A0A5K4F651_SCHMA Loading...

Ovule protein

AlphaFold DB , UniProt , Accession A0A5K4F651, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 64 aa.

						>A0A5K4F651_SCHMA|A0A5K4F651
MYNDQLKSYKTLTYPTRHIPQQARNTRCRQTIYNLEHQNKPLKVYQRIQRTKQYSIIKLSPLQV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.9	Low	51.4	Low	224 Å²	224	150.2 Å²	150.2	100%	1.103	72%	0.723	S	S	*	*				0	-3.5	0	-80.1	-154.5	150.4	0	0	116.3
2	Y	46.4	Very low	51.4	Low	202 Å²	202	145 Å²	145	79%	0.792	70%	0.701	S	S	*	*			trans	-107.4	-15.7	164.8	-137.7	-96.7	0	0	0	113.3
3	N	53	Low	51.7	Low	126 Å²	126	143.5 Å²	143.5	67%	0.674	71%	0.706	S	S	*	*	S	Bend	trans	-86.4	-8.6	179.5	-91.5	-27.7	0	0	0	114.9
4	D	53.1	Low	51.6	Low	118 Å²	118	145.6 Å²	145.6	63%	0.631	70%	0.704	S	S	*	*	H	α-helix	trans	-80.5	-34.6	-179.4	-102.6	-91.2	0	0	0	112.8	L6 K7 S8	D4-L6 VanDerWaalsContact C-N 3.31Å; D4-L6 PolarHBondContact O-N 3.04Å; D4-K7 PolarHBondContact O-N 3.15Å; D4-S8 PolarHBondContact O-N 2.86Å
5	Q	47	Very low	51.8	Low	144 Å²	144	142.9 Å²	142.9	67%	0.673	70%	0.702	S	S	*	*	H	α-helix	trans	-68.7	-28.9	178.7	-74.8	-176.8	-21.5	0	0	112.9
6	L	53.4	Low	52.1	Low	122 Å²	122	140.6 Å²	140.6	64%	0.639	70%	0.699	S	S	*	*	H	α-helix	trans	-74.5	-29.6	174.3	-84.2	159.3	0	0	0	112.8	D4	D4-L6 VanDerWaalsContact C-N 3.31Å; D4-L6 PolarHBondContact O-N 3.04Å
7	K	51.3	Low	52.3	Low	163 Å²	163	145.5 Å²	145.5	71%	0.709	71%	0.708	S	S	*	*	H	α-helix	trans	-71.7	-33.3	173.2	-82.7	-175.7	176.3	-178.9	0	112	D4 Y9 K10	D4-K7 PolarHBondContact O-N 3.15Å; K7-Y9 VanDerWaalsContact C-N 3.28Å; K7-Y9 PolarHBondContact O-N 3.36Å; K7-K10 PolarHBondContact O-N 2.96Å
8	S	52.7	Low	52.4	Low	81 Å²	81	148.1 Å²	148.1	57%	0.566	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	-12.2	178.8	-156.8	0	0	0	0	114.7	D4 T11	D4-S8 PolarHBondContact O-N 2.86Å; S8-T11 PolarHBondContact O-OG1 2.99Å
9	Y	49.8	Very low	52.5	Low	184 Å²	184	144.2 Å²	144.2	72%	0.722	70%	0.7	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.8	-22.2	171.6	-104.1	-87.8	0	0	0	113	K7 T11	K7-Y9 VanDerWaalsContact C-N 3.28Å; K7-Y9 PolarHBondContact O-N 3.36Å; Y9-T11 VanDerWaalsContact C-N 3.3Å; Y9-T11 PolarHBondContact O-N 3Å
10	K	52.9	Low	52.7	Low	183 Å²	183	141.3 Å²	141.3	80%	0.796	69%	0.693	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.4	-13.7	178.6	-95	-175.2	173.9	-177.2	0	113.8	K7	K7-K10 PolarHBondContact O-N 2.96Å
11	T	53.6	Low	53.1	Low	105 Å²	105	141 Å²	141	64%	0.644	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.1	2.5	179.2	23.6	0	0	0	0	114.4	S8 Y9 T13	S8-T11 PolarHBondContact O-OG1 2.99Å; Y9-T11 VanDerWaalsContact C-N 3.3Å; Y9-T11 PolarHBondContact O-N 3Å; T11-T13 PolarHBondContact O-N 3.45Å
12	L	51.6	Low	53.5	Low	88 Å²	88	137.9 Å²	137.9	46%	0.461	67%	0.673	S	S	.	*			trans	-86.7	39.7	168.8	-79.6	166.3	0	0	0	112.5	Y14	L12-Y14 HydrophobicContact CD2-CD2 3.65Å; L12-Y14 HydrophobicContact CD2-CE2 3.63Å; L12-Y14 PolarHBondContact O-N 2.91Å
13	T	55	Low	54.1	Low	125 Å²	125	130.1 Å²	130.1	77%	0.767	65%	0.651	S	S	*	*			trans	-74	67.5	157.4	33.9	0	0	0	0	108.9	T11	T11-T13 PolarHBondContact O-N 3.45Å
14	Y	50.9	Low	54.4	Low	174 Å²	174	130.1 Å²	130.1	68%	0.682	64%	0.641	S	S	*	*			trans	-66.4	134.6	159.7	-93.2	-93.1	0	0	0	107.7	L12 T16	L12-Y14 HydrophobicContact CD2-CD2 3.65Å; L12-Y14 HydrophobicContact CD2-CE2 3.63Å; L12-Y14 PolarHBondContact O-N 2.91Å; Y14-T16 PolarHBondContact O-N 2.89Å
15	P	53.6	Low	55.1	Low	104 Å²	104	128.8 Å²	128.8	68%	0.675	63%	0.634	S	S	*	*			trans	-56.4	113	-178.8	21.9	-31.2	0	0	0	109.3	R17	P15-R17 PolarHBondContact O-N 3.01Å
16	T	57.1	Low	56.3	Low	107 Å²	107	125.6 Å²	125.6	66%	0.656	62%	0.624	S	S	*	*			trans	-69.3	37.4	177	33.1	0	0	0	0	112.8	Y14	Y14-T16 PolarHBondContact O-N 2.89Å
17	R	55.2	Low	57.1	Low	223 Å²	223	126.3 Å²	126.3	84%	0.842	62%	0.619	S	S	*	*	S	Bend	trans	-96.7	112.7	171	-72.6	-175.4	-179.2	-172.6	0.5	107.1	P15	P15-R17 PolarHBondContact O-N 3.01Å
18	H	54.2	Low	58.1	Low	192 Å²	192	122 Å²	122	89%	0.889	61%	0.608	S	S	*	*			trans	69.4	59.4	173.8	-83.6	-117.9	0	0	0	117.4
19	I	55.5	Low	59.1	Low	74 Å²	74	127.5 Å²	127.5	38%	0.379	62%	0.617	S	S	.	*			trans	-98.3	117	155.8	-57.3	176.1	0	0	0	107.2	Q21 A23 R24	I19-Q21 PolarHBondContact O-N 3.2Å; I19-A23 HydrophobicContact CG2-CB 3.67Å; I19-R24 HydrophobicContact CG2-CG 4.1Å
20	P	56.5	Low	60.4	Low	86 Å²	86	124.7 Å²	124.7	56%	0.558	61%	0.61	S	S	*	*			trans	-57.7	138.5	176.2	19.8	-28	0	0	0	109.7	Q22 A23 R24	P20-Q22 PolarHBondContact O-N 2.9Å; P20-A23 HydrophobicContact CG-CB 3.93Å; P20-A23 WeakPolarHBondContact O-CA 2.96Å; P20-A23 WeakPolarHBondContact O-CB 3.34Å; P20-A23 PolarHBondContact O-N 3.34Å; P20-R24 PolarHBondContact O-N 3.23Å
21	Q	60.3	Low	61.4	Low	136 Å²	136	119.3 Å²	119.3	64%	0.636	59%	0.593	S	S	*	*	H	α-helix	trans	-48.9	-34.4	-176.2	-165	82.8	21.7	0	0	112.4	I19 R24 N25	I19-Q21 PolarHBondContact O-N 3.2Å; Q21-R24 PolarHBondContact O-N 2.84Å; Q21-N25 PolarHBondContact O-N 2.92Å; Q21-N25 VanDerWaalsContact O-N 3.08Å
22	Q	59.5	Low	62.5	Low	159 Å²	159	119 Å²	119	74%	0.743	59%	0.586	S	S	*	*	H	α-helix	trans	-61.6	-41.9	174.4	-72.7	178.3	-18.3	0	0	113.2	P20 R24 N25 T26	P20-Q22 PolarHBondContact O-N 2.9Å; Q22-R24 VanDerWaalsContact C-N 3.35Å; Q22-N25 PolarHBondContact O-N 3.49Å; Q22-T26 PolarHBondContact O-N 2.77Å; Q22-T26 PolarHBondContact O-OG1 2.88Å
23	A	60.3	Low	63.6	Low	39 Å²	39	121.2 Å²	121.2	32%	0.322	59%	0.589	S	S	.	*	H	α-helix	trans	-70.5	-28.5	177.5	0	0	0	0	0	112.9	I19 P20 T26 R27	I19-A23 HydrophobicContact CG2-CB 3.67Å; P20-A23 HydrophobicContact CG-CB 3.93Å; P20-A23 WeakPolarHBondContact O-CA 2.96Å; P20-A23 WeakPolarHBondContact O-CB 3.34Å; P20-A23 PolarHBondContact O-N 3.34Å; A23-T26 WeakPolarHBondContact CA-OG1 3.49Å; A23-T26 PolarHBondContact O-OG1 3.33Å; A23-R27 WeakPolarHBondContact O-CB 3.49Å; A23-R27 PolarHBondContact O-N 3.39Å; A23-R27 VanDerWaalsContact O-N 3.17Å
24	R	59.9	Low	64.5	Low	125 Å²	125	119.2 Å²	119.2	47%	0.472	57%	0.574	S	S	.	*	H	α-helix	trans	-65	-45.9	167.7	-93.2	-175.1	171.1	178.9	-2.3	111.1	I19 P20 Q21 Q22 T26 R27 C28	I19-R24 HydrophobicContact CG2-CG 4.1Å; P20-R24 PolarHBondContact O-N 3.23Å; Q21-R24 PolarHBondContact O-N 2.84Å; Q22-R24 VanDerWaalsContact C-N 3.35Å; R24-T26 PolarHBondContact O-N 3.34Å; R24-R27 PolarHBondContact O-N 2.95Å; R24-C28 WeakPolarHBondContact O-CB 3.18Å; R24-C28 PolarHBondContact O-N 3.28Å; R24-C28 PolarHBondContact O-SG 3.49Å
25	N	66.9	Low	65.4	Low	90 Å²	90	115.4 Å²	115.4	48%	0.481	57%	0.565	S	S	.	*	H	α-helix	trans	-64.5	-39.3	-179.5	-72.7	-16.8	0	0	0	112.4	Q21 Q22 R29	Q21-N25 PolarHBondContact O-N 2.92Å; Q21-N25 VanDerWaalsContact O-N 3.08Å; Q22-N25 PolarHBondContact O-N 3.49Å; N25-R29 WeakPolarHBondContact O-CB 3.44Å; N25-R29 VanDerWaalsContact O-CG 3.3Å; N25-R29 WeakPolarHBondContact O-CG 3.21Å; N25-R29 PolarHBondContact O-N 2.9Å
26	T	72.1	Confident	66.2	Low	77 Å²	77	115.8 Å²	115.8	47%	0.472	56%	0.558	S	S	.	*	H	α-helix	trans	-66.9	-43.9	175.9	52	0	0	0	0	111.9	Q22 A23 R24 C28 R29 Q30	Q22-T26 PolarHBondContact O-N 2.77Å; Q22-T26 PolarHBondContact O-OG1 2.88Å; A23-T26 WeakPolarHBondContact CA-OG1 3.49Å; A23-T26 PolarHBondContact O-OG1 3.33Å; R24-T26 PolarHBondContact O-N 3.34Å; T26-C28 PolarHBondContact O-N 3.41Å; T26-R29 PolarHBondContact O-N 3.39Å; T26-Q30 WeakPolarHBondContact O-CB 3.45Å; T26-Q30 WeakPolarHBondContact O-CG 3.35Å; T26-Q30 PolarHBondContact O-N 3.19Å
27	R	70	Confident	66.8	Low	138 Å²	138	113.6 Å²	113.6	52%	0.521	54%	0.54	S	S	.	.	H	α-helix	trans	-63.1	-41.6	176.9	-167.9	177.6	-176.2	-172.2	1.5	112	A23 R24 Q30 T31	A23-R27 WeakPolarHBondContact O-CB 3.49Å; A23-R27 PolarHBondContact O-N 3.39Å; A23-R27 VanDerWaalsContact O-N 3.17Å; R24-R27 PolarHBondContact O-N 2.95Å; R27-Q30 PolarHBondContact O-N 2.93Å; R27-T31 WeakPolarHBondContact O-CB 3.37Å; R27-T31 PolarHBondContact O-N 2.86Å; R27-T31 PolarHBondContact O-OG1 2.92Å
28	C	73.1	Confident	67.3	Low	73 Å²	73	109.9 Å²	109.9	49%	0.493	53%	0.532	S	S	.	.	H	α-helix	trans	-62.2	-46.1	173.5	-70.9	0	0	0	0	111.3	R24 T26 Q30 T31 I32	R24-C28 WeakPolarHBondContact O-CB 3.18Å; R24-C28 PolarHBondContact O-N 3.28Å; R24-C28 PolarHBondContact O-SG 3.49Å; T26-C28 PolarHBondContact O-N 3.41Å; C28-Q30 PolarHBondContact O-N 2.9Å; C28-T31 PolarHBondContact O-N 3.39Å; C28-I32 VanDerWaalsContact O-CG1 3.3Å; C28-I32 WeakPolarHBondContact O-CG1 3.33Å; C28-I32 PolarHBondContact O-N 3.41Å
29	R	73.8	Confident	67.6	Low	195 Å²	195	103.9 Å²	103.9	74%	0.736	51%	0.507	S	S	*	.	H	α-helix	trans	-61.2	-43.5	176.5	-79.6	179.2	168.7	-161.6	-2.9	112.6	N25 T26 T31 I32 Y33	N25-R29 WeakPolarHBondContact O-CB 3.44Å; N25-R29 VanDerWaalsContact O-CG 3.3Å; N25-R29 WeakPolarHBondContact O-CG 3.21Å; N25-R29 PolarHBondContact O-N 2.9Å; T26-R29 PolarHBondContact O-N 3.39Å; R29-T31 VanDerWaalsContact C-N 3.33Å; R29-I32 PolarHBondContact O-N 3.18Å; R29-Y33 VanDerWaalsContact O-CB 3.23Å; R29-Y33 WeakPolarHBondContact O-CB 3.15Å; R29-Y33 PolarHBondContact O-N 2.82Å
30	Q	75.6	Confident	67.8	Low	125 Å²	125	105.6 Å²	105.6	58%	0.584	51%	0.511	S	S	*	.	H	α-helix	trans	-63.9	-39.5	175.8	-76.1	176	-18.5	0	0	111.6	T26 R27 C28 Y33 N34	T26-Q30 WeakPolarHBondContact O-CB 3.45Å; T26-Q30 WeakPolarHBondContact O-CG 3.35Å; T26-Q30 PolarHBondContact O-N 3.19Å; R27-Q30 PolarHBondContact O-N 2.93Å; C28-Q30 PolarHBondContact O-N 2.9Å; Q30-Y33 PolarHBondContact O-N 2.85Å; Q30-N34 VanDerWaalsContact O-CB 3.23Å; Q30-N34 WeakPolarHBondContact O-CB 3.39Å; Q30-N34 PolarHBondContact O-N 3.37Å; Q30-N34 PolarHBondContact O-ND2 3.26Å
31	T	75.6	Confident	67.9	Low	70 Å²	70	105.5 Å²	105.5	43%	0.429	51%	0.51	S	S	.	.	H	α-helix	trans	-66.5	-45.3	177.4	-54.3	0	0	0	0	110.8	R27 C28 R29 N34 L35	R27-T31 WeakPolarHBondContact O-CB 3.37Å; R27-T31 PolarHBondContact O-N 2.86Å; R27-T31 PolarHBondContact O-OG1 2.92Å; C28-T31 PolarHBondContact O-N 3.39Å; R29-T31 VanDerWaalsContact C-N 3.33Å; T31-N34 PolarHBondContact O-N 3.09Å; T31-L35 HydrophobicContact CG2-CD1 4.05Å; T31-L35 HydrophobicContact CG2-CG 4.46Å; T31-L35 WeakPolarHBondContact O-CB 3.28Å; T31-L35 VanDerWaalsContact O-CG 3.23Å; T31-L35 WeakPolarHBondContact O-CG 3.28Å; T31-L35 PolarHBondContact O-N 3.22Å
32	I	76.3	Confident	68.1	Low	99 Å²	99	103.5 Å²	103.5	51%	0.508	50%	0.504	S	S	.	.	H	α-helix	trans	-62.7	-47.1	175.6	-66.1	164.7	0	0	0	110.2	C28 R29 N34 L35 E36	C28-I32 VanDerWaalsContact O-CG1 3.3Å; C28-I32 WeakPolarHBondContact O-CG1 3.33Å; C28-I32 PolarHBondContact O-N 3.41Å; R29-I32 PolarHBondContact O-N 3.18Å; I32-N34 VanDerWaalsContact C-N 3.34Å; I32-N34 PolarHBondContact O-N 3.33Å; I32-L35 PolarHBondContact O-N 3.35Å; I32-E36 HydrophobicContact CG2-CG 4.34Å; I32-E36 WeakPolarHBondContact O-CB 3.37Å; I32-E36 WeakPolarHBondContact O-CG 3.45Å; I32-E36 PolarHBondContact O-N 3.22Å
33	Y	74.7	Confident	68.3	Low	134 Å²	134	102.4 Å²	102.4	53%	0.525	50%	0.496	S	S	.	.	H	α-helix	trans	-57.6	-47	176.9	-179.5	-88.1	0	0	0	111.4	R29 Q30 E36 H37	R29-Y33 VanDerWaalsContact O-CB 3.23Å; R29-Y33 WeakPolarHBondContact O-CB 3.15Å; R29-Y33 PolarHBondContact O-N 2.82Å; Q30-Y33 PolarHBondContact O-N 2.85Å; Y33-E36 PolarHBondContact O-N 3.03Å; Y33-H37 AromaticContact CD1-ND1 3.81Å; Y33-H37 AromaticContact CD2-CE1 3.37Å; Y33-H37 WeakPolarHBondContact CD2-CE1 2.95Å; Y33-H37 AromaticContact CD2-ND1 3.63Å; Y33-H37 HydrophobicContact CE1-CB 4.5Å; Y33-H37 AromaticContact CE1-CD2 3.99Å; Y33-H37 AromaticContact CE1-CE1 3.92Å; Y33-H37 AromaticContact CE1-CG 3.82Å; Y33-H37 AromaticContact CE1-ND1 3.75Å; Y33-H37 AromaticContact CE2-CE1 3.01Å; Y33-H37 WeakPolarHBondContact CE2-CE1 3.2Å; Y33-H37 AromaticContact CE2-ND1 3.6Å; Y33-H37 AromaticContact CE2-NE2 3.45Å; Y33-H37 WeakPolarHBondContact CE2-NE2 3.27Å; Y33-H37 AromaticContact CG-CE1 3.97Å; Y33-H37 AromaticContact CG-ND1 3.75Å; Y33-H37 AromaticContact CZ-CD2 3.66Å; Y33-H37 AromaticContact CZ-CE1 3.31Å; Y33-H37 AromaticContact CZ-CG 3.87Å; Y33-H37 AromaticContact CZ-ND1 3.64Å; Y33-H37 AromaticContact CZ-NE2 3.35Å; Y33-H37 VanDerWaalsContact O-CB 3.3Å; Y33-H37 WeakPolarHBondContact O-CB 3.4Å; Y33-H37 PolarHBondContact O-N 2.76Å; Y33-H37 PolarHBondContact O-ND1 2.9Å; Y33-H37 PolarHBondContact OH-NE2 3.01Å
34	N	74.2	Confident	68.6	Low	83 Å²	83	104.4 Å²	104.4	44%	0.444	51%	0.505	S	S	.	.	H	α-helix	trans	-64.5	-41.9	177.4	-73.7	-13.6	0	0	0	111.4	Q30 T31 I32 H37 Q38	Q30-N34 VanDerWaalsContact O-CB 3.23Å; Q30-N34 WeakPolarHBondContact O-CB 3.39Å; Q30-N34 PolarHBondContact O-N 3.37Å; Q30-N34 PolarHBondContact O-ND2 3.26Å; T31-N34 PolarHBondContact O-N 3.09Å; I32-N34 VanDerWaalsContact C-N 3.34Å; I32-N34 PolarHBondContact O-N 3.33Å; N34-H37 PolarHBondContact O-N 2.85Å; N34-Q38 WeakPolarHBondContact O-CA 3.26Å; N34-Q38 WeakPolarHBondContact O-CB 3.4Å; N34-Q38 VanDerWaalsContact O-CG 3.24Å; N34-Q38 WeakPolarHBondContact O-CG 3.37Å; N34-Q38 PolarHBondContact O-N 3.48Å
35	L	69.2	Low	68.9	Low	95 Å²	95	105.2 Å²	105.2	50%	0.497	51%	0.509	S	S	.	.	H	α-helix	trans	-63.7	-43	175.3	-74.2	170.3	0	0	0	111.2	T31 I32 N39	T31-L35 HydrophobicContact CG2-CD1 4.05Å; T31-L35 HydrophobicContact CG2-CG 4.46Å; T31-L35 WeakPolarHBondContact O-CB 3.28Å; T31-L35 VanDerWaalsContact O-CG 3.23Å; T31-L35 WeakPolarHBondContact O-CG 3.28Å; T31-L35 PolarHBondContact O-N 3.22Å; I32-L35 PolarHBondContact O-N 3.35Å; L35-N39 WeakPolarHBondContact O-CB 3.42Å; L35-N39 VanDerWaalsContact O-CG 3.28Å; L35-N39 PolarHBondContact O-N 2.74Å; L35-N39 PolarHBondContact O-ND2 3.13Å
36	E	70.1	Confident	69	Low	112 Å²	112	105.9 Å²	105.9	52%	0.523	51%	0.509	S	S	.	.	H	α-helix	trans	-66.5	-40.4	177.5	-72.6	-162.2	115.8	0	0	111.8	I32 Y33 K40	I32-E36 HydrophobicContact CG2-CG 4.34Å; I32-E36 WeakPolarHBondContact O-CB 3.37Å; I32-E36 WeakPolarHBondContact O-CG 3.45Å; I32-E36 PolarHBondContact O-N 3.22Å; Y33-E36 PolarHBondContact O-N 3.03Å; E36-K40 WeakPolarHBondContact O-CG 3.43Å; E36-K40 PolarHBondContact O-N 3.24Å; E36-K40 VanDerWaalsContact O-N 3.1Å
37	H	69.1	Low	69	Low	60 Å²	60	111.5 Å²	111.5	28%	0.278	52%	0.521	S	S	.	.	H	α-helix	trans	-78.9	-38.3	-178.1	-73.5	66.7	0	0	0	113.1	Y33 N34 N39 K40 P41	Y33-H37 AromaticContact CD1-ND1 3.81Å; Y33-H37 AromaticContact CD2-CE1 3.37Å; Y33-H37 WeakPolarHBondContact CD2-CE1 2.95Å; Y33-H37 AromaticContact CD2-ND1 3.63Å; Y33-H37 HydrophobicContact CE1-CB 4.5Å; Y33-H37 AromaticContact CE1-CD2 3.99Å; Y33-H37 AromaticContact CE1-CE1 3.92Å; Y33-H37 AromaticContact CE1-CG 3.82Å; Y33-H37 AromaticContact CE1-ND1 3.75Å; Y33-H37 AromaticContact CE2-CE1 3.01Å; Y33-H37 WeakPolarHBondContact CE2-CE1 3.2Å; Y33-H37 AromaticContact CE2-ND1 3.6Å; Y33-H37 AromaticContact CE2-NE2 3.45Å; Y33-H37 WeakPolarHBondContact CE2-NE2 3.27Å; Y33-H37 AromaticContact CG-CE1 3.97Å; Y33-H37 AromaticContact CG-ND1 3.75Å; Y33-H37 AromaticContact CZ-CD2 3.66Å; Y33-H37 AromaticContact CZ-CE1 3.31Å; Y33-H37 AromaticContact CZ-CG 3.87Å; Y33-H37 AromaticContact CZ-ND1 3.64Å; Y33-H37 AromaticContact CZ-NE2 3.35Å; Y33-H37 VanDerWaalsContact O-CB 3.3Å; Y33-H37 WeakPolarHBondContact O-CB 3.4Å; Y33-H37 PolarHBondContact O-N 2.76Å; Y33-H37 PolarHBondContact O-ND1 2.9Å; Y33-H37 PolarHBondContact OH-NE2 3.01Å; N34-H37 PolarHBondContact O-N 2.85Å; H37-N39 VanDerWaalsContact C-N 3.27Å; H37-N39 PolarHBondContact O-N 3.1Å; H37-K40 PolarHBondContact CD2-NZ 3.39Å; H37-K40 PolarHBondContact NE2-NZ 2.83Å; H37-K40 VanDerWaalsContact O-CB 3.29Å; H37-K40 WeakPolarHBondContact O-CB 3.48Å; H37-K40 PolarHBondContact O-N 3.47Å; H37-K40 VanDerWaalsContact O-N 3.13Å; H37-P41 VanDerWaalsContact O-CD 3.29Å; H37-P41 WeakPolarHBondContact O-CD 3.19Å
38	Q	66.1	Low	69.1	Low	146 Å²	146	108.6 Å²	108.6	68%	0.682	52%	0.516	S	S	*	.	H	α-helix	trans	-70.2	-25.8	172.4	-70.6	-169.7	-18	0	0	112	N34 P41	N34-Q38 WeakPolarHBondContact O-CA 3.26Å; N34-Q38 WeakPolarHBondContact O-CB 3.4Å; N34-Q38 VanDerWaalsContact O-CG 3.24Å; N34-Q38 WeakPolarHBondContact O-CG 3.37Å; N34-Q38 PolarHBondContact O-N 3.48Å; Q38-P41 WeakPolarHBondContact O-CD 3.13Å; Q38-P41 WeakPolarHBondContact O-CG 3.29Å
39	N	60.8	Low	69	Low	66 Å²	66	108.8 Å²	108.8	35%	0.353	51%	0.509	S	S	.	.	H	α-helix	trans	-84.5	-7.4	169.5	-73.7	-57.6	0	0	0	113.7	L35 H37 L42 K43	L35-N39 WeakPolarHBondContact O-CB 3.42Å; L35-N39 VanDerWaalsContact O-CG 3.28Å; L35-N39 PolarHBondContact O-N 2.74Å; L35-N39 PolarHBondContact O-ND2 3.13Å; H37-N39 VanDerWaalsContact C-N 3.27Å; H37-N39 PolarHBondContact O-N 3.1Å; N39-L42 PolarHBondContact O-N 3.33Å; N39-K43 PolarHBondContact O-N 3.41Å
40	K	59.7	Low	68.8	Low	109 Å²	109	107.2 Å²	107.2	47%	0.474	50%	0.503	S	S	.	.	H	α-helix	trans	-56.1	-49	170.6	-76.2	175.6	-179.5	-177.5	0	111.9	E36 H37 L42 K43 V44	E36-K40 WeakPolarHBondContact O-CG 3.43Å; E36-K40 PolarHBondContact O-N 3.24Å; E36-K40 VanDerWaalsContact O-N 3.1Å; H37-K40 PolarHBondContact CD2-NZ 3.39Å; H37-K40 PolarHBondContact NE2-NZ 2.83Å; H37-K40 VanDerWaalsContact O-CB 3.29Å; H37-K40 WeakPolarHBondContact O-CB 3.48Å; H37-K40 PolarHBondContact O-N 3.47Å; H37-K40 VanDerWaalsContact O-N 3.13Å; K40-L42 VanDerWaalsContact C-N 3.25Å; K40-L42 PolarHBondContact O-N 3.2Å; K40-K43 PolarHBondContact O-N 2.84Å; K40-V44 WeakPolarHBondContact O-CB 3.35Å; K40-V44 WeakPolarHBondContact O-CG2 3.36Å; K40-V44 PolarHBondContact O-N 3.39Å
41	P	59.5	Low	68.5	Low	84 Å²	84	105 Å²	105	55%	0.545	50%	0.498	S	S	.	.	H	α-helix	trans	-61.7	-35.2	176.4	23.3	-34.3	0	0	0	111.9	H37 Q38 Y45	H37-P41 VanDerWaalsContact O-CD 3.29Å; H37-P41 WeakPolarHBondContact O-CD 3.19Å; Q38-P41 WeakPolarHBondContact O-CD 3.13Å; Q38-P41 WeakPolarHBondContact O-CG 3.29Å; P41-Y45 WeakPolarHBondContact O-CB 3.24Å; P41-Y45 PolarHBondContact O-N 2.79Å
42	L	63.1	Low	68.1	Low	94 Å²	94	107.2 Å²	107.2	49%	0.492	50%	0.502	S	S	.	.	H	α-helix	trans	-69	-44.7	178.9	-150.8	85.6	0	0	0	112.4	N39 K40 Y45 Q46	N39-L42 PolarHBondContact O-N 3.33Å; K40-L42 VanDerWaalsContact C-N 3.25Å; K40-L42 PolarHBondContact O-N 3.2Å; L42-Y45 PolarHBondContact O-N 3.4Å; L42-Q46 WeakPolarHBondContact O-CB 3.14Å; L42-Q46 WeakPolarHBondContact O-CG 3.49Å; L42-Q46 PolarHBondContact O-N 2.94Å
43	K	63.9	Low	67.4	Low	136 Å²	136	108.2 Å²	108.2	59%	0.591	50%	0.504	S	S	*	.	H	α-helix	trans	-65.4	-40	175.8	-73.9	-177.4	177.7	178	0	111.5	N39 K40 R47	N39-K43 PolarHBondContact O-N 3.41Å; K40-K43 PolarHBondContact O-N 2.84Å; K43-R47 WeakPolarHBondContact O-CB 3.2Å; K43-R47 PolarHBondContact O-N 2.75Å
44	V	66.7	Low	66.7	Low	82 Å²	82	109 Å²	109	50%	0.497	51%	0.507	S	S	.	.	H	α-helix	trans	-65.2	-45.5	175	171.7	0	0	0	0	110.4	K40 R47 I48	K40-V44 WeakPolarHBondContact O-CB 3.35Å; K40-V44 WeakPolarHBondContact O-CG2 3.36Å; K40-V44 PolarHBondContact O-N 3.39Å; V44-R47 PolarHBondContact O-N 3.24Å; V44-I48 HydrophobicContact CG1-CD1 3.7Å; V44-I48 HydrophobicContact CG1-CG1 4.36Å; V44-I48 VanDerWaalsContact O-CG1 3.27Å; V44-I48 WeakPolarHBondContact O-CG1 3.23Å; V44-I48 PolarHBondContact O-N 2.83Å
45	Y	66.5	Low	66	Low	142 Å²	142	107.5 Å²	107.5	56%	0.557	50%	0.504	S	S	*	.	H	α-helix	trans	-60.9	-46.8	175.9	-174.7	-94.9	0	0	0	111.8	P41 L42 R47 I48 Q49	P41-Y45 WeakPolarHBondContact O-CB 3.24Å; P41-Y45 PolarHBondContact O-N 2.79Å; L42-Y45 PolarHBondContact O-N 3.4Å; Y45-R47 VanDerWaalsContact C-N 3.31Å; Y45-R47 PolarHBondContact O-N 2.81Å; Y45-I48 PolarHBondContact O-N 2.84Å; Y45-Q49 HydrophobicContact CD1-CG 3.89Å; Y45-Q49 HydrophobicContact CE1-CG 3.58Å; Y45-Q49 HydrophobicContact CG-CG 4.48Å; Y45-Q49 WeakPolarHBondContact O-CB 3.36Å; Y45-Q49 VanDerWaalsContact O-CG 3.28Å; Y45-Q49 WeakPolarHBondContact O-CG 3.4Å; Y45-Q49 PolarHBondContact O-N 3.24Å; Y45-Q49 PolarHBondContact OH-NE2 3.29Å
46	Q	69	Low	65.4	Low	104 Å²	104	108.4 Å²	108.4	49%	0.486	51%	0.508	S	S	.	.	H	α-helix	trans	-60	-40.2	174.9	-78	179.6	-4	0	0	112.2	L42 Q49 R50	L42-Q46 WeakPolarHBondContact O-CB 3.14Å; L42-Q46 WeakPolarHBondContact O-CG 3.49Å; L42-Q46 PolarHBondContact O-N 2.94Å; Q46-Q49 PolarHBondContact O-N 2.82Å; Q46-R50 WeakPolarHBondContact O-CB 3.47Å; Q46-R50 WeakPolarHBondContact O-CG 3.41Å; Q46-R50 PolarHBondContact O-N 2.82Å
47	R	73.4	Confident	64.7	Low	194 Å²	194	108 Å²	108	73%	0.732	51%	0.508	S	S	*	.	H	α-helix	trans	-64.6	-45.4	175.4	-170.8	177.5	-178.7	-179	0.2	111.4	K43 V44 Y45 R50 T51	K43-R47 WeakPolarHBondContact O-CB 3.2Å; K43-R47 PolarHBondContact O-N 2.75Å; V44-R47 PolarHBondContact O-N 3.24Å; Y45-R47 VanDerWaalsContact C-N 3.31Å; Y45-R47 PolarHBondContact O-N 2.81Å; R47-R50 PolarHBondContact O-N 2.95Å; R47-T51 PolarHBondContact O-N 3.37Å; R47-T51 PolarHBondContact O-OG1 2.93Å; R47-T51 VanDerWaalsContact O-OG1 3.09Å
48	I	71.9	Confident	64.1	Low	78 Å²	78	113.9 Å²	113.9	40%	0.4	53%	0.533	S	S	.	.	H	α-helix	trans	-61.8	-43.6	177.3	-68.8	167.3	0	0	0	110.8	V44 Y45 T51 K52	V44-I48 HydrophobicContact CG1-CD1 3.7Å; V44-I48 HydrophobicContact CG1-CG1 4.36Å; V44-I48 VanDerWaalsContact O-CG1 3.27Å; V44-I48 WeakPolarHBondContact O-CG1 3.23Å; V44-I48 PolarHBondContact O-N 2.83Å; Y45-I48 PolarHBondContact O-N 2.84Å; I48-T51 VanDerWaalsContact CA-OG1 3.26Å; I48-T51 WeakPolarHBondContact CA-OG1 3.16Å; I48-T51 PolarHBondContact O-N 3.49Å; I48-T51 PolarHBondContact O-OG1 2.88Å; I48-K52 HydrophobicContact CG2-CD 4.38Å; I48-K52 WeakPolarHBondContact O-CB 3.23Å; I48-K52 WeakPolarHBondContact O-CG 3.29Å; I48-K52 PolarHBondContact O-N 3.47Å
49	Q	71.1	Confident	63.5	Low	77 Å²	77	113.2 Å²	113.2	36%	0.36	53%	0.534	S	S	.	.	H	α-helix	trans	-63	-45	177.1	-72.4	-64.9	-9.8	0	0	111.6	Y45 Q46 T51 K52 Q53	Y45-Q49 HydrophobicContact CD1-CG 3.89Å; Y45-Q49 HydrophobicContact CE1-CG 3.58Å; Y45-Q49 HydrophobicContact CG-CG 4.48Å; Y45-Q49 WeakPolarHBondContact O-CB 3.36Å; Y45-Q49 VanDerWaalsContact O-CG 3.28Å; Y45-Q49 WeakPolarHBondContact O-CG 3.4Å; Y45-Q49 PolarHBondContact O-N 3.24Å; Y45-Q49 PolarHBondContact OH-NE2 3.29Å; Q46-Q49 PolarHBondContact O-N 2.82Å; Q49-T51 PolarHBondContact O-N 3.47Å; Q49-K52 PolarHBondContact O-N 3.42Å; Q49-Q53 WeakPolarHBondContact O-CB 3.3Å; Q49-Q53 PolarHBondContact O-N 2.95Å
50	R	68.3	Low	63	Low	162 Å²	162	114.1 Å²	114.1	61%	0.611	55%	0.545	S	S	*	.	H	α-helix	trans	-60.1	-46.7	173.8	-76.5	-177.2	-179	-176.9	1	111.5	Q46 R47 K52 Q53 Y54	Q46-R50 WeakPolarHBondContact O-CB 3.47Å; Q46-R50 WeakPolarHBondContact O-CG 3.41Å; Q46-R50 PolarHBondContact O-N 2.82Å; R47-R50 PolarHBondContact O-N 2.95Å; R50-K52 VanDerWaalsContact C-N 3.32Å; R50-K52 PolarHBondContact O-N 3.47Å; R50-Q53 PolarHBondContact O-N 2.91Å; R50-Y54 HydrophobicContact CB-CD2 4.37Å; R50-Y54 HydrophobicContact CB-CE2 4.11Å; R50-Y54 WeakPolarHBondContact O-CD2 3.01Å; R50-Y54 PolarHBondContact O-N 3.03Å
51	T	69.4	Low	62.4	Low	78 Å²	78	113.1 Å²	113.1	48%	0.479	55%	0.549	S	S	.	.	H	α-helix	trans	-62	-39.1	177.6	47.2	0	0	0	0	112.5	R47 I48 Q49 Y54 S55	R47-T51 PolarHBondContact O-N 3.37Å; R47-T51 PolarHBondContact O-OG1 2.93Å; R47-T51 VanDerWaalsContact O-OG1 3.09Å; I48-T51 VanDerWaalsContact CA-OG1 3.26Å; I48-T51 WeakPolarHBondContact CA-OG1 3.16Å; I48-T51 PolarHBondContact O-N 3.49Å; I48-T51 PolarHBondContact O-OG1 2.88Å; Q49-T51 PolarHBondContact O-N 3.47Å; T51-Y54 PolarHBondContact O-N 3.36Å; T51-S55 PolarHBondContact O-N 3.17Å; T51-S55 PolarHBondContact O-OG 2.98Å
52	K	67.4	Low	62	Low	116 Å²	116	117.4 Å²	117.4	50%	0.504	57%	0.567	S	S	.	*	H	α-helix	trans	-62.9	-43.4	174.1	-77.5	-175.7	177.5	-171.7	0	111.5	I48 Q49 R50 S55 I56	I48-K52 HydrophobicContact CG2-CD 4.38Å; I48-K52 WeakPolarHBondContact O-CB 3.23Å; I48-K52 WeakPolarHBondContact O-CG 3.29Å; I48-K52 PolarHBondContact O-N 3.47Å; Q49-K52 PolarHBondContact O-N 3.42Å; R50-K52 VanDerWaalsContact C-N 3.32Å; R50-K52 PolarHBondContact O-N 3.47Å; K52-S55 WeakPolarHBondContact CA-OG 3.37Å; K52-S55 PolarHBondContact O-N 3.3Å; K52-S55 PolarHBondContact O-OG 2.81Å; K52-I56 WeakPolarHBondContact O-CB 3.41Å; K52-I56 WeakPolarHBondContact O-CD1 3.23Å; K52-I56 WeakPolarHBondContact O-CG1 3.3Å; K52-I56 PolarHBondContact O-N 3.44Å
53	Q	62	Low	61.4	Low	120 Å²	120	121.2 Å²	121.2	56%	0.561	58%	0.582	S	S	*	*	H	α-helix	trans	-64.1	-42.9	177.6	-169.2	173.9	-7.7	0	0	111.6	Q49 R50 I56 I57	Q49-Q53 WeakPolarHBondContact O-CB 3.3Å; Q49-Q53 PolarHBondContact O-N 2.95Å; R50-Q53 PolarHBondContact O-N 2.91Å; Q53-I56 PolarHBondContact O-N 3.23Å; Q53-I57 HydrophobicContact CG-CD1 3.88Å; Q53-I57 WeakPolarHBondContact O-CB 3.45Å; Q53-I57 WeakPolarHBondContact O-CD1 3.47Å; Q53-I57 WeakPolarHBondContact O-CG1 3.4Å; Q53-I57 PolarHBondContact O-N 3.47Å
54	Y	59.1	Low	60.2	Low	150 Å²	150	124.8 Å²	124.8	59%	0.588	62%	0.615	S	S	*	*	H	α-helix	trans	-67	-35.8	175.5	-71.5	-64.2	0	0	0	113	R50 T51 K58	R50-Y54 HydrophobicContact CB-CD2 4.37Å; R50-Y54 HydrophobicContact CB-CE2 4.11Å; R50-Y54 WeakPolarHBondContact O-CD2 3.01Å; R50-Y54 PolarHBondContact O-N 3.03Å; T51-Y54 PolarHBondContact O-N 3.36Å; Y54-K58 WeakPolarHBondContact O-CB 3.47Å; Y54-K58 WeakPolarHBondContact O-CG 3.45Å; Y54-K58 PolarHBondContact O-N 3.33Å
55	S	59.1	Low	59.9	Low	53 Å²	53	127 Å²	127	37%	0.371	62%	0.621	S	S	.	*	H	α-helix	trans	-70.7	-36.1	174.9	53.7	0	0	0	0	111.9	T51 K52 K58 L59	T51-S55 PolarHBondContact O-N 3.17Å; T51-S55 PolarHBondContact O-OG 2.98Å; K52-S55 WeakPolarHBondContact CA-OG 3.37Å; K52-S55 PolarHBondContact O-N 3.3Å; K52-S55 PolarHBondContact O-OG 2.81Å; S55-K58 PolarHBondContact O-N 3.29Å; S55-L59 WeakPolarHBondContact O-CB 3.35Å; S55-L59 WeakPolarHBondContact O-CD1 3.36Å; S55-L59 VanDerWaalsContact O-CG 3.28Å; S55-L59 WeakPolarHBondContact O-CG 3.3Å; S55-L59 PolarHBondContact O-N 3.08Å
56	I	56.6	Low	59.6	Low	114 Å²	114	126.2 Å²	126.2	59%	0.585	62%	0.624	S	S	*	*	H	α-helix	trans	-67.5	-39.2	175.1	-67.7	161.7	0	0	0	111.3	K52 Q53 S60	K52-I56 WeakPolarHBondContact O-CB 3.41Å; K52-I56 WeakPolarHBondContact O-CD1 3.23Å; K52-I56 WeakPolarHBondContact O-CG1 3.3Å; K52-I56 PolarHBondContact O-N 3.44Å; Q53-I56 PolarHBondContact O-N 3.23Å; I56-S60 PolarHBondContact O-N 2.77Å; I56-S60 VanDerWaalsContact O-N 3.15Å; I56-S60 PolarHBondContact O-OG 2.96Å; I56-S60 VanDerWaalsContact O-OG 3.04Å
57	I	56.5	Low	59.1	Low	103 Å²	103	127.4 Å²	127.4	53%	0.528	63%	0.632	S	S	.	*	H	α-helix	trans	-71.7	-33.8	177.8	-65.2	164.7	0	0	0	111.5	Q53	Q53-I57 HydrophobicContact CG-CD1 3.88Å; Q53-I57 WeakPolarHBondContact O-CB 3.45Å; Q53-I57 WeakPolarHBondContact O-CD1 3.47Å; Q53-I57 WeakPolarHBondContact O-CG1 3.4Å; Q53-I57 PolarHBondContact O-N 3.47Å
58	K	55.3	Low	58.2	Low	183 Å²	183	123.5 Å²	123.5	80%	0.796	63%	0.626	S	S	*	*	H	α-helix	trans	-82.1	-18.7	176.4	-73.4	-174.2	176.5	-171.5	0	114.4	Y54 S55	Y54-K58 WeakPolarHBondContact O-CB 3.47Å; Y54-K58 WeakPolarHBondContact O-CG 3.45Å; Y54-K58 PolarHBondContact O-N 3.33Å; S55-K58 PolarHBondContact O-N 3.29Å
59	L	54.6	Low	57.4	Low	133 Å²	133	126.3 Å²	126.3	70%	0.696	64%	0.64	S	S	*	*	S	Bend	trans	-98.8	4.9	175.3	-73.1	162	0	0	0	112.8	S55 P61	S55-L59 WeakPolarHBondContact O-CB 3.35Å; S55-L59 WeakPolarHBondContact O-CD1 3.36Å; S55-L59 VanDerWaalsContact O-CG 3.28Å; S55-L59 WeakPolarHBondContact O-CG 3.3Å; S55-L59 PolarHBondContact O-N 3.08Å; L59-P61 WeakPolarHBondContact O-CD 3.46Å; L59-P61 WeakPolarHBondContact O-CG 3.44Å; L59-P61 VanDerWaalsContact O-N 3.16Å
60	S	49.7	Very low	56.4	Low	84 Å²	84	129.6 Å²	129.6	59%	0.587	66%	0.659	S	S	*	*	S	Bend	trans	-71.6	96.9	161.5	-64.2	0	0	0	0	106.7	I56	I56-S60 PolarHBondContact O-N 2.77Å; I56-S60 VanDerWaalsContact O-N 3.15Å; I56-S60 PolarHBondContact O-OG 2.96Å; I56-S60 VanDerWaalsContact O-OG 3.04Å
61	P	46.5	Very low	55.6	Low	88 Å²	88	127.3 Å²	127.3	57%	0.571	66%	0.663	S	S	*	*			trans	-76.5	152.8	-172	-1.3	22.5	0	0	0	108.1	L59 Q63	L59-P61 WeakPolarHBondContact O-CD 3.46Å; L59-P61 WeakPolarHBondContact O-CG 3.44Å; L59-P61 VanDerWaalsContact O-N 3.16Å; P61-Q63 PolarHBondContact O-N 3.22Å
62	L	52.9	Low	54.5	Low	174 Å²	174	131.1 Å²	131.1	91%	0.911	68%	0.677	S	S	*	*			trans	-38.5	103.2	154.2	-68.5	87.8	0	0	0	109.7
63	Q	49	Very low	53.5	Low	174 Å²	174	132.3 Å²	132.3	81%	0.813	69%	0.691	S	S	*	*			trans	-121.9	59	169.1	-77.9	-172.9	-82.5	0	0	108.1	P61	P61-Q63 PolarHBondContact O-N 3.22Å
64	V	40.1	Very low	52.7	Low	212 Å²	212	133.5 Å²	133.5	100%	1.285	70%	0.703	S	S	*	*			trans	-162.6	0	141.2	-167.8	0	0	0	0	106.8

Retrieved 64 of 64 residues in 18.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).