A0A5K4F602_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F602, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 62 aa.

						>A0A5K4F602_SCHMA|A0A5K4F602
MEPQHQVEGVLAVPVRALNVLGVVDVVGVVVETVVEDVVVNGEPTTKTEKPREMVKSRSKRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.6	Very low	45.6	Very low	245 Å²	245	160.4 Å²	160.4	100%	1.207	85%	0.846	S	S	*	*				0	114	0	-62.6	-165.1	-154.8	0	0	106
2	E	48.1	Very low	45.9	Very low	187 Å²	187	154.4 Å²	154.4	87%	0.874	84%	0.837	S	S	*	*			trans	-75.5	139.4	174.7	-71.8	-166.2	119.5	0	0	109.6	Q4	E2-Q4 PolarHBondContact O-N 3.39Å
3	P	49.1	Very low	46.1	Very low	111 Å²	111	150.7 Å²	150.7	72%	0.721	82%	0.822	S	S	*	*			trans	-73.2	122.4	-177.5	28.2	-31.3	0	0	0	109.9	H5	P3-H5 PolarHBondContact O-N 3.48Å
4	Q	46.5	Very low	45.9	Very low	177 Å²	177	147.1 Å²	147.1	83%	0.827	81%	0.81	S	S	*	*			trans	-65.3	101	167.8	-65.6	179.3	-25.5	0	0	107.7	E2 Q6	E2-Q4 PolarHBondContact O-N 3.39Å; Q4-Q6 VanDerWaalsContact C-N 3.3Å; Q4-Q6 PolarHBondContact O-N 2.91Å
5	H	46.4	Very low	46.1	Very low	174 Å²	174	144.9 Å²	144.9	81%	0.806	80%	0.801	S	S	*	*			trans	-61.3	98.7	162.2	-86.7	104.3	0	0	0	106.7	P3 V7	P3-H5 PolarHBondContact O-N 3.48Å; H5-V7 PolarHBondContact O-N 3.02Å; H5-V7 VanDerWaalsContact O-N 3.09Å
6	Q	39.6	Very low	45.9	Very low	177 Å²	177	150.9 Å²	150.9	83%	0.827	81%	0.808	S	S	*	*			trans	-64.7	110	167.1	-69.6	-178.2	53.3	0	0	106	Q4 E8	Q4-Q6 VanDerWaalsContact C-N 3.3Å; Q4-Q6 PolarHBondContact O-N 2.91Å; Q6-E8 VanDerWaalsContact C-N 3.32Å; Q6-E8 PolarHBondContact O-N 3.18Å
7	V	44.5	Very low	46	Very low	139 Å²	139	147.3 Å²	147.3	84%	0.842	80%	0.804	S	S	*	*			trans	-67.3	98.4	173.2	-176.4	0	0	0	0	106.3	H5 G9	H5-V7 PolarHBondContact O-N 3.02Å; H5-V7 VanDerWaalsContact O-N 3.09Å; V7-G9 PolarHBondContact O-N 2.92Å; V7-G9 VanDerWaalsContact O-N 3.14Å
8	E	41	Very low	46.1	Very low	198 Å²	198	142.7 Å²	142.7	93%	0.925	78%	0.778	S	S	*	*			trans	-57.7	108.8	167.2	-165.3	169.5	-159.5	0	0	107	Q6	Q6-E8 VanDerWaalsContact C-N 3.32Å; Q6-E8 PolarHBondContact O-N 3.18Å
9	G	43.8	Very low	46	Very low	58 Å²	58	142.1 Å²	142.1	60%	0.598	77%	0.774	S	S	*	*			trans	-157.2	124.2	-168.5	0	0	0	0	0	112.1	V7	V7-G9 PolarHBondContact O-N 2.92Å; V7-G9 VanDerWaalsContact O-N 3.14Å
10	V	46.3	Very low	46.2	Very low	140 Å²	140	141.3 Å²	141.3	85%	0.848	77%	0.774	S	S	*	*			trans	88.8	82.5	172	-159.1	0	0	0	0	114.7	A12	V10-A12 PolarHBondContact O-N 3.05Å
11	L	48	Very low	46.2	Very low	158 Å²	158	142.5 Å²	142.5	83%	0.827	78%	0.778	S	S	*	*			trans	-60.1	102.5	155.5	-173.9	75.7	0	0	0	108.2	V13	L11-V13 VanDerWaalsContact C-N 3.34Å; L11-V13 HydrophobicContact CD2-CG2 4.01Å; L11-V13 HydrophobicContact CG-CG2 4.25Å; L11-V13 PolarHBondContact O-N 2.73Å
12	A	48.3	Very low	46	Very low	89 Å²	89	132.2 Å²	132.2	74%	0.736	74%	0.735	S	S	*	*			trans	-70.7	89.7	174.9	0	0	0	0	0	109.5	V10 P14	V10-A12 PolarHBondContact O-N 3.05Å; A12-P14 VanDerWaalsContact O-CD 3.3Å; A12-P14 WeakPolarHBondContact O-CD 3.22Å
13	V	49.5	Very low	45.9	Very low	106 Å²	106	127.2 Å²	127.2	64%	0.642	72%	0.717	S	S	*	*			trans	-69.5	119	175.9	-178.7	0	0	0	0	108.9	L11 V15	L11-V13 VanDerWaalsContact C-N 3.34Å; L11-V13 HydrophobicContact CD2-CG2 4.01Å; L11-V13 HydrophobicContact CG-CG2 4.25Å; L11-V13 PolarHBondContact O-N 2.73Å; V13-V15 PolarHBondContact O-N 2.8Å
14	P	43	Very low	45.9	Very low	101 Å²	101	128 Å²	128	66%	0.656	72%	0.72	S	S	*	*			trans	-69.4	117.7	-177.2	23.8	-29.7	0	0	0	111.3	A12 R16	A12-P14 VanDerWaalsContact O-CD 3.3Å; A12-P14 WeakPolarHBondContact O-CD 3.22Å; P14-R16 PolarHBondContact O-N 2.7Å
15	V	49.1	Very low	45.9	Very low	113 Å²	113	124.8 Å²	124.8	69%	0.685	71%	0.709	S	S	*	*	G	3₁₀ helix	trans	-58.5	-2.7	-177.7	-168.9	0	0	0	0	114.3	V13 A17 L18	V13-V15 PolarHBondContact O-N 2.8Å; V15-A17 PolarHBondContact O-N 3.11Å; V15-L18 HydrophobicContact CG1-CD1 3.69Å; V15-L18 HydrophobicContact CG1-CG 4.31Å; V15-L18 PolarHBondContact O-N 3.35Å
16	R	43	Very low	46	Very low	241 Å²	241	119.5 Å²	119.5	91%	0.909	69%	0.688	S	S	*	*	G	3₁₀ helix	trans	-68.2	-15.6	-179	-71.8	-168.3	175.3	-168.4	-0.5	114.4	P14	P14-R16 PolarHBondContact O-N 2.7Å
17	A	47.8	Very low	46.6	Very low	90 Å²	90	115.7 Å²	115.7	74%	0.744	68%	0.677	S	S	*	*	G	3₁₀ helix	trans	-87.8	-3.2	178.8	0	0	0	0	0	114.2	V15 N19	V15-A17 PolarHBondContact O-N 3.11Å; A17-N19 PolarHBondContact O-N 2.68Å
18	L	47.8	Very low	46.7	Very low	64 Å²	64	110.6 Å²	110.6	34%	0.335	65%	0.653	S	S	.	*			trans	-76	60.1	174.3	-65.1	-175.7	0	0	0	111.6	V15 V20 V26	V15-L18 HydrophobicContact CG1-CD1 3.69Å; V15-L18 HydrophobicContact CG1-CG 4.31Å; V15-L18 PolarHBondContact O-N 3.35Å; L18-V20 PolarHBondContact O-N 2.65Å; L18-V26 HydrophobicContact CD2-CB 3.54Å; L18-V26 HydrophobicContact CD2-CG1 3.97Å; L18-V26 HydrophobicContact CD2-CG2 3.09Å; L18-V26 HydrophobicContact CG-CG2 4.46Å
19	N	44.3	Very low	47.3	Very low	131 Å²	131	104.4 Å²	104.4	70%	0.701	63%	0.628	S	S	*	*			trans	-74.7	94.4	170.5	-101.2	-12.5	0	0	0	109.2	A17 L21 G22	A17-N19 PolarHBondContact O-N 2.68Å; N19-L21 PolarHBondContact O-N 3.09Å; N19-G22 PolarHBondContact O-N 3.3Å
20	V	49.9	Very low	47.7	Very low	126 Å²	126	105.5 Å²	105.5	76%	0.764	62%	0.623	S	S	*	*	T	Hydrogen-bonded Turn	trans	45.4	-27	144	-163.4	0	0	0	0	120.7	L18	L18-V20 PolarHBondContact O-N 2.65Å
21	L	45.7	Very low	48	Very low	167 Å²	167	102.8 Å²	102.8	87%	0.874	61%	0.607	S	S	*	*	T	Hydrogen-bonded Turn	trans	-104.7	-23.3	164.4	-96.1	94.8	0	0	0	113	N19 V23	N19-L21 PolarHBondContact O-N 3.09Å; L21-V23 PolarHBondContact O-N 3.01Å
22	G	43.4	Very low	48.1	Very low	29 Å²	29	101.5 Å²	101.5	30%	0.299	60%	0.596	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.8	4.9	-176.6	0	0	0	0	0	115.7	N19 V24 D25 V26	N19-G22 PolarHBondContact O-N 3.3Å; G22-V24 PolarHBondContact O-N 2.89Å; G22-D25 WeakPolarHBondContact O-CB 3.39Å; G22-D25 PolarHBondContact O-N 2.77Å; G22-V26 PolarHBondContact O-N 3.14Å
23	V	47.8	Very low	48.3	Very low	82 Å²	82	100.4 Å²	100.4	50%	0.497	58%	0.58	S	S	.	*	H	α-helix	trans	-62.4	-26.8	-179.4	-179.3	0	0	0	0	111.8	L21 D25	L21-V23 PolarHBondContact O-N 3.01Å; V23-D25 VanDerWaalsContact C-N 3.29Å
24	V	47.4	Very low	48.2	Very low	128 Å²	128	99.3 Å²	99.3	78%	0.776	57%	0.574	S	S	*	*	H	α-helix	trans	-68.2	-32.7	173.2	-174.9	0	0	0	0	111.2	G22 G28	G22-V24 PolarHBondContact O-N 2.89Å; V24-G28 PolarHBondContact O-N 2.95Å
25	D	46.8	Very low	48.5	Very low	110 Å²	110	98.4 Å²	98.4	59%	0.588	57%	0.566	S	S	*	*	H	α-helix	trans	-78.5	-31.1	-173.5	-152.4	26.2	0	0	0	112.3	G22 V23 G28 V29	G22-D25 WeakPolarHBondContact O-CB 3.39Å; G22-D25 PolarHBondContact O-N 2.77Å; V23-D25 VanDerWaalsContact C-N 3.29Å; D25-G28 CarbonylContact O-C 3.49Å; D25-G28 VanDerWaalsContact O-CA 3.31Å; D25-G28 WeakPolarHBondContact O-CA 2.81Å; D25-G28 PolarHBondContact O-N 2.93Å; D25-V29 WeakPolarHBondContact O-CG2 3.37Å; D25-V29 PolarHBondContact O-N 3.26Å
26	V	49.7	Very low	48.2	Very low	62 Å²	62	99.2 Å²	99.2	38%	0.376	56%	0.563	S	S	.	*	H	α-helix	trans	-77	-26.2	-179.7	176	0	0	0	0	113.2	L18 G22 G28 V30	L18-V26 HydrophobicContact CD2-CB 3.54Å; L18-V26 HydrophobicContact CD2-CG1 3.97Å; L18-V26 HydrophobicContact CD2-CG2 3.09Å; L18-V26 HydrophobicContact CG-CG2 4.46Å; G22-V26 PolarHBondContact O-N 3.14Å; V26-G28 VanDerWaalsContact C-N 3.29Å; V26-V30 HydrophobicContact CG1-CG2 4.1Å; V26-V30 WeakPolarHBondContact O-CB 3Å; V26-V30 WeakPolarHBondContact O-CG2 3.14Å; V26-V30 PolarHBondContact O-N 3.22Å
27	V	50.8	Low	48.1	Very low	98 Å²	98	92.4 Å²	92.4	59%	0.594	54%	0.544	S	S	*	.	H	α-helix	trans	-65.7	-40.6	164.4	-176.7	0	0	0	0	109.5	V31	V27-V31 HydrophobicContact CG1-CG2 4.28Å; V27-V31 WeakPolarHBondContact O-CB 3.17Å; V27-V31 WeakPolarHBondContact O-CG2 3.23Å; V27-V31 PolarHBondContact O-N 3.47Å
28	G	47	Very low	48	Very low	32 Å²	32	92.5 Å²	92.5	33%	0.33	54%	0.535	S	S	.	.	H	α-helix	trans	-55.7	-53.9	173.9	0	0	0	0	0	112.5	V24 D25 V26 V31 E32	V24-G28 PolarHBondContact O-N 2.95Å; D25-G28 CarbonylContact O-C 3.49Å; D25-G28 VanDerWaalsContact O-CA 3.31Å; D25-G28 WeakPolarHBondContact O-CA 2.81Å; D25-G28 PolarHBondContact O-N 2.93Å; V26-G28 VanDerWaalsContact C-N 3.29Å; G28-V31 PolarHBondContact O-N 2.77Å; G28-E32 WeakPolarHBondContact O-CB 3.28Å; G28-E32 WeakPolarHBondContact O-CG 3.18Å; G28-E32 PolarHBondContact O-N 3.32Å
29	V	53	Low	47.8	Very low	68 Å²	68	93.5 Å²	93.5	41%	0.412	54%	0.544	S	S	.	.	H	α-helix	trans	-68.3	-39.2	-177.9	177.6	0	0	0	0	112.3	D25 V31 E32 T33	D25-V29 WeakPolarHBondContact O-CG2 3.37Å; D25-V29 PolarHBondContact O-N 3.26Å; V29-V31 VanDerWaalsContact C-N 3.31Å; V29-V31 PolarHBondContact O-N 2.74Å; V29-E32 PolarHBondContact O-N 3.04Å; V29-T33 HydrophobicContact CG1-CG2 4.18Å; V29-T33 WeakPolarHBondContact O-CB 3.19Å; V29-T33 VanDerWaalsContact O-CG2 3.24Å; V29-T33 WeakPolarHBondContact O-CG2 3.44Å; V29-T33 PolarHBondContact O-N 3.29Å; V29-T33 PolarHBondContact O-OG1 2.79Å
30	V	52.9	Low	47.9	Very low	80 Å²	80	92.4 Å²	92.4	49%	0.485	54%	0.542	S	S	.	.	H	α-helix	trans	-65.7	-38.1	175.7	174.6	0	0	0	0	110.5	V26 T33 V34	V26-V30 HydrophobicContact CG1-CG2 4.1Å; V26-V30 WeakPolarHBondContact O-CB 3Å; V26-V30 WeakPolarHBondContact O-CG2 3.14Å; V26-V30 PolarHBondContact O-N 3.22Å; V30-T33 WeakPolarHBondContact CA-OG1 3.23Å; V30-T33 PolarHBondContact O-OG1 2.9Å; V30-T33 VanDerWaalsContact O-OG1 3.07Å; V30-V34 WeakPolarHBondContact O-CB 3.35Å; V30-V34 VanDerWaalsContact O-CG2 3.23Å; V30-V34 WeakPolarHBondContact O-CG2 3.46Å; V30-V34 PolarHBondContact O-N 2.87Å; V30-V34 VanDerWaalsContact O-N 3.08Å
31	V	53.5	Low	47.5	Very low	84 Å²	84	92.3 Å²	92.3	51%	0.509	54%	0.537	S	S	.	.	H	α-helix	trans	-70.7	-43.4	175.6	174.4	0	0	0	0	111.1	V27 G28 V29 T33 V34 V35	V27-V31 HydrophobicContact CG1-CG2 4.28Å; V27-V31 WeakPolarHBondContact O-CB 3.17Å; V27-V31 WeakPolarHBondContact O-CG2 3.23Å; V27-V31 PolarHBondContact O-N 3.47Å; G28-V31 PolarHBondContact O-N 2.77Å; V29-V31 VanDerWaalsContact C-N 3.31Å; V29-V31 PolarHBondContact O-N 2.74Å; V31-T33 PolarHBondContact O-N 2.7Å; V31-V34 PolarHBondContact O-N 3.12Å; V31-V35 HydrophobicContact CG1-CG2 4.26Å; V31-V35 WeakPolarHBondContact O-CB 3.5Å; V31-V35 VanDerWaalsContact O-CG2 3.23Å; V31-V35 WeakPolarHBondContact O-CG2 3.49Å; V31-V35 PolarHBondContact O-N 3.49Å
32	E	48.4	Very low	47.1	Very low	131 Å²	131	86.4 Å²	86.4	61%	0.612	52%	0.516	S	S	*	.	H	α-helix	trans	-59.5	-47.5	176	-79.8	-174.7	161.9	0	0	111.2	G28 V29 V34 V35 E36	G28-E32 WeakPolarHBondContact O-CB 3.28Å; G28-E32 WeakPolarHBondContact O-CG 3.18Å; G28-E32 PolarHBondContact O-N 3.32Å; V29-E32 PolarHBondContact O-N 3.04Å; E32-V34 PolarHBondContact O-N 2.83Å; E32-V35 PolarHBondContact O-N 2.78Å; E32-E36 WeakPolarHBondContact O-CB 3.5Å; E32-E36 WeakPolarHBondContact O-CG 3.37Å; E32-E36 PolarHBondContact O-N 2.96Å
33	T	52.8	Low	46.8	Very low	65 Å²	65	91.6 Å²	91.6	40%	0.399	53%	0.532	S	S	.	.	H	α-helix	trans	-65.3	-38.1	179.7	51	0	0	0	0	112.9	V29 V30 V31 E36 D37	V29-T33 HydrophobicContact CG1-CG2 4.18Å; V29-T33 WeakPolarHBondContact O-CB 3.19Å; V29-T33 VanDerWaalsContact O-CG2 3.24Å; V29-T33 WeakPolarHBondContact O-CG2 3.44Å; V29-T33 PolarHBondContact O-N 3.29Å; V29-T33 PolarHBondContact O-OG1 2.79Å; V30-T33 WeakPolarHBondContact CA-OG1 3.23Å; V30-T33 PolarHBondContact O-OG1 2.9Å; V30-T33 VanDerWaalsContact O-OG1 3.07Å; V31-T33 PolarHBondContact O-N 2.7Å; T33-E36 PolarHBondContact O-N 3.48Å; T33-D37 WeakPolarHBondContact O-CB 3.24Å; T33-D37 PolarHBondContact O-N 3.08Å
34	V	48.5	Very low	46.7	Very low	83 Å²	83	93.5 Å²	93.5	50%	0.503	55%	0.547	S	S	.	.	H	α-helix	trans	-70.2	-36.2	174.4	175.4	0	0	0	0	111.4	V30 V31 E32 D37 V38	V30-V34 WeakPolarHBondContact O-CB 3.35Å; V30-V34 VanDerWaalsContact O-CG2 3.23Å; V30-V34 WeakPolarHBondContact O-CG2 3.46Å; V30-V34 PolarHBondContact O-N 2.87Å; V30-V34 VanDerWaalsContact O-N 3.08Å; V31-V34 PolarHBondContact O-N 3.12Å; E32-V34 PolarHBondContact O-N 2.83Å; V34-D37 PolarHBondContact O-N 3.43Å; V34-V38 HydrophobicContact CG1-CG2 4.35Å; V34-V38 WeakPolarHBondContact O-CB 3.45Å; V34-V38 VanDerWaalsContact O-CG2 3.22Å; V34-V38 WeakPolarHBondContact O-CG2 3.46Å; V34-V38 PolarHBondContact O-N 3.39Å
35	V	48.4	Very low	46.7	Very low	82 Å²	82	92.6 Å²	92.6	50%	0.497	54%	0.541	S	S	.	.	H	α-helix	trans	-68	-42.2	174.8	173.4	0	0	0	0	110.4	V31 E32 V38 V39	V31-V35 HydrophobicContact CG1-CG2 4.26Å; V31-V35 WeakPolarHBondContact O-CB 3.5Å; V31-V35 VanDerWaalsContact O-CG2 3.23Å; V31-V35 WeakPolarHBondContact O-CG2 3.49Å; V31-V35 PolarHBondContact O-N 3.49Å; E32-V35 PolarHBondContact O-N 2.78Å; V35-V38 CarbonylContact O-C 3.21Å; V35-V38 PolarHBondContact O-N 3.49Å; V35-V39 HydrophobicContact CG1-CG2 4.2Å; V35-V39 WeakPolarHBondContact O-CB 3.31Å; V35-V39 WeakPolarHBondContact O-CG2 3.38Å; V35-V39 PolarHBondContact O-N 3.46Å
36	E	43.4	Very low	46.4	Very low	131 Å²	131	93.8 Å²	93.8	61%	0.612	55%	0.553	S	S	*	*	H	α-helix	trans	-62.9	-44.7	173.4	-74.6	-170.1	154.9	0	0	111	E32 T33 V38 V39 V40	E32-E36 WeakPolarHBondContact O-CB 3.5Å; E32-E36 WeakPolarHBondContact O-CG 3.37Å; E32-E36 PolarHBondContact O-N 2.96Å; T33-E36 PolarHBondContact O-N 3.48Å; E36-V38 VanDerWaalsContact C-N 3.27Å; E36-V38 PolarHBondContact O-N 2.94Å; E36-V39 CarbonylContact O-C 3.57Å; E36-V39 PolarHBondContact O-N 2.75Å; E36-V39 VanDerWaalsContact O-N 3.12Å; E36-V40 WeakPolarHBondContact O-CA 3.17Å; E36-V40 WeakPolarHBondContact O-CB 3.34Å; E36-V40 WeakPolarHBondContact O-CG2 3.41Å; E36-V40 PolarHBondContact O-N 2.85Å
37	D	41.8	Very low	46.2	Very low	98 Å²	98	99.5 Å²	99.5	52%	0.524	57%	0.573	S	S	.	*	H	α-helix	trans	-66.4	-27.6	176.6	-99.4	-17.7	0	0	0	112.6	T33 V34 N41	T33-D37 WeakPolarHBondContact O-CB 3.24Å; T33-D37 PolarHBondContact O-N 3.08Å; V34-D37 PolarHBondContact O-N 3.43Å; D37-N41 VanDerWaalsContact O-CA 3.28Å; D37-N41 WeakPolarHBondContact O-CA 3.3Å; D37-N41 WeakPolarHBondContact O-CB 3.36Å; D37-N41 PolarHBondContact O-N 2.91Å; D37-N41 PolarHBondContact O-ND2 3.07Å; D37-N41 PolarHBondContact OD1-ND2 3.04Å
38	V	44.6	Very low	45.9	Very low	91 Å²	91	101 Å²	101	55%	0.552	58%	0.583	S	S	*	*	H	α-helix	trans	-84.1	-22.9	172.8	175.7	0	0	0	0	111.8	V34 V35 E36 G42	V34-V38 HydrophobicContact CG1-CG2 4.35Å; V34-V38 WeakPolarHBondContact O-CB 3.45Å; V34-V38 VanDerWaalsContact O-CG2 3.22Å; V34-V38 WeakPolarHBondContact O-CG2 3.46Å; V34-V38 PolarHBondContact O-N 3.39Å; V35-V38 CarbonylContact O-C 3.21Å; V35-V38 PolarHBondContact O-N 3.49Å; E36-V38 VanDerWaalsContact C-N 3.27Å; E36-V38 PolarHBondContact O-N 2.94Å; V38-G42 CarbonylContact O-C 3.55Å; V38-G42 WeakPolarHBondContact O-CA 3.38Å; V38-G42 PolarHBondContact O-N 3.4Å
39	V	44.1	Very low	45.7	Very low	85 Å²	85	107.6 Å²	107.6	52%	0.515	61%	0.605	S	S	.	*	H	α-helix	trans	-80.5	-34.4	170.9	172.4	0	0	0	0	110.4	V35 E36	V35-V39 HydrophobicContact CG1-CG2 4.2Å; V35-V39 WeakPolarHBondContact O-CB 3.31Å; V35-V39 WeakPolarHBondContact O-CG2 3.38Å; V35-V39 PolarHBondContact O-N 3.46Å; E36-V39 CarbonylContact O-C 3.57Å; E36-V39 PolarHBondContact O-N 2.75Å; E36-V39 VanDerWaalsContact O-N 3.12Å
40	V	45.2	Very low	45.1	Very low	108 Å²	108	112.2 Å²	112.2	66%	0.655	62%	0.619	S	S	*	*	H	α-helix	trans	-82.2	-38.8	178.4	175.9	0	0	0	0	111.3	E36	E36-V40 WeakPolarHBondContact O-CA 3.17Å; E36-V40 WeakPolarHBondContact O-CB 3.34Å; E36-V40 WeakPolarHBondContact O-CG2 3.41Å; E36-V40 PolarHBondContact O-N 2.85Å
41	N	43.2	Very low	45.1	Very low	125 Å²	125	114.3 Å²	114.3	67%	0.668	63%	0.634	S	S	*	*	H	α-helix	trans	-102.9	-3.9	176.9	-54.4	-56.5	0	0	0	114.3	D37	D37-N41 VanDerWaalsContact O-CA 3.28Å; D37-N41 WeakPolarHBondContact O-CA 3.3Å; D37-N41 WeakPolarHBondContact O-CB 3.36Å; D37-N41 PolarHBondContact O-N 2.91Å; D37-N41 PolarHBondContact O-ND2 3.07Å; D37-N41 PolarHBondContact OD1-ND2 3.04Å
42	G	37	Very low	45.3	Very low	42 Å²	42	121.3 Å²	121.3	43%	0.433	65%	0.651	S	S	.	*	S	Bend	trans	-125.1	24.6	-177.8	0	0	0	0	0	115.1	V38	V38-G42 CarbonylContact O-C 3.55Å; V38-G42 WeakPolarHBondContact O-CA 3.38Å; V38-G42 PolarHBondContact O-N 3.4Å
43	E	36.6	Very low	45.5	Very low	138 Å²	138	122.9 Å²	122.9	65%	0.645	66%	0.659	S	S	*	*			trans	-134.6	97.5	157.3	-80.6	-161.9	123.2	0	0	111.7	T45	E43-T45 PolarHBondContact O-N 3.05Å
44	P	46.4	Very low	45.2	Very low	123 Å²	123	127.6 Å²	127.6	80%	0.799	68%	0.678	S	S	*	*			trans	-72.4	91.9	153.7	29.9	-26.8	0	0	0	106.5	T46	P44-T46 PolarHBondContact O-N 3.28Å
45	T	46.6	Very low	45.2	Very low	108 Å²	108	129.2 Å²	129.2	66%	0.663	69%	0.688	S	S	*	*			trans	-28	127.9	159.9	57.9	0	0	0	0	110.2	E43 K47	E43-T45 PolarHBondContact O-N 3.05Å; T45-K47 PolarHBondContact O-N 3.39Å
46	T	41.1	Very low	45.3	Very low	135 Å²	135	133.6 Å²	133.6	83%	0.828	70%	0.701	S	S	*	*			trans	-59.7	79	178.4	53	0	0	0	0	111	P44	P44-T46 PolarHBondContact O-N 3.28Å
47	K	45.2	Very low	45.7	Very low	182 Å²	182	133 Å²	133	79%	0.791	71%	0.711	S	S	*	*			trans	-119.2	75	157.9	-70.2	-171.7	-178.1	177	0	106.3	T45 E49	T45-K47 PolarHBondContact O-N 3.39Å; K47-E49 PolarHBondContact O-N 2.79Å
48	T	43.4	Very low	46.2	Very low	131 Å²	131	137.6 Å²	137.6	80%	0.804	72%	0.721	S	S	*	*				6.5	54.3	128.2	-27.6	0	0	0	0	116.3	K50	T48-K50 VanDerWaalsContact C-N 3.28Å; T48-K50 PolarHBondContact O-N 3.22Å; T48-K50 VanDerWaalsContact O-N 3.11Å
49	E	44.5	Very low	46.3	Very low	169 Å²	169	138.2 Å²	138.2	79%	0.79	73%	0.729	S	S	*	*			trans	-76.9	96.5	156.5	-165.4	172.4	175.5	0	0	104	K47	K47-E49 PolarHBondContact O-N 2.79Å
50	K	40.5	Very low	46.9	Very low	166 Å²	166	141.4 Å²	141.4	72%	0.722	74%	0.736	S	S	*	*			trans	-34.1	131.9	177.8	-68	176.7	177.6	179.4	0	108.7	T48 R52	T48-K50 VanDerWaalsContact C-N 3.28Å; T48-K50 PolarHBondContact O-N 3.22Å; T48-K50 VanDerWaalsContact O-N 3.11Å; K50-R52 PolarHBondContact O-N 2.84Å
51	P	52.5	Low	46.6	Very low	123 Å²	123	147.5 Å²	147.5	80%	0.799	75%	0.747	S	S	*	*			trans	-53.4	112.7	171.9	23.7	-31.6	0	0	0	105.5	E53	P51-E53 PolarHBondContact O-N 3.5Å
52	R	57.4	Low	46.9	Very low	231 Å²	231	155 Å²	155	87%	0.872	77%	0.774	S	S	*	*			trans	-66.1	90.5	171.2	-87.8	-174.8	169.2	-154	-0.4	104.6	K50 M54	K50-R52 PolarHBondContact O-N 2.84Å; R52-M54 PolarHBondContact O-N 2.92Å
53	E	52.4	Low	47.4	Very low	165 Å²	165	160.6 Å²	160.6	77%	0.771	79%	0.791	S	S	*	*			trans	-44.4	115.2	171.8	-161.3	175.8	-171.3	0	0	106.4	P51 V55	P51-E53 PolarHBondContact O-N 3.5Å; E53-V55 HydrophobicContact CB-CG2 4.3Å; E53-V55 HydrophobicContact CG-CG2 4.2Å; E53-V55 PolarHBondContact O-N 3.2Å
54	M	47.3	Very low	48	Very low	163 Å²	163	161.8 Å²	161.8	80%	0.803	80%	0.799	S	S	*	*			trans	-64.3	78.2	172	-80.8	173.1	51.5	0	0	108	R52 K56	R52-M54 PolarHBondContact O-N 2.92Å; M54-K56 VanDerWaalsContact C-N 3.29Å; M54-K56 PolarHBondContact O-N 3.22Å
55	V	47.1	Very low	48.1	Very low	118 Å²	118	163.9 Å²	163.9	72%	0.715	80%	0.799	S	S	*	*			trans	-74.7	94.9	170.6	-174.8	0	0	0	0	106.4	E53 S57	E53-V55 HydrophobicContact CB-CG2 4.3Å; E53-V55 HydrophobicContact CG-CG2 4.2Å; E53-V55 PolarHBondContact O-N 3.2Å; V55-S57 PolarHBondContact O-N 3.04Å
56	K	50.8	Low	48.2	Very low	174 Å²	174	167.2 Å²	167.2	76%	0.757	81%	0.807	S	S	*	*			trans	-48.1	121.6	173.1	-71.4	175.1	179.2	175.7	0	109	M54 R58	M54-K56 VanDerWaalsContact C-N 3.29Å; M54-K56 PolarHBondContact O-N 3.22Å; K56-R58 PolarHBondContact O-N 2.83Å
57	S	51.8	Low	48.6	Very low	117 Å²	117	169.3 Å²	169.3	82%	0.818	81%	0.805	S	S	*	*			trans	-40.9	102.2	165	178.5	0	0	0	0	110.5	V55 S59	V55-S57 PolarHBondContact O-N 3.04Å; S57-S59 PolarHBondContact O-N 3.21Å
58	R	51.9	Low	48.9	Very low	195 Å²	195	168.4 Å²	168.4	74%	0.736	81%	0.806	S	S	*	*			trans	-98.2	77.6	167.3	-163	179.9	-161.9	-177.7	7.3	107.8	K56 K60	K56-R58 PolarHBondContact O-N 2.83Å; R58-K60 HydrophobicContact CG-CG 4.2Å; R58-K60 PolarHBondContact O-N 3.32Å
59	S	46.6	Very low	49.2	Very low	105 Å²	105	171.1 Å²	171.1	73%	0.734	81%	0.806	S	S	*	*			trans	-58.6	105	158.7	-175.3	0	0	0	0	108.4	S57	S57-S59 PolarHBondContact O-N 3.21Å
60	K	57.1	Low	49.6	Very low	151 Å²	151	171.2 Å²	171.2	66%	0.657	81%	0.808	S	S	*	*			trans	-120.8	72.6	164.4	-90	-164.8	171.7	-170	0	109.1	R58 K62	R58-K60 HydrophobicContact CG-CG 4.2Å; R58-K60 PolarHBondContact O-N 3.32Å; K60-K62 PolarHBondContact O-N 2.68Å
61	R	40.3	Very low	50.4	Low	236 Å²	236	171.7 Å²	171.7	89%	0.891	82%	0.815	S	S	*	*				18.9	94.6	123.6	-151	179.5	-165.1	167.8	3.5	115.3
62	K	49.3	Very low	50.2	Low	282 Å²	282	176.1 Å²	176.1	100%	1.226	82%	0.816	S	S	*	*				175.8	0	123.6	-97.4	-167.9	179.3	-171.9	0	109.3	K60	K60-K62 PolarHBondContact O-N 2.68Å

Retrieved 62 of 62 residues in 43.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).