans	-42.5	0	-175.5	-54.4	0	0	0	0	116.6

Retrieved 107 of 107 residues in 69.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).