A0A5K4F603_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F603, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 100 aa.

						>A0A5K4F603_SCHMA|A0A5K4F603
MYSMFNLPTYLNSQIIEQQKRLIIQIKEAQLLRAELETCRHRLLESIPGHIKCDITHNIIDKLGRDFVNDNQLTTTTSNNITSTTDKTNYNQNITQLKLT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.2	Low	71.9	Confident	185 Å²	185	123.6 Å²	123.6	91%	0.911	62%	0.618	S	S	*	*				0	-48.8	0	-153.1	169.5	-177	0	0	112	S3 M4 F5	M1-S3 PolarHBondContact O-N 3.28Å; M1-M4 PolarHBondContact O-N 3.35Å; M1-F5 HydrophobicContact CG-CE2 4.29Å
2	Y	60.9	Low	73.4	Confident	199 Å²	199	121 Å²	121	78%	0.78	61%	0.608	S	S	*	*	H	α-helix	trans	-59.1	-37	177.2	-71.8	-78.9	0	0	0	115.4	M4 F5 N6	Y2-M4 VanDerWaalsContact C-N 3.27Å; Y2-M4 PolarHBondContact O-N 3.29Å; Y2-F5 PolarHBondContact O-N 3.39Å; Y2-N6 PolarHBondContact O-N 3.44Å; Y2-N6 PolarHBondContact O-ND2 2.95Å
3	S	62	Low	74.8	Confident	96 Å²	96	116.8 Å²	116.8	67%	0.671	60%	0.596	S	S	*	*	H	α-helix	trans	-61.6	-32.6	-179.6	55.5	0	0	0	0	113.7	M1 N6 L7	M1-S3 PolarHBondContact O-N 3.28Å; S3-N6 PolarHBondContact O-N 3.35Å; S3-L7 PolarHBondContact O-N 3.36Å
4	M	63	Low	76.1	Confident	154 Å²	154	113.4 Å²	113.4	76%	0.759	58%	0.577	S	S	*	*	H	α-helix	trans	-73.7	-31.1	-176.6	-170.8	173.5	151	0	0	112.4	M1 Y2 P8	M1-M4 PolarHBondContact O-N 3.35Å; Y2-M4 VanDerWaalsContact C-N 3.27Å; Y2-M4 PolarHBondContact O-N 3.29Å; M4-P8 WeakPolarHBondContact O-CD 3.37Å
5	F	65.7	Low	77.4	Confident	141 Å²	141	111 Å²	111	62%	0.618	57%	0.565	S	S	*	*	H	α-helix	trans	-80.9	-22.3	173.9	-67.4	-73.9	0	0	0	113.2	M1 Y2 T9	M1-F5 HydrophobicContact CG-CE2 4.29Å; Y2-F5 PolarHBondContact O-N 3.39Å; F5-T9 PolarHBondContact O-OG1 3.38Å
6	N	71.1	Confident	78.6	Confident	99 Å²	99	109.1 Å²	109.1	53%	0.529	56%	0.555	S	S	.	*	H	α-helix	trans	-75.6	-25.9	177.7	-73.8	-21.4	0	0	0	113.1	Y2 S3 T9 Y10	Y2-N6 PolarHBondContact O-N 3.44Å; Y2-N6 PolarHBondContact O-ND2 2.95Å; S3-N6 PolarHBondContact O-N 3.35Å; N6-T9 VanDerWaalsContact CA-OG1 3.3Å; N6-T9 WeakPolarHBondContact CA-OG1 3.17Å; N6-T9 PolarHBondContact O-OG1 2.92Å; N6-Y10 WeakPolarHBondContact O-CB 3.41Å; N6-Y10 PolarHBondContact O-N 2.94Å
7	L	75.5	Confident	79.6	Confident	108 Å²	108	106.8 Å²	106.8	57%	0.565	54%	0.542	S	S	*	.	H	α-helix	trans	-69.6	-48.2	-177.7	-173	72.3	0	0	0	112.9	S3 T9 Y10 L11	S3-L7 PolarHBondContact O-N 3.36Å; L7-T9 VanDerWaalsContact C-N 3.33Å; L7-T9 PolarHBondContact O-N 3.03Å; L7-Y10 PolarHBondContact O-N 2.97Å; L7-L11 HydrophobicContact CG-CD1 4.18Å; L7-L11 WeakPolarHBondContact O-CG 3.3Å; L7-L11 PolarHBondContact O-N 3.44Å
8	P	81.6	Confident	80.6	Confident	69 Å²	69	107.7 Å²	107.7	45%	0.448	54%	0.544	S	S	.	.	H	α-helix	trans	-61.8	-40.8	175.9	-22.8	33.3	0	0	0	112.6	M4 L11 N12	M4-P8 WeakPolarHBondContact O-CD 3.37Å; P8-L11 PolarHBondContact O-N 3.02Å; P8-N12 WeakPolarHBondContact O-CB 3.13Å; P8-N12 VanDerWaalsContact O-CG 3.23Å; P8-N12 PolarHBondContact O-N 3.46Å; P8-N12 PolarHBondContact O-ND2 2.97Å
9	T	83.5	Confident	81.5	Confident	85 Å²	85	107.8 Å²	107.8	52%	0.521	54%	0.542	S	S	.	.	H	α-helix	trans	-66.4	-41.2	179.2	45	0	0	0	0	111.7	F5 N6 L7 S13	F5-T9 PolarHBondContact O-OG1 3.38Å; N6-T9 VanDerWaalsContact CA-OG1 3.3Å; N6-T9 WeakPolarHBondContact CA-OG1 3.17Å; N6-T9 PolarHBondContact O-OG1 2.92Å; L7-T9 VanDerWaalsContact C-N 3.33Å; L7-T9 PolarHBondContact O-N 3.03Å; T9-S13 PolarHBondContact O-N 3.38Å
10	Y	83.7	Confident	82.3	Confident	135 Å²	135	107.6 Å²	107.6	53%	0.529	54%	0.538	S	S	.	.	H	α-helix	trans	-63.1	-47.9	174.2	177	-100.8	0	0	0	112.7	N6 L7 N12 S13 Q14	N6-Y10 WeakPolarHBondContact O-CB 3.41Å; N6-Y10 PolarHBondContact O-N 2.94Å; L7-Y10 PolarHBondContact O-N 2.97Å; Y10-N12 VanDerWaalsContact C-N 3.34Å; Y10-N12 PolarHBondContact O-N 2.95Å; Y10-S13 WeakPolarHBondContact O-CB 3.45Å; Y10-S13 PolarHBondContact O-N 2.97Å; Y10-Q14 HydrophobicContact CD1-CG 4.45Å; Y10-Q14 HydrophobicContact CE1-CG 4.01Å; Y10-Q14 HydrophobicContact CE2-CG 4.31Å; Y10-Q14 PolarHBondContact O-N 3.09Å; Y10-Q14 PolarHBondContact OH-NE2 3.18Å
11	L	86.4	Confident	83.1	Confident	89 Å²	89	109.1 Å²	109.1	47%	0.466	54%	0.537	S	S	.	.	H	α-helix	trans	-60.9	-44.2	177.9	-72.6	171.7	0	0	0	111.4	L7 P8 S13 Q14 I15	L7-L11 HydrophobicContact CG-CD1 4.18Å; L7-L11 WeakPolarHBondContact O-CG 3.3Å; L7-L11 PolarHBondContact O-N 3.44Å; P8-L11 PolarHBondContact O-N 3.02Å; L11-S13 VanDerWaalsContact C-N 3.31Å; L11-S13 PolarHBondContact O-N 3.48Å; L11-Q14 PolarHBondContact O-N 3.48Å; L11-I15 WeakPolarHBondContact O-CG1 3.33Å; L11-I15 PolarHBondContact O-N 3.41Å
12	N	90.6	Very high	85.1	Confident	92 Å²	92	104.9 Å²	104.9	49%	0.492	52%	0.518	S	S	.	.	H	α-helix	trans	-59.1	-43.1	174.9	-76.9	-34.2	0	0	0	111.6	P8 Y10 Q14 I15 I16	P8-N12 WeakPolarHBondContact O-CB 3.13Å; P8-N12 VanDerWaalsContact O-CG 3.23Å; P8-N12 PolarHBondContact O-N 3.46Å; P8-N12 PolarHBondContact O-ND2 2.97Å; Y10-N12 VanDerWaalsContact C-N 3.34Å; Y10-N12 PolarHBondContact O-N 2.95Å; N12-Q14 VanDerWaalsContact C-N 3.33Å; N12-Q14 PolarHBondContact O-N 3.42Å; N12-I15 PolarHBondContact O-N 3.26Å; N12-I16 WeakPolarHBondContact O-CB 3.49Å; N12-I16 WeakPolarHBondContact O-CD1 3.34Å; N12-I16 WeakPolarHBondContact O-CG1 3.32Å; N12-I16 PolarHBondContact O-N 3.21Å
13	S	90.5	Very high	86.8	Confident	66 Å²	66	99.5 Å²	99.5	46%	0.462	50%	0.502	S	S	.	.	H	α-helix	trans	-59.8	-42.1	176	-170.2	0	0	0	0	112.1	T9 Y10 L11 I16 E17	T9-S13 PolarHBondContact O-N 3.38Å; Y10-S13 WeakPolarHBondContact O-CB 3.45Å; Y10-S13 PolarHBondContact O-N 2.97Å; L11-S13 VanDerWaalsContact C-N 3.31Å; L11-S13 PolarHBondContact O-N 3.48Å; S13-I16 PolarHBondContact O-N 3.05Å; S13-E17 WeakPolarHBondContact O-CG 3.46Å; S13-E17 PolarHBondContact O-N 2.76Å; S13-E17 VanDerWaalsContact O-N 3.09Å
14	Q	93.9	Very high	88.6	Confident	70 Å²	70	99.2 Å²	99.2	33%	0.327	49%	0.492	S	S	.	.	H	α-helix	trans	-67.4	-42.2	179.1	-69.2	-71.2	18.4	0	0	112.2	Y10 L11 N12 I16 E17 Q18	Y10-Q14 HydrophobicContact CD1-CG 4.45Å; Y10-Q14 HydrophobicContact CE1-CG 4.01Å; Y10-Q14 HydrophobicContact CE2-CG 4.31Å; Y10-Q14 PolarHBondContact O-N 3.09Å; Y10-Q14 PolarHBondContact OH-NE2 3.18Å; L11-Q14 PolarHBondContact O-N 3.48Å; N12-Q14 VanDerWaalsContact C-N 3.33Å; N12-Q14 PolarHBondContact O-N 3.42Å; Q14-I16 VanDerWaalsContact C-N 3.34Å; Q14-I16 PolarHBondContact O-N 3.17Å; Q14-E17 PolarHBondContact O-N 2.95Å; Q14-Q18 WeakPolarHBondContact O-CG 3.2Å; Q14-Q18 PolarHBondContact O-N 2.88Å
15	I	95.6	Very high	90.3	Very high	77 Å²	77	97.7 Å²	97.7	40%	0.395	48%	0.483	S	S	.	.	H	α-helix	trans	-61.5	-45	176.8	-68.3	165.7	0	0	0	110.3	L11 N12 E17 Q18 Q19	L11-I15 WeakPolarHBondContact O-CG1 3.33Å; L11-I15 PolarHBondContact O-N 3.41Å; N12-I15 PolarHBondContact O-N 3.26Å; I15-E17 VanDerWaalsContact C-N 3.32Å; I15-E17 PolarHBondContact O-N 3.49Å; I15-Q18 PolarHBondContact O-N 3.49Å; I15-Q19 HydrophobicContact CG2-CG 4.35Å; I15-Q19 WeakPolarHBondContact O-CB 3.42Å; I15-Q19 WeakPolarHBondContact O-CG 3.37Å; I15-Q19 PolarHBondContact O-N 3.26Å
16	I	95.6	Very high	91.8	Very high	80 Å²	80	94.8 Å²	94.8	41%	0.41	47%	0.473	S	S	.	.	H	α-helix	trans	-59.8	-43.7	177.8	-70.3	164.9	0	0	0	110.6	N12 S13 Q14 Q18 Q19 K20	N12-I16 WeakPolarHBondContact O-CB 3.49Å; N12-I16 WeakPolarHBondContact O-CD1 3.34Å; N12-I16 WeakPolarHBondContact O-CG1 3.32Å; N12-I16 PolarHBondContact O-N 3.21Å; S13-I16 PolarHBondContact O-N 3.05Å; Q14-I16 VanDerWaalsContact C-N 3.34Å; Q14-I16 PolarHBondContact O-N 3.17Å; I16-Q18 PolarHBondContact O-N 2.96Å; I16-Q19 PolarHBondContact O-N 3.48Å; I16-K20 HydrophobicContact CG2-CD 4.35Å; I16-K20 WeakPolarHBondContact O-CG 3.22Å; I16-K20 PolarHBondContact O-N 3.29Å
17	E	96.6	Very high	93.1	Very high	70 Å²	70	96.5 Å²	96.5	33%	0.327	48%	0.476	S	S	.	.	H	α-helix	trans	-68.6	-32.1	178.3	-73.2	-53.9	129.2	0	0	113.5	S13 Q14 I15 K20 R21	S13-E17 WeakPolarHBondContact O-CG 3.46Å; S13-E17 PolarHBondContact O-N 2.76Å; S13-E17 VanDerWaalsContact O-N 3.09Å; Q14-E17 PolarHBondContact O-N 2.95Å; I15-E17 VanDerWaalsContact C-N 3.32Å; I15-E17 PolarHBondContact O-N 3.49Å; E17-K20 IonicContact OE1-NZ 3.11Å; E17-K20 PolarHBondContact OE1-NZ 3.28Å; E17-R21 PolarHBondContact O-N 3.41Å; E17-R21 PolarHBondContact O-NE 3.48Å
18	Q	96.9	Very high	94.2	Very high	124 Å²	124	96.7 Å²	96.7	58%	0.579	47%	0.473	S	S	*	.	H	α-helix	trans	-68.6	-44.8	171.7	-72.7	176.1	-7	0	0	111.5	Q14 I15 I16 K20 R21 L22	Q14-Q18 WeakPolarHBondContact O-CG 3.2Å; Q14-Q18 PolarHBondContact O-N 2.88Å; I15-Q18 PolarHBondContact O-N 3.49Å; I16-Q18 PolarHBondContact O-N 2.96Å; Q18-K20 PolarHBondContact O-N 3.36Å; Q18-R21 PolarHBondContact O-N 3.27Å; Q18-L22 PolarHBondContact O-N 2.93Å
19	Q	97.9	Very high	95	Very high	109 Å²	109	96.1 Å²	96.1	51%	0.509	47%	0.474	S	S	.	.	H	α-helix	trans	-62	-42.6	177.7	-73.9	175.5	-16.3	0	0	111.9	I15 I16 R21 L22 I23	I15-Q19 HydrophobicContact CG2-CG 4.35Å; I15-Q19 WeakPolarHBondContact O-CB 3.42Å; I15-Q19 WeakPolarHBondContact O-CG 3.37Å; I15-Q19 PolarHBondContact O-N 3.26Å; I16-Q19 PolarHBondContact O-N 3.48Å; Q19-R21 PolarHBondContact O-N 3.47Å; Q19-L22 PolarHBondContact O-N 2.89Å; Q19-I23 WeakPolarHBondContact O-CB 3.35Å; Q19-I23 WeakPolarHBondContact O-CD1 3.47Å; Q19-I23 VanDerWaalsContact O-CG1 3.22Å; Q19-I23 WeakPolarHBondContact O-CG1 3.45Å; Q19-I23 PolarHBondContact O-N 2.95Å
20	K	98.1	Very high	95.8	Very high	104 Å²	104	97.5 Å²	97.5	45%	0.452	48%	0.475	S	S	.	.	H	α-helix	trans	-57.9	-47.7	174.6	-75.5	175.6	-175	170.3	0	111.8	I16 E17 Q18 L22 I23 I24	I16-K20 HydrophobicContact CG2-CD 4.35Å; I16-K20 WeakPolarHBondContact O-CG 3.22Å; I16-K20 PolarHBondContact O-N 3.29Å; E17-K20 IonicContact OE1-NZ 3.11Å; E17-K20 PolarHBondContact OE1-NZ 3.28Å; Q18-K20 PolarHBondContact O-N 3.36Å; K20-L22 PolarHBondContact O-N 3.35Å; K20-I23 PolarHBondContact O-N 3.37Å; K20-I24 WeakPolarHBondContact O-CG1 3.34Å; K20-I24 PolarHBondContact O-N 3.15Å
21	R	98.3	Very high	96.5	Very high	139 Å²	139	96.8 Å²	96.8	53%	0.525	48%	0.48	S	S	.	.	H	α-helix	trans	-60.2	-44.1	177	-80.8	-177.2	-92.2	-143.8	-1.3	112.1	E17 Q18 Q19 I24 Q25	E17-R21 PolarHBondContact O-N 3.41Å; E17-R21 PolarHBondContact O-NE 3.48Å; Q18-R21 PolarHBondContact O-N 3.27Å; Q19-R21 PolarHBondContact O-N 3.47Å; R21-I24 PolarHBondContact O-N 3.06Å; R21-Q25 WeakPolarHBondContact O-CG 3.35Å; R21-Q25 PolarHBondContact O-N 3.33Å; R21-Q25 VanDerWaalsContact O-N 3.15Å
22	L	98.6	Very high	97.1	Very high	96 Å²	96	97.9 Å²	97.9	50%	0.503	49%	0.485	S	S	.	.	H	α-helix	trans	-62.6	-44.7	177.1	178.9	60.7	0	0	0	112.1	Q18 Q19 K20 I24 Q25 I26	Q18-L22 PolarHBondContact O-N 2.93Å; Q19-L22 PolarHBondContact O-N 2.89Å; K20-L22 PolarHBondContact O-N 3.35Å; L22-I24 VanDerWaalsContact C-N 3.3Å; L22-I24 PolarHBondContact O-N 3.33Å; L22-Q25 PolarHBondContact O-N 3.41Å; L22-I26 HydrophobicContact CD1-CD1 4.05Å; L22-I26 HydrophobicContact CD1-CG1 4.29Å; L22-I26 HydrophobicContact CG-CD1 3.89Å; L22-I26 WeakPolarHBondContact O-CG1 3.34Å; L22-I26 PolarHBondContact O-N 2.95Å
23	I	98.4	Very high	97.4	Very high	87 Å²	87	102.6 Å²	102.6	45%	0.446	50%	0.496	S	S	.	.	H	α-helix	trans	-60.7	-41	178.7	-70.6	163.9	0	0	0	111	Q19 K20 I26 K27	Q19-I23 WeakPolarHBondContact O-CB 3.35Å; Q19-I23 WeakPolarHBondContact O-CD1 3.47Å; Q19-I23 VanDerWaalsContact O-CG1 3.22Å; Q19-I23 WeakPolarHBondContact O-CG1 3.45Å; Q19-I23 PolarHBondContact O-N 2.95Å; K20-I23 PolarHBondContact O-N 3.37Å; I23-I26 PolarHBondContact O-N 3.25Å; I23-K27 HydrophobicContact CG2-CD 4.18Å; I23-K27 WeakPolarHBondContact O-CG 3.48Å; I23-K27 PolarHBondContact O-N 2.92Å
24	I	98.4	Very high	97.8	Very high	90 Å²	90	102.1 Å²	102.1	46%	0.462	50%	0.496	S	S	.	.	H	α-helix	trans	-60.5	-50.1	176.6	-69.2	165.1	0	0	0	110.3	K20 R21 L22 I26 K27 E28	K20-I24 WeakPolarHBondContact O-CG1 3.34Å; K20-I24 PolarHBondContact O-N 3.15Å; R21-I24 PolarHBondContact O-N 3.06Å; L22-I24 VanDerWaalsContact C-N 3.3Å; L22-I24 PolarHBondContact O-N 3.33Å; I24-I26 VanDerWaalsContact C-N 3.31Å; I24-I26 PolarHBondContact O-N 3.11Å; I24-K27 PolarHBondContact O-N 3.39Å; I24-K27 VanDerWaalsContact O-N 3.11Å; I24-E28 HydrophobicContact CG2-CG 4.4Å; I24-E28 WeakPolarHBondContact O-CG 3.48Å; I24-E28 PolarHBondContact O-N 3Å
25	Q	98.4	Very high	98	Very high	122 Å²	122	104.5 Å²	104.5	57%	0.57	51%	0.507	S	S	*	.	H	α-helix	trans	-59.5	-41.1	179	-68.9	175.8	27.2	0	0	112.5	R21 L22 E28 A29	R21-Q25 WeakPolarHBondContact O-CG 3.35Å; R21-Q25 PolarHBondContact O-N 3.33Å; R21-Q25 VanDerWaalsContact O-N 3.15Å; L22-Q25 PolarHBondContact O-N 3.41Å; Q25-E28 PolarHBondContact O-N 3.42Å; Q25-A29 WeakPolarHBondContact O-CB 3.43Å; Q25-A29 PolarHBondContact O-N 2.97Å
26	I	98.7	Very high	98.1	Very high	80 Å²	80	106.8 Å²	106.8	41%	0.41	52%	0.52	S	S	.	.	H	α-helix	trans	-62.7	-44.7	176.9	-69.4	168.4	0	0	0	110.4	L22 I23 I24 A29 Q30	L22-I26 HydrophobicContact CD1-CD1 4.05Å; L22-I26 HydrophobicContact CD1-CG1 4.29Å; L22-I26 HydrophobicContact CG-CD1 3.89Å; L22-I26 WeakPolarHBondContact O-CG1 3.34Å; L22-I26 PolarHBondContact O-N 2.95Å; I23-I26 PolarHBondContact O-N 3.25Å; I24-I26 VanDerWaalsContact C-N 3.31Å; I24-I26 PolarHBondContact O-N 3.11Å; I26-A29 PolarHBondContact O-N 2.99Å; I26-Q30 HydrophobicContact CG2-CG 4.39Å; I26-Q30 WeakPolarHBondContact O-CB 3.36Å; I26-Q30 VanDerWaalsContact O-CG 3.25Å; I26-Q30 WeakPolarHBondContact O-CG 3.25Å; I26-Q30 PolarHBondContact O-N 3.39Å
27	K	98.7	Very high	98.2	Very high	135 Å²	135	106.6 Å²	106.6	59%	0.587	52%	0.517	S	S	*	.	H	α-helix	trans	-63.8	-43.1	178.9	-75.4	179.7	175.1	-173.6	0	112	I23 I24 Q30 L31	I23-K27 HydrophobicContact CG2-CD 4.18Å; I23-K27 WeakPolarHBondContact O-CG 3.48Å; I23-K27 PolarHBondContact O-N 2.92Å; I24-K27 PolarHBondContact O-N 3.39Å; I24-K27 VanDerWaalsContact O-N 3.11Å; K27-Q30 PolarHBondContact O-N 2.96Å; K27-L31 WeakPolarHBondContact O-CB 3.36Å; K27-L31 PolarHBondContact O-N 3.27Å
28	E	98.6	Very high	98.3	Very high	111 Å²	111	107 Å²	107	52%	0.519	52%	0.524	S	S	.	.	H	α-helix	trans	-62.2	-45.9	176.2	-71.7	173.7	170.4	0	0	111.3	I24 Q25 Q30 L31 L32	I24-E28 HydrophobicContact CG2-CG 4.4Å; I24-E28 WeakPolarHBondContact O-CG 3.48Å; I24-E28 PolarHBondContact O-N 3Å; Q25-E28 PolarHBondContact O-N 3.42Å; E28-Q30 VanDerWaalsContact C-N 3.33Å; E28-Q30 PolarHBondContact O-N 3.45Å; E28-L31 PolarHBondContact O-N 2.95Å; E28-L32 WeakPolarHBondContact O-CG 3.41Å; E28-L32 PolarHBondContact O-N 3.36Å
29	A	98.4	Very high	98.3	Very high	57 Å²	57	103.8 Å²	103.8	47%	0.471	52%	0.515	S	S	.	.	H	α-helix	trans	-63.5	-37.7	177	0	0	0	0	0	112.8	Q25 I26 R33	Q25-A29 WeakPolarHBondContact O-CB 3.43Å; Q25-A29 PolarHBondContact O-N 2.97Å; I26-A29 PolarHBondContact O-N 2.99Å; A29-R33 WeakPolarHBondContact O-CB 3.4Å; A29-R33 PolarHBondContact O-N 2.92Å
30	Q	98.6	Very high	98.2	Very high	114 Å²	114	104.4 Å²	104.4	53%	0.533	51%	0.513	S	S	.	.	H	α-helix	trans	-65.6	-43.1	175.1	-76.5	174.2	-22.7	0	0	111.9	I26 K27 E28 R33 A34	I26-Q30 HydrophobicContact CG2-CG 4.39Å; I26-Q30 WeakPolarHBondContact O-CB 3.36Å; I26-Q30 VanDerWaalsContact O-CG 3.25Å; I26-Q30 WeakPolarHBondContact O-CG 3.25Å; I26-Q30 PolarHBondContact O-N 3.39Å; K27-Q30 PolarHBondContact O-N 2.96Å; E28-Q30 VanDerWaalsContact C-N 3.33Å; E28-Q30 PolarHBondContact O-N 3.45Å; Q30-R33 PolarHBondContact O-N 3.14Å; Q30-A34 PolarHBondContact O-N 3.47Å
31	L	98.6	Very high	98.1	Very high	121 Å²	121	103.6 Å²	103.6	63%	0.634	51%	0.51	S	S	*	.	H	α-helix	trans	-60.3	-49.5	175.8	179.2	64.8	0	0	0	111	K27 E28 R33 A34 E35	K27-L31 WeakPolarHBondContact O-CB 3.36Å; K27-L31 PolarHBondContact O-N 3.27Å; E28-L31 PolarHBondContact O-N 2.95Å; L31-R33 VanDerWaalsContact C-N 3.3Å; L31-R33 PolarHBondContact O-N 3.1Å; L31-A34 PolarHBondContact O-N 3.42Å; L31-A34 VanDerWaalsContact O-N 3.14Å; L31-E35 PolarHBondContact O-N 2.95Å
32	L	98.8	Very high	97.9	Very high	111 Å²	111	104 Å²	104	58%	0.581	51%	0.512	S	S	*	.	H	α-helix	trans	-60.2	-39.6	178	-71.5	171	0	0	0	112.1	E28 E35 L36	E28-L32 WeakPolarHBondContact O-CG 3.41Å; E28-L32 PolarHBondContact O-N 3.36Å; L32-E35 PolarHBondContact O-N 2.93Å; L32-L36 WeakPolarHBondContact O-CB 3.42Å; L32-L36 PolarHBondContact O-N 3.44Å
33	R	98.2	Very high	97.6	Very high	192 Å²	192	105.1 Å²	105.1	73%	0.725	52%	0.518	S	S	*	.	H	α-helix	trans	-62.7	-43.4	175.1	-179.6	179.2	-77.8	149.1	-4.2	111.7	A29 Q30 L31 L36 E37	A29-R33 WeakPolarHBondContact O-CB 3.4Å; A29-R33 PolarHBondContact O-N 2.92Å; Q30-R33 PolarHBondContact O-N 3.14Å; L31-R33 VanDerWaalsContact C-N 3.3Å; L31-R33 PolarHBondContact O-N 3.1Å; R33-L36 PolarHBondContact O-N 3.01Å; R33-E37 WeakPolarHBondContact O-CB 3.34Å; R33-E37 PolarHBondContact O-N 3.37Å
34	A	98.1	Very high	97.2	Very high	55 Å²	55	104.6 Å²	104.6	46%	0.455	52%	0.516	S	S	.	.	H	α-helix	trans	-65.8	-40.7	178.8	0	0	0	0	0	112	Q30 L31 E37 T38	Q30-A34 PolarHBondContact O-N 3.47Å; L31-A34 PolarHBondContact O-N 3.42Å; L31-A34 VanDerWaalsContact O-N 3.14Å; A34-E37 PolarHBondContact O-N 2.98Å; A34-T38 WeakPolarHBondContact O-CB 3.47Å; A34-T38 PolarHBondContact O-N 3.12Å; A34-T38 PolarHBondContact O-OG1 3.29Å
35	E	98.2	Very high	96.8	Very high	121 Å²	121	107.3 Å²	107.3	57%	0.565	53%	0.526	S	S	*	.	H	α-helix	trans	-65.1	-44.2	175.9	-173.2	175.9	-175.3	0	0	111.9	L31 L32 E37 T38 C39	L31-E35 PolarHBondContact O-N 2.95Å; L32-E35 PolarHBondContact O-N 2.93Å; E35-E37 VanDerWaalsContact C-N 3.33Å; E35-E37 PolarHBondContact O-N 3.35Å; E35-T38 WeakPolarHBondContact O-CB 3.39Å; E35-T38 PolarHBondContact O-N 3.28Å; E35-C39 WeakPolarHBondContact O-CB 3.44Å; E35-C39 PolarHBondContact O-N 3.41Å
36	L	98.5	Very high	96.5	Very high	124 Å²	124	105.9 Å²	105.9	65%	0.649	53%	0.53	S	S	*	.	H	α-helix	trans	-61.8	-42.2	176.7	-175.4	66.5	0	0	0	111.5	L32 R33 T38 C39 R40	L32-L36 WeakPolarHBondContact O-CB 3.42Å; L32-L36 PolarHBondContact O-N 3.44Å; R33-L36 PolarHBondContact O-N 3.01Å; L36-T38 VanDerWaalsContact C-N 3.32Å; L36-T38 PolarHBondContact O-N 3.3Å; L36-C39 WeakPolarHBondContact O-CB 3.43Å; L36-C39 PolarHBondContact O-N 3.4Å; L36-R40 WeakPolarHBondContact O-CB 3.49Å; L36-R40 PolarHBondContact O-N 3.48Å
37	E	97.5	Very high	96	Very high	77 Å²	77	104.2 Å²	104.2	36%	0.36	52%	0.521	S	S	.	.	H	α-helix	trans	-65.7	-38.2	177.4	-173.1	58.8	-164.2	0	0	111.7	R33 A34 E35 R40 H41	R33-E37 WeakPolarHBondContact O-CB 3.34Å; R33-E37 PolarHBondContact O-N 3.37Å; A34-E37 PolarHBondContact O-N 2.98Å; E35-E37 VanDerWaalsContact C-N 3.33Å; E35-E37 PolarHBondContact O-N 3.35Å; E37-R40 PolarHBondContact O-N 3.23Å; E37-R40 IonicContact OE1-CZ 3.3Å; E37-R40 VanDerWaalsContact OE1-CZ 3.3Å; E37-R40 IonicContact OE1-NE 2.99Å; E37-R40 PolarHBondContact OE1-NE 2.98Å; E37-R40 VanDerWaalsContact OE1-NE 3.11Å; E37-R40 IonicContact OE1-NH2 2.67Å; E37-R40 PolarHBondContact OE1-NH2 3.47Å; E37-R40 IonicContact OE2-CZ 3.88Å; E37-R40 IonicContact OE2-NE 3.74Å; E37-R40 PolarHBondContact OE2-NE 3.05Å; E37-R40 IonicContact OE2-NH2 3.95Å; E37-H41 PolarHBondContact O-N 2.7Å; E37-H41 PolarHBondContact O-ND1 3.48Å; E37-H41 IonicContact OE1-CE1 2.89Å; E37-H41 PolarHBondContact OE1-CE1 3Å; E37-H41 IonicContact OE1-ND1 3.43Å; E37-H41 PolarHBondContact OE1-ND1 3.19Å; E37-H41 IonicContact OE1-NE2 3.88Å
38	T	97.4	Very high	95.6	Very high	77 Å²	77	100.7 Å²	100.7	47%	0.472	51%	0.512	S	S	.	.	H	α-helix	trans	-65.8	-40.5	173.8	-56.3	0	0	0	0	111.5	A34 E35 L36 H41 R42	A34-T38 WeakPolarHBondContact O-CB 3.47Å; A34-T38 PolarHBondContact O-N 3.12Å; A34-T38 PolarHBondContact O-OG1 3.29Å; E35-T38 WeakPolarHBondContact O-CB 3.39Å; E35-T38 PolarHBondContact O-N 3.28Å; L36-T38 VanDerWaalsContact C-N 3.32Å; L36-T38 PolarHBondContact O-N 3.3Å; T38-H41 PolarHBondContact O-N 2.9Å; T38-R42 WeakPolarHBondContact O-CG 3.31Å; T38-R42 PolarHBondContact O-N 3.45Å; T38-R42 VanDerWaalsContact O-N 3.09Å
39	C	98.4	Very high	95	Very high	58 Å²	58	98 Å²	98	39%	0.392	51%	0.514	S	S	.	.	H	α-helix	trans	-61.7	-46.6	174.5	-177.1	0	0	0	0	111.2	E35 L36 H41 R42 L43	E35-C39 WeakPolarHBondContact O-CB 3.44Å; E35-C39 PolarHBondContact O-N 3.41Å; L36-C39 WeakPolarHBondContact O-CB 3.43Å; L36-C39 PolarHBondContact O-N 3.4Å; C39-H41 VanDerWaalsContact C-N 3.34Å; C39-H41 PolarHBondContact O-N 2.85Å; C39-R42 PolarHBondContact O-N 3.26Å; C39-L43 WeakPolarHBondContact O-CB 3.48Å; C39-L43 PolarHBondContact O-N 2.83Å
40	R	95.8	Very high	94.4	Very high	122 Å²	122	101.4 Å²	101.4	46%	0.46	52%	0.52	S	S	.	.	H	α-helix	trans	-55.2	-48.2	176.2	-172.9	-174.9	78.9	88.5	3.7	111.5	L36 E37 L43 L44	L36-R40 WeakPolarHBondContact O-CB 3.49Å; L36-R40 PolarHBondContact O-N 3.48Å; E37-R40 PolarHBondContact O-N 3.23Å; E37-R40 IonicContact OE1-CZ 3.3Å; E37-R40 VanDerWaalsContact OE1-CZ 3.3Å; E37-R40 IonicContact OE1-NE 2.99Å; E37-R40 PolarHBondContact OE1-NE 2.98Å; E37-R40 VanDerWaalsContact OE1-NE 3.11Å; E37-R40 IonicContact OE1-NH2 2.67Å; E37-R40 PolarHBondContact OE1-NH2 3.47Å; E37-R40 IonicContact OE2-CZ 3.88Å; E37-R40 IonicContact OE2-NE 3.74Å; E37-R40 PolarHBondContact OE2-NE 3.05Å; E37-R40 IonicContact OE2-NH2 3.95Å; R40-L43 PolarHBondContact O-N 3.11Å; R40-L44 HydrophobicContact CG-CD1 4.22Å; R40-L44 WeakPolarHBondContact O-CG 3.31Å; R40-L44 PolarHBondContact O-N 3.43Å
41	H	95.1	Very high	93.8	Very high	87 Å²	87	99.2 Å²	99.2	40%	0.403	51%	0.511	S	S	.	.	H	α-helix	trans	-60.6	-50.5	178.1	-77.8	95.3	0	0	0	112.2	E37 T38 C39 L43 L44 E45	E37-H41 PolarHBondContact O-N 2.7Å; E37-H41 PolarHBondContact O-ND1 3.48Å; E37-H41 IonicContact OE1-CE1 2.89Å; E37-H41 PolarHBondContact OE1-CE1 3Å; E37-H41 IonicContact OE1-ND1 3.43Å; E37-H41 PolarHBondContact OE1-ND1 3.19Å; E37-H41 IonicContact OE1-NE2 3.88Å; T38-H41 PolarHBondContact O-N 2.9Å; C39-H41 VanDerWaalsContact C-N 3.34Å; C39-H41 PolarHBondContact O-N 2.85Å; H41-L43 VanDerWaalsContact C-N 3.31Å; H41-L43 PolarHBondContact O-N 2.89Å; H41-L44 PolarHBondContact O-N 2.79Å; H41-E45 WeakPolarHBondContact O-CG 3.46Å; H41-E45 PolarHBondContact O-N 3.45Å
42	R	94.9	Very high	93	Very high	148 Å²	148	97 Å²	97	56%	0.558	50%	0.497	S	S	*	.	H	α-helix	trans	-59.8	-41.4	178.6	-72.3	-172.1	-65.5	154.5	-3.2	112.7	T38 C39 E45 S46	T38-R42 WeakPolarHBondContact O-CG 3.31Å; T38-R42 PolarHBondContact O-N 3.45Å; T38-R42 VanDerWaalsContact O-N 3.09Å; C39-R42 PolarHBondContact O-N 3.26Å; R42-E45 PolarHBondContact O-N 2.82Å; R42-S46 WeakPolarHBondContact O-CB 3.46Å; R42-S46 PolarHBondContact O-N 2.99Å; R42-S46 PolarHBondContact O-OG 3.14Å
43	L	92.1	Very high	92.3	Very high	118 Å²	118	94.6 Å²	94.6	62%	0.618	49%	0.488	S	S	*	.	H	α-helix	trans	-62.9	-46.4	177.9	-178.8	62.8	0	0	0	110.8	C39 R40 H41 S46	C39-L43 WeakPolarHBondContact O-CB 3.48Å; C39-L43 PolarHBondContact O-N 2.83Å; R40-L43 PolarHBondContact O-N 3.11Å; H41-L43 VanDerWaalsContact C-N 3.31Å; H41-L43 PolarHBondContact O-N 2.89Å; L43-S46 WeakPolarHBondContact O-CB 2.97Å; L43-S46 PolarHBondContact O-N 2.83Å
44	L	89.1	Confident	91.8	Very high	77 Å²	77	89.8 Å²	89.8	40%	0.403	48%	0.477	S	S	.	.	H	α-helix	trans	-63.8	-43.1	177.2	-71	174.8	0	0	0	111.4	R40 H41 S46 I47 K52	R40-L44 HydrophobicContact CG-CD1 4.22Å; R40-L44 WeakPolarHBondContact O-CG 3.31Å; R40-L44 PolarHBondContact O-N 3.43Å; H41-L44 PolarHBondContact O-N 2.79Å; L44-S46 PolarHBondContact O-N 3.21Å; L44-I47 HydrophobicContact CD2-CD1 4.3Å; L44-I47 PolarHBondContact O-N 3Å; L44-I47 VanDerWaalsContact O-N 3.13Å; L44-K52 WeakPolarHBondContact O-CE 3.29Å; L44-K52 PolarHBondContact O-NZ 3.42Å
45	E	90.2	Very high	91.2	Very high	146 Å²	146	90.6 Å²	90.6	68%	0.682	47%	0.473	S	S	*	.	H	α-helix	trans	-59.9	-34.3	176.3	-75.3	179.6	167.1	0	0	112.7	H41 R42 I47	H41-E45 WeakPolarHBondContact O-CG 3.46Å; H41-E45 PolarHBondContact O-N 3.45Å; R42-E45 PolarHBondContact O-N 2.82Å; E45-I47 PolarHBondContact O-N 2.67Å
46	S	91.8	Very high	90.6	Very high	93 Å²	93	88.3 Å²	88.3	65%	0.65	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.9	-16	178.2	-56.4	0	0	0	0	113.9	R42 L43 L44	R42-S46 WeakPolarHBondContact O-CB 3.46Å; R42-S46 PolarHBondContact O-N 2.99Å; R42-S46 PolarHBondContact O-OG 3.14Å; L43-S46 WeakPolarHBondContact O-CB 2.97Å; L43-S46 PolarHBondContact O-N 2.83Å; L44-S46 PolarHBondContact O-N 3.21Å
47	I	89	Confident	90.1	Very high	44 Å²	44	87.3 Å²	87.3	23%	0.226	46%	0.459	C	S	.	.	S	Bend	trans	-82.1	126.6	178.7	-55.9	170.9	0	0	0	109.9	L44 E45 I51 K52	L44-I47 HydrophobicContact CD2-CD1 4.3Å; L44-I47 PolarHBondContact O-N 3Å; L44-I47 VanDerWaalsContact O-N 3.13Å; E45-I47 PolarHBondContact O-N 2.67Å; I47-I51 HydrophobicContact CG2-CB 3.82Å; I47-I51 HydrophobicContact CG2-CG2 3.78Å; I47-K52 HydrophobicContact CB-CG 3.94Å; I47-K52 HydrophobicContact CG2-CG 3.71Å; I47-K52 WeakPolarHBondContact O-CE 3.22Å; I47-K52 PolarHBondContact O-NZ 3.37Å
48	P	90.1	Very high	89.7	Confident	61 Å²	61	88.8 Å²	88.8	40%	0.396	47%	0.47	S	S	.	.			trans	-55.5	143.7	173.5	-25.6	33.6	0	0	0	113.2	H50 I51 K52	P48-H50 VanDerWaalsContact C-N 3.32Å; P48-H50 VanDerWaalsContact CB-CE1 3.46Å; P48-H50 WeakPolarHBondContact CB-CE1 3.48Å; P48-H50 PolarHBondContact O-N 3.34Å; P48-I51 HydrophobicContact CB-CD1 4.28Å; P48-I51 HydrophobicContact CB-CG1 4.25Å; P48-I51 HydrophobicContact CG-CD1 3.98Å; P48-I51 HydrophobicContact CG-CG1 4.49Å; P48-I51 PolarHBondContact O-N 3Å; P48-I51 VanDerWaalsContact O-N 3.1Å; P48-K52 PolarHBondContact O-N 2.73Å
49	G	85.7	Confident	89.3	Confident	55 Å²	55	89.6 Å²	89.6	57%	0.567	47%	0.47	S	S	*	.	H	α-helix	trans	-56.4	-37.8	-173.8	0	0	0	0	0	115.3	K52 C53	G49-K52 WeakPolarHBondContact O-CB 3.33Å; G49-K52 PolarHBondContact O-N 3.42Å; G49-C53 PolarHBondContact O-N 3.41Å; G49-C53 VanDerWaalsContact O-N 3.15Å
50	H	85.8	Confident	88.6	Confident	128 Å²	128	91.5 Å²	91.5	59%	0.593	48%	0.475	S	S	*	.	H	α-helix	trans	-67.6	-41.3	177.6	57.9	-85.9	0	0	0	111.9	P48 K52 C53 D54	P48-H50 VanDerWaalsContact C-N 3.32Å; P48-H50 VanDerWaalsContact CB-CE1 3.46Å; P48-H50 WeakPolarHBondContact CB-CE1 3.48Å; P48-H50 PolarHBondContact O-N 3.34Å; H50-K52 VanDerWaalsContact C-N 3.35Å; H50-K52 PolarHBondContact O-N 3.36Å; H50-C53 VanDerWaalsContact O-CB 3.25Å; H50-C53 WeakPolarHBondContact O-CB 3.46Å; H50-C53 PolarHBondContact O-N 2.81Å; H50-D54 PolarHBondContact O-N 3.49Å
51	I	85.7	Confident	88.2	Confident	68 Å²	68	89.6 Å²	89.6	35%	0.349	47%	0.474	S	S	.	.	H	α-helix	trans	-65.6	-39.1	176.3	-56.1	-175.9	0	0	0	110.9	I47 P48 C53 D54 I55	I47-I51 HydrophobicContact CG2-CB 3.82Å; I47-I51 HydrophobicContact CG2-CG2 3.78Å; P48-I51 HydrophobicContact CB-CD1 4.28Å; P48-I51 HydrophobicContact CB-CG1 4.25Å; P48-I51 HydrophobicContact CG-CD1 3.98Å; P48-I51 HydrophobicContact CG-CG1 4.49Å; P48-I51 PolarHBondContact O-N 3Å; P48-I51 VanDerWaalsContact O-N 3.1Å; I51-C53 VanDerWaalsContact C-N 3.26Å; I51-C53 PolarHBondContact O-N 3.21Å; I51-D54 PolarHBondContact O-N 3.43Å; I51-I55 HydrophobicContact CG2-CD1 3.8Å; I51-I55 HydrophobicContact CG2-CG1 4.22Å; I51-I55 WeakPolarHBondContact O-CB 3.42Å; I51-I55 VanDerWaalsContact O-CG1 3.3Å; I51-I55 WeakPolarHBondContact O-CG1 3.45Å; I51-I55 PolarHBondContact O-N 3.19Å
52	K	82.9	Confident	87.9	Confident	75 Å²	75	90.6 Å²	90.6	33%	0.326	48%	0.478	S	S	.	.	H	α-helix	trans	-56.8	-43.7	173.6	-73.8	172.8	167.1	140.6	0	111.4	L44 I47 P48 G49 H50 T56	L44-K52 WeakPolarHBondContact O-CE 3.29Å; L44-K52 PolarHBondContact O-NZ 3.42Å; I47-K52 HydrophobicContact CB-CG 3.94Å; I47-K52 HydrophobicContact CG2-CG 3.71Å; I47-K52 WeakPolarHBondContact O-CE 3.22Å; I47-K52 PolarHBondContact O-NZ 3.37Å; P48-K52 PolarHBondContact O-N 2.73Å; G49-K52 WeakPolarHBondContact O-CB 3.33Å; G49-K52 PolarHBondContact O-N 3.42Å; H50-K52 VanDerWaalsContact C-N 3.35Å; H50-K52 PolarHBondContact O-N 3.36Å; K52-T56 VanDerWaalsContact O-CB 3.3Å; K52-T56 WeakPolarHBondContact O-CB 3.3Å; K52-T56 PolarHBondContact O-N 2.9Å; K52-T56 PolarHBondContact O-OG1 3.03Å
53	C	83	Confident	87.5	Confident	60 Å²	60	87.6 Å²	87.6	41%	0.405	47%	0.472	S	S	.	.	H	α-helix	trans	-59.9	-52.3	176.6	-159.6	0	0	0	0	110.3	G49 H50 I51 I55 T56 H57	G49-C53 PolarHBondContact O-N 3.41Å; G49-C53 VanDerWaalsContact O-N 3.15Å; H50-C53 VanDerWaalsContact O-CB 3.25Å; H50-C53 WeakPolarHBondContact O-CB 3.46Å; H50-C53 PolarHBondContact O-N 2.81Å; I51-C53 VanDerWaalsContact C-N 3.26Å; I51-C53 PolarHBondContact O-N 3.21Å; C53-I55 PolarHBondContact O-N 3.49Å; C53-T56 PolarHBondContact O-N 3.25Å; C53-T56 VanDerWaalsContact O-N 3.14Å; C53-H57 PolarHBondContact O-CD2 2.87Å; C53-H57 PolarHBondContact O-N 3.09Å; C53-H57 PolarHBondContact SG-CD2 3.21Å; C53-H57 PolarHBondContact SG-NE2 3.46Å
54	D	87.4	Confident	87.2	Confident	91 Å²	91	83.8 Å²	83.8	49%	0.487	46%	0.461	S	S	.	.	H	α-helix	trans	-59.3	-44.6	179.8	-65	-22.8	0	0	0	112.4	H50 I51 T56 H57 N58	H50-D54 PolarHBondContact O-N 3.49Å; I51-D54 PolarHBondContact O-N 3.43Å; D54-T56 VanDerWaalsContact C-N 3.35Å; D54-H57 PolarHBondContact O-N 3Å; D54-N58 WeakPolarHBondContact O-CB 3.46Å; D54-N58 VanDerWaalsContact O-CG 3.32Å; D54-N58 PolarHBondContact O-N 2.79Å; D54-N58 PolarHBondContact O-ND2 3.36Å
55	I	86.3	Confident	87.1	Confident	73 Å²	73	86.6 Å²	86.6	37%	0.374	47%	0.466	S	S	.	.	H	α-helix	trans	-60.9	-47.2	176.2	-69.7	169.7	0	0	0	110.1	I51 C53 H57 N58 I59	I51-I55 HydrophobicContact CG2-CD1 3.8Å; I51-I55 HydrophobicContact CG2-CG1 4.22Å; I51-I55 WeakPolarHBondContact O-CB 3.42Å; I51-I55 VanDerWaalsContact O-CG1 3.3Å; I51-I55 WeakPolarHBondContact O-CG1 3.45Å; I51-I55 PolarHBondContact O-N 3.19Å; C53-I55 PolarHBondContact O-N 3.49Å; I55-H57 PolarHBondContact O-N 2.9Å; I55-N58 PolarHBondContact O-N 3.31Å; I55-I59 HydrophobicContact CG2-CD1 3.56Å; I55-I59 HydrophobicContact CG2-CG1 4.28Å; I55-I59 WeakPolarHBondContact O-CB 3.35Å; I55-I59 VanDerWaalsContact O-CG1 3.29Å; I55-I59 WeakPolarHBondContact O-CG1 3.13Å; I55-I59 PolarHBondContact O-N 3.28Å
56	T	85.1	Confident	86.8	Confident	73 Å²	73	82.7 Å²	82.7	45%	0.448	45%	0.45	S	S	.	.	H	α-helix	trans	-61.9	-46.4	-178.1	-58.1	0	0	0	0	110.7	K52 C53 D54 I59 I60	K52-T56 VanDerWaalsContact O-CB 3.3Å; K52-T56 WeakPolarHBondContact O-CB 3.3Å; K52-T56 PolarHBondContact O-N 2.9Å; K52-T56 PolarHBondContact O-OG1 3.03Å; C53-T56 PolarHBondContact O-N 3.25Å; C53-T56 VanDerWaalsContact O-N 3.14Å; D54-T56 VanDerWaalsContact C-N 3.35Å; T56-I59 PolarHBondContact O-N 3.4Å; T56-I60 HydrophobicContact CG2-CD1 3.65Å; T56-I60 HydrophobicContact CG2-CG1 4.37Å; T56-I60 WeakPolarHBondContact O-CB 3.28Å; T56-I60 VanDerWaalsContact O-CG1 3.22Å; T56-I60 WeakPolarHBondContact O-CG1 3.22Å; T56-I60 PolarHBondContact O-N 3.06Å
57	H	89.4	Confident	86.3	Confident	103 Å²	103	85 Å²	85	48%	0.477	45%	0.449	S	S	.	.	H	α-helix	trans	-60.5	-48.2	175.2	-74.2	-63.1	0	0	0	112	C53 D54 I55 I59 I60 D61	C53-H57 PolarHBondContact O-CD2 2.87Å; C53-H57 PolarHBondContact O-N 3.09Å; C53-H57 PolarHBondContact SG-CD2 3.21Å; C53-H57 PolarHBondContact SG-NE2 3.46Å; D54-H57 PolarHBondContact O-N 3Å; I55-H57 PolarHBondContact O-N 2.9Å; H57-I59 VanDerWaalsContact C-N 3.33Å; H57-I59 PolarHBondContact O-N 2.96Å; H57-I60 PolarHBondContact O-N 2.88Å; H57-D61 VanDerWaalsContact O-CB 3.28Å; H57-D61 WeakPolarHBondContact O-CB 3.37Å; H57-D61 PolarHBondContact O-N 3.46Å
58	N	88.1	Confident	85.7	Confident	108 Å²	108	87.1 Å²	87.1	58%	0.578	46%	0.463	S	S	*	.	H	α-helix	trans	-60.2	-41	178.9	-79.2	-55.8	0	0	0	112.9	D54 I55 K62	D54-N58 WeakPolarHBondContact O-CB 3.46Å; D54-N58 VanDerWaalsContact O-CG 3.32Å; D54-N58 PolarHBondContact O-N 2.79Å; D54-N58 PolarHBondContact O-ND2 3.36Å; I55-N58 PolarHBondContact O-N 3.31Å; N58-K62 VanDerWaalsContact O-CB 3.31Å; N58-K62 WeakPolarHBondContact O-CB 3.47Å; N58-K62 PolarHBondContact O-N 2.84Å
59	I	88.7	Confident	84.5	Confident	94 Å²	94	88.7 Å²	88.7	48%	0.482	47%	0.469	S	S	.	.	H	α-helix	trans	-68.2	-47.5	177.6	-69.1	172.3	0	0	0	110.3	I55 T56 H57 D61 K62 L63	I55-I59 HydrophobicContact CG2-CD1 3.56Å; I55-I59 HydrophobicContact CG2-CG1 4.28Å; I55-I59 WeakPolarHBondContact O-CB 3.35Å; I55-I59 VanDerWaalsContact O-CG1 3.29Å; I55-I59 WeakPolarHBondContact O-CG1 3.13Å; I55-I59 PolarHBondContact O-N 3.28Å; T56-I59 PolarHBondContact O-N 3.4Å; H57-I59 VanDerWaalsContact C-N 3.33Å; H57-I59 PolarHBondContact O-N 2.96Å; I59-D61 VanDerWaalsContact C-N 3.33Å; I59-D61 PolarHBondContact O-N 2.8Å; I59-K62 PolarHBondContact O-N 3.45Å; I59-L63 HydrophobicContact CG2-CD1 3.86Å; I59-L63 HydrophobicContact CG2-CG 4.28Å; I59-L63 WeakPolarHBondContact O-CB 3.43Å; I59-L63 VanDerWaalsContact O-CG 3.31Å; I59-L63 WeakPolarHBondContact O-CG 3.49Å; I59-L63 PolarHBondContact O-N 3.02Å
60	I	85.4	Confident	83.5	Confident	98 Å²	98	91.9 Å²	91.9	50%	0.503	47%	0.473	S	S	.	.	H	α-helix	trans	-60.1	-45.1	178	-71.1	171.2	0	0	0	110.4	T56 H57 K62 L63 G64	T56-I60 HydrophobicContact CG2-CD1 3.65Å; T56-I60 HydrophobicContact CG2-CG1 4.37Å; T56-I60 WeakPolarHBondContact O-CB 3.28Å; T56-I60 VanDerWaalsContact O-CG1 3.22Å; T56-I60 WeakPolarHBondContact O-CG1 3.22Å; T56-I60 PolarHBondContact O-N 3.06Å; H57-I60 PolarHBondContact O-N 2.88Å; I60-K62 VanDerWaalsContact C-N 3.33Å; I60-K62 PolarHBondContact O-N 2.96Å; I60-L63 PolarHBondContact O-N 3.05Å; I60-G64 PolarHBondContact O-N 2.95Å
61	D	86	Confident	82.2	Confident	81 Å²	81	92 Å²	92	43%	0.433	48%	0.477	S	S	.	.	H	α-helix	trans	-62.8	-41.4	178.3	-73.8	-11.6	0	0	0	111.4	H57 I59 G64 R65	H57-D61 VanDerWaalsContact O-CB 3.28Å; H57-D61 WeakPolarHBondContact O-CB 3.37Å; H57-D61 PolarHBondContact O-N 3.46Å; I59-D61 VanDerWaalsContact C-N 3.33Å; I59-D61 PolarHBondContact O-N 2.8Å; D61-G64 PolarHBondContact O-N 2.86Å; D61-R65 WeakPolarHBondContact O-CG 2.74Å; D61-R65 PolarHBondContact O-N 3.26Å
62	K	88.9	Confident	80.9	Confident	109 Å²	109	95.3 Å²	95.3	47%	0.474	49%	0.492	S	S	.	.	H	α-helix	trans	-64.5	-49.1	175.9	-174.8	179.6	-179.3	-64.6	0	111.2	N58 I59 I60 G64 R65 D66	N58-K62 VanDerWaalsContact O-CB 3.31Å; N58-K62 WeakPolarHBondContact O-CB 3.47Å; N58-K62 PolarHBondContact O-N 2.84Å; I59-K62 PolarHBondContact O-N 3.45Å; I60-K62 VanDerWaalsContact C-N 3.33Å; I60-K62 PolarHBondContact O-N 2.96Å; K62-G64 VanDerWaalsContact C-N 3.3Å; K62-G64 PolarHBondContact O-N 3Å; K62-R65 PolarHBondContact O-N 3.25Å; K62-R65 VanDerWaalsContact O-N 3.14Å; K62-D66 IonicContact NZ-OD1 2.7Å; K62-D66 IonicContact NZ-OD2 2.76Å; K62-D66 PolarHBondContact NZ-OD2 2.98Å; K62-D66 WeakPolarHBondContact O-CB 3.35Å; K62-D66 PolarHBondContact O-N 3.03Å
63	L	86	Confident	79.5	Confident	84 Å²	84	99.2 Å²	99.2	44%	0.44	52%	0.515	S	S	.	.	H	α-helix	trans	-57.9	-45.2	176.7	-71.8	173.3	0	0	0	110.8	I59 I60 R65 D66 F67	I59-L63 HydrophobicContact CG2-CD1 3.86Å; I59-L63 HydrophobicContact CG2-CG 4.28Å; I59-L63 WeakPolarHBondContact O-CB 3.43Å; I59-L63 VanDerWaalsContact O-CG 3.31Å; I59-L63 WeakPolarHBondContact O-CG 3.49Å; I59-L63 PolarHBondContact O-N 3.02Å; I60-L63 PolarHBondContact O-N 3.05Å; L63-R65 VanDerWaalsContact C-N 3.31Å; L63-R65 PolarHBondContact O-N 2.82Å; L63-D66 PolarHBondContact O-N 3.46Å; L63-F67 HydrophobicContact CB-CD2 4.48Å; L63-F67 HydrophobicContact CB-CE2 4.21Å; L63-F67 HydrophobicContact CD2-CE2 4.44Å; L63-F67 WeakPolarHBondContact O-CD2 3.3Å; L63-F67 PolarHBondContact O-N 2.89Å
64	G	85.8	Confident	77.9	Confident	38 Å²	38	102.3 Å²	102.3	39%	0.392	53%	0.533	S	S	.	.	H	α-helix	trans	-57.3	-42.9	175.9	0	0	0	0	0	112.6	I60 D61 K62 V68	I60-G64 PolarHBondContact O-N 2.95Å; D61-G64 PolarHBondContact O-N 2.86Å; K62-G64 VanDerWaalsContact C-N 3.3Å; K62-G64 PolarHBondContact O-N 3Å; G64-V68 WeakPolarHBondContact O-CG2 3.46Å; G64-V68 PolarHBondContact O-N 3.3Å
65	R	87.2	Confident	76.1	Confident	136 Å²	136	103.6 Å²	103.6	51%	0.513	54%	0.544	S	S	.	.	H	α-helix	trans	-68.4	-42.4	175	-71.2	-172	-58.4	-92.5	1.3	112.9	D61 K62 L63 F67 V68 N69	D61-R65 WeakPolarHBondContact O-CG 2.74Å; D61-R65 PolarHBondContact O-N 3.26Å; K62-R65 PolarHBondContact O-N 3.25Å; K62-R65 VanDerWaalsContact O-N 3.14Å; L63-R65 VanDerWaalsContact C-N 3.31Å; L63-R65 PolarHBondContact O-N 2.82Å; R65-F67 VanDerWaalsContact C-N 3.31Å; R65-F67 PolarHBondContact O-N 3.13Å; R65-V68 PolarHBondContact O-N 2.82Å; R65-N69 WeakPolarHBondContact O-CB 3.25Å; R65-N69 PolarHBondContact O-N 2.89Å; R65-N69 PolarHBondContact O-ND2 3.39Å
66	D	85.2	Confident	73.9	Confident	64 Å²	64	106.1 Å²	106.1	34%	0.342	56%	0.563	S	S	.	*	H	α-helix	trans	-59.3	-44	-180	-67.9	-13.8	0	0	0	109.9	K62 L63 D70	K62-D66 IonicContact NZ-OD1 2.7Å; K62-D66 IonicContact NZ-OD2 2.76Å; K62-D66 PolarHBondContact NZ-OD2 2.98Å; K62-D66 WeakPolarHBondContact O-CB 3.35Å; K62-D66 PolarHBondContact O-N 3.03Å; L63-D66 PolarHBondContact O-N 3.46Å; D66-D70 PolarHBondContact O-N 3.1Å
67	F	79.6	Confident	71.9	Confident	143 Å²	143	108 Å²	108	63%	0.627	58%	0.575	S	S	*	*	H	α-helix	trans	-71.3	-28.3	176.6	-68.4	-63.3	0	0	0	114.8	L63 R65	L63-F67 HydrophobicContact CB-CD2 4.48Å; L63-F67 HydrophobicContact CB-CE2 4.21Å; L63-F67 HydrophobicContact CD2-CE2 4.44Å; L63-F67 WeakPolarHBondContact O-CD2 3.3Å; L63-F67 PolarHBondContact O-N 2.89Å; R65-F67 VanDerWaalsContact C-N 3.31Å; R65-F67 PolarHBondContact O-N 3.13Å
68	V	77.1	Confident	69.5	Low	87 Å²	87	108 Å²	108	53%	0.527	59%	0.586	S	S	.	*	H	α-helix	trans	-75.7	-38	177.4	169.6	0	0	0	0	111.2	G64 R65 D70 N71	G64-V68 WeakPolarHBondContact O-CG2 3.46Å; G64-V68 PolarHBondContact O-N 3.3Å; R65-V68 PolarHBondContact O-N 2.82Å; V68-D70 VanDerWaalsContact C-N 3.34Å; V68-D70 PolarHBondContact O-N 3.22Å; V68-N71 PolarHBondContact O-N 3.42Å
69	N	65.4	Low	67.2	Low	95 Å²	95	109.8 Å²	109.8	51%	0.508	60%	0.595	S	S	.	*	H	α-helix	trans	-70.8	-29.7	-176.3	-68.5	-23.9	0	0	0	112.6	R65 N71 Q72	R65-N69 WeakPolarHBondContact O-CB 3.25Å; R65-N69 PolarHBondContact O-N 2.89Å; R65-N69 PolarHBondContact O-ND2 3.39Å; N69-N71 PolarHBondContact O-N 3.26Å; N69-Q72 PolarHBondContact O-N 3.14Å; N69-Q72 VanDerWaalsContact O-N 3.12Å
70	D	63.7	Low	64.9	Low	122 Å²	122	112.4 Å²	112.4	65%	0.652	61%	0.61	S	S	*	*	H	α-helix	trans	-62.5	-28.9	175.4	-72.4	-23.4	0	0	0	112.5	D66 V68 Q72	D66-D70 PolarHBondContact O-N 3.1Å; V68-D70 VanDerWaalsContact C-N 3.34Å; V68-D70 PolarHBondContact O-N 3.22Å; D70-Q72 VanDerWaalsContact C-N 3.35Å
71	N	59.1	Low	62.8	Low	129 Å²	129	115.2 Å²	115.2	69%	0.69	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.3	-8.4	177.6	-70.2	-28.5	0	0	0	114.1	V68 N69	V68-N71 PolarHBondContact O-N 3.42Å; N69-N71 PolarHBondContact O-N 3.26Å
72	Q	58	Low	60.4	Low	139 Å²	139	117.3 Å²	117.3	65%	0.65	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.8	-9.9	178.2	-82.4	-164.9	42.4	0	0	114.2	N69 D70 T74	N69-Q72 PolarHBondContact O-N 3.14Å; N69-Q72 VanDerWaalsContact O-N 3.12Å; D70-Q72 VanDerWaalsContact C-N 3.35Å; Q72-T74 PolarHBondContact O-N 2.96Å; Q72-T74 VanDerWaalsContact O-N 3.1Å
73	L	53.3	Low	57.8	Low	157 Å²	157	116.9 Å²	116.9	82%	0.822	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.7	3.6	-177.5	-159.2	60.2	0	0	0	114.3
74	T	50.7	Low	55.4	Low	125 Å²	125	119 Å²	119	77%	0.767	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.2	5.1	178.7	53.8	0	0	0	0	116	Q72	Q72-T74 PolarHBondContact O-N 2.96Å; Q72-T74 VanDerWaalsContact O-N 3.1Å
75	T	48.5	Very low	53	Low	118 Å²	118	122.6 Å²	122.6	72%	0.724	68%	0.682	S	S	*	*			trans	-115.8	56.4	179.6	7.7	0	0	0	0	112.6	T77	T75-T77 PolarHBondContact O-N 3.4Å
76	T	41.5	Very low	50.7	Low	126 Å²	126	122.3 Å²	122.3	77%	0.773	69%	0.691	S	S	*	*			trans	-67.8	122.5	154.7	-39.5	0	0	0	0	107.6
77	T	42.3	Very low	48.5	Very low	113 Å²	113	129.9 Å²	129.9	69%	0.693	72%	0.721	S	S	*	*			trans	91.9	97.8	165.2	-29.9	0	0	0	0	116.7	T75	T75-T77 PolarHBondContact O-N 3.4Å
78	S	38.5	Very low	46.5	Very low	101 Å²	101	128.7 Å²	128.7	71%	0.706	73%	0.725	S	S	*	*				171.3	103.8	113.6	-75.9	0	0	0	0	112
79	N	40.4	Very low	44.7	Very low	146 Å²	146	130.8 Å²	130.8	78%	0.781	73%	0.734	S	S	*	*			trans	50.2	111.9	135.2	-57.6	-13.1	0	0	0	120.2
80	N	39.5	Very low	43.5	Very low	149 Å²	149	136 Å²	136	80%	0.797	75%	0.748	S	S	*	*			trans	21.5	121.1	132.7	-64.9	-15.2	0	0	0	117
81	I	42	Very low	42.5	Very low	158 Å²	158	137 Å²	137	81%	0.81	75%	0.754	S	S	*	*				173.5	110.6	122.3	-85.7	152.2	0	0	0	108.9
82	T	35	Very low	41.9	Very low	124 Å²	124	137.3 Å²	137.3	76%	0.761	75%	0.751	S	S	*	*			trans	63.3	109	137.3	-39.6	0	0	0	0	120.2
83	S	34.4	Very low	41.3	Very low	100 Å²	100	138 Å²	138	70%	0.699	76%	0.759	S	S	*	*			trans	-2.1	126	144.1	-52.6	0	0	0	0	117
84	T	35.4	Very low	41.1	Very low	128 Å²	128	136 Å²	136	79%	0.785	75%	0.748	S	S	*	*				165.8	141.9	107.6	40	0	0	0	0	110.3
85	T	36.9	Very low	41.3	Very low	114 Å²	114	136.2 Å²	136.2	70%	0.699	75%	0.749	S	S	*	*	S	Bend	trans	74.7	119.9	158.6	2.4	0	0	0	0	118.2
86	D	37.9	Very low	41.2	Very low	131 Å²	131	139.1 Å²	139.1	70%	0.701	76%	0.755	S	S	*	*			trans	73	103	154.3	-51.3	-31.2	0	0	0	117	T88	D86-T88 VanDerWaalsContact C-N 3.34Å; D86-T88 PolarHBondContact O-N 3.49Å
87	K	39.7	Very low	41.5	Very low	222 Å²	222	140.6 Å²	140.6	97%	0.965	76%	0.757	S	S	*	*			trans	-47.5	96	167.8	-81.3	176.2	172.6	170	0	109.6
88	T	37.3	Very low	42.1	Very low	118 Å²	118	143.6 Å²	143.6	72%	0.724	76%	0.76	S	S	*	*			trans	-75.4	137.4	177.2	41.4	0	0	0	0	110.4	D86	D86-T88 VanDerWaalsContact C-N 3.34Å; D86-T88 PolarHBondContact O-N 3.49Å
89	N	38.5	Very low	42.4	Very low	132 Å²	132	146.4 Å²	146.4	71%	0.706	77%	0.766	S	S	*	*			trans	53.4	78.6	145.5	-64.9	-4.6	0	0	0	117	N91	N89-N91 PolarHBondContact O-N 2.93Å
90	Y	41.6	Very low	43.3	Very low	203 Å²	203	148 Å²	148	80%	0.796	78%	0.782	S	S	*	*			trans	-64.4	90.1	149.1	-167.1	-99.7	0	0	0	107.9	Q92	Y90-Q92 VanDerWaalsContact C-N 3.31Å; Y90-Q92 HydrophobicContact CD1-CG 3.44Å; Y90-Q92 VanDerWaalsContact CD1-CG 3.44Å; Y90-Q92 HydrophobicContact CE1-CG 3.73Å; Y90-Q92 PolarHBondContact O-N 3.06Å
91	N	42	Very low	43.5	Very low	145 Å²	145	148 Å²	148	78%	0.775	78%	0.781	S	S	*	*			trans	-61.1	92.8	172.5	-91.8	-25	0	0	0	108.7	N89 N93	N89-N91 PolarHBondContact O-N 2.93Å; N91-N93 VanDerWaalsContact C-N 3.3Å; N91-N93 PolarHBondContact O-N 2.88Å
92	Q	46	Very low	43.5	Very low	134 Å²	134	147.4 Å²	147.4	63%	0.626	78%	0.779	S	S	*	*			trans	-71.8	83.4	172.8	-71.7	-155.1	-20.3	0	0	110	Y90 I94	Y90-Q92 VanDerWaalsContact C-N 3.31Å; Y90-Q92 HydrophobicContact CD1-CG 3.44Å; Y90-Q92 VanDerWaalsContact CD1-CG 3.44Å; Y90-Q92 HydrophobicContact CE1-CG 3.73Å; Y90-Q92 PolarHBondContact O-N 3.06Å; Q92-I94 HydrophobicContact CB-CD1 4.32Å; Q92-I94 HydrophobicContact CB-CG1 4.18Å; Q92-I94 HydrophobicContact CG-CD1 4.47Å; Q92-I94 PolarHBondContact O-N 2.7Å
93	N	46.7	Very low	44	Very low	155 Å²	155	148.7 Å²	148.7	83%	0.829	78%	0.78	S	S	*	*			trans	-80.3	65.6	159.4	-122.9	-25.6	0	0	0	108.2	N91 T95	N91-N93 VanDerWaalsContact C-N 3.3Å; N91-N93 PolarHBondContact O-N 2.88Å; N93-T95 VanDerWaalsContact C-N 3.3Å; N93-T95 PolarHBondContact O-N 3.03Å
94	I	48.7	Very low	44.6	Very low	114 Å²	114	151.6 Å²	151.6	59%	0.585	79%	0.785	S	S	*	*			trans	-73.2	94.8	169.6	-63.4	172.9	0	0	0	105.7	Q92 Q96	Q92-I94 HydrophobicContact CB-CD1 4.32Å; Q92-I94 HydrophobicContact CB-CG1 4.18Å; Q92-I94 HydrophobicContact CG-CD1 4.47Å; Q92-I94 PolarHBondContact O-N 2.7Å; I94-Q96 PolarHBondContact O-N 2.79Å
95	T	54.2	Low	45.2	Very low	130 Å²	130	153.1 Å²	153.1	80%	0.798	79%	0.785	S	S	*	*			trans	-60.7	106.8	166	-10.1	0	0	0	0	106.2	N93 L97	N93-T95 VanDerWaalsContact C-N 3.3Å; N93-T95 PolarHBondContact O-N 3.03Å; T95-L97 PolarHBondContact O-N 3.15Å
96	Q	46.7	Very low	45.7	Very low	179 Å²	179	155.7 Å²	155.7	84%	0.836	79%	0.791	S	S	*	*			trans	-59.5	100.6	177.2	-71.7	177.2	-19.4	0	0	108.5	I94 K98	I94-Q96 PolarHBondContact O-N 2.79Å; Q96-K98 VanDerWaalsContact C-N 3.3Å; Q96-K98 PolarHBondContact O-N 3.17Å
97	L	48.8	Very low	46.3	Very low	156 Å²	156	157.4 Å²	157.4	82%	0.817	80%	0.797	S	S	*	*			trans	-70.8	93.9	168.2	-167	76.6	0	0	0	106.9	T95 L99	T95-L97 PolarHBondContact O-N 3.15Å; L97-L99 PolarHBondContact O-N 3.48Å
98	K	53.5	Low	46.8	Very low	177 Å²	177	152.5 Å²	152.5	77%	0.77	78%	0.784	S	S	*	*			trans	-68.1	100.1	173.3	-173.1	178.5	-178.4	-180	0	108.1	Q96 T100	Q96-K98 VanDerWaalsContact C-N 3.3Å; Q96-K98 PolarHBondContact O-N 3.17Å; K98-T100 VanDerWaalsContact C-N 3.33Å; K98-T100 PolarHBondContact O-N 3.3Å
99	L	46.2	Very low	47.6	Very low	159 Å²	159	155.3 Å²	155.3	83%	0.832	79%	0.79	S	S	*	*			trans	-68.8	93.4	162.4	-71.8	156.5	0	0	0	107.2	L97	L97-L99 PolarHBondContact O-N 3.48Å
100	T	57.8	Low	48.4	Very low	180 Å²	180	157.5 Å²	157.5	100%	1.104	80%	0.797	S	S	*	*			trans	-77.6	0	150.8	40.9	0	0	0	0	108.7	K98	K98-T100 VanDerWaalsContact C-N 3.33Å; K98-T100 PolarHBondContact O-N 3.3Å

Retrieved 100 of 100 residues in 27.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).