A0A5K4F689_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F689, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 68 aa.

						>A0A5K4F689_SCHMA|A0A5K4F689
MKKLNKNNGCSKCFNWKKKYNVQSVAHNLIDSLKTITYQYYNIKSDKTTMLNRQSNKSLFDNVKTDQR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.2	Very low	57.2	Low	243 Å²	243	148.8 Å²	148.8	100%	1.197	78%	0.778	S	S	*	*				0	112.2	0	-70.4	176.8	167.8	0	0	109.2	K3	M1-K3 PolarHBondContact O-N 3.44Å
2	K	43.9	Very low	58.7	Low	214 Å²	214	149.8 Å²	149.8	93%	0.93	77%	0.771	S	S	*	*			trans	-76.6	117.8	176.5	-82.2	-178.8	175.9	176.6	0	109	L4	K2-L4 PolarHBondContact O-N 3.37Å
3	K	49.6	Very low	60	Low	208 Å²	208	144.4 Å²	144.4	90%	0.904	75%	0.753	S	S	*	*			trans	-62.4	119.1	172.7	-72.7	176.8	176.5	176.9	0	108.8	M1 N5	M1-K3 PolarHBondContact O-N 3.44Å; K3-N5 PolarHBondContact O-N 2.96Å
4	L	53.8	Low	61	Low	171 Å²	171	144.3 Å²	144.3	90%	0.895	74%	0.744	S	S	*	*			trans	-65.2	103.9	167.1	-84.2	158	0	0	0	108	K2 K6	K2-L4 PolarHBondContact O-N 3.37Å; L4-K6 PolarHBondContact O-N 3.31Å
5	N	55.1	Low	62.2	Low	98 Å²	98	141.5 Å²	141.5	52%	0.524	73%	0.731	S	S	.	*			trans	-67.3	111.8	170.2	-170.7	-9	0	0	0	107.7	K3 N7 N8	K3-N5 PolarHBondContact O-N 2.96Å; N5-N7 PolarHBondContact O-N 3.33Å; N5-N7 PolarHBondContact OD1-N 3.09Å; N5-N8 PolarHBondContact O-N 3.48Å
6	K	58.5	Low	63.3	Low	207 Å²	207	145 Å²	145	90%	0.9	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.1	-7.8	179.8	-79.5	179.9	174.7	176.6	0	113.4	L4	L4-K6 PolarHBondContact O-N 3.31Å
7	N	58.3	Low	64.4	Low	141 Å²	141	146 Å²	146	75%	0.754	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.8	2.5	177.8	-64.6	-10.3	0	0	0	114.6	N5 G9	N5-N7 PolarHBondContact O-N 3.33Å; N5-N7 PolarHBondContact OD1-N 3.09Å; N7-G9 VanDerWaalsContact C-N 3.29Å; N7-G9 PolarHBondContact O-N 3.06Å
8	N	57.1	Low	65.4	Low	137 Å²	137	145.5 Å²	145.5	73%	0.733	72%	0.723	S	S	*	*			trans	-88.5	49.3	176.9	-98.3	25.9	0	0	0	113.1	N5 C10	N5-N8 PolarHBondContact O-N 3.48Å; N8-C10 PolarHBondContact O-N 3.16Å
9	G	63.2	Low	66.4	Low	63 Å²	63	144.7 Å²	144.7	65%	0.649	72%	0.715	S	S	*	*			trans	-62.7	124.9	169.6	0	0	0	0	0	110.1	N7 S11	N7-G9 VanDerWaalsContact C-N 3.29Å; N7-G9 PolarHBondContact O-N 3.06Å; G9-S11 PolarHBondContact O-N 3.25Å
10	C	71	Confident	67.5	Low	67 Å²	67	145.3 Å²	145.3	45%	0.453	71%	0.71	S	S	.	*			trans	-59.2	137	173.3	174.7	0	0	0	0	109.5	N8 K12 C13 F14	N8-C10 PolarHBondContact O-N 3.16Å; C10-K12 PolarHBondContact O-N 3.31Å; C10-K12 VanDerWaalsContact O-N 3.12Å; C10-C13 HydrophobicContact CB-CB 4.43Å; C10-C13 WeakPolarHBondContact O-CA 3.46Å; C10-C13 VanDerWaalsContact O-CB 3.27Å; C10-C13 WeakPolarHBondContact O-CB 3.32Å; C10-C13 PolarHBondContact O-N 3.03Å; C10-F14 PolarHBondContact O-N 2.8Å; C10-F14 VanDerWaalsContact O-N 3.12Å
11	S	73.8	Confident	68.6	Low	88 Å²	88	143.2 Å²	143.2	62%	0.615	70%	0.702	S	S	*	*	H	α-helix	trans	-53.3	-34.8	179.3	57.6	0	0	0	0	112.4	G9 F14 N15	G9-S11 PolarHBondContact O-N 3.25Å; S11-F14 PolarHBondContact O-N 3.39Å; S11-N15 PolarHBondContact O-N 3.45Å
12	K	74.7	Confident	70.8	Confident	161 Å²	161	135.9 Å²	135.9	70%	0.7	67%	0.67	S	S	*	*	H	α-helix	trans	-60.7	-42.8	172.5	-66	-176.8	178.5	179.7	0	112.2	C10 N15 W16	C10-K12 PolarHBondContact O-N 3.31Å; C10-K12 VanDerWaalsContact O-N 3.12Å; K12-N15 PolarHBondContact O-N 3Å; K12-W16 WeakPolarHBondContact O-CB 3.32Å; K12-W16 PolarHBondContact O-N 3.5Å
13	C	75.9	Confident	73.1	Confident	79 Å²	79	130.8 Å²	130.8	53%	0.534	65%	0.65	S	S	.	*	H	α-helix	trans	-65.2	-40.7	177.5	-60.3	0	0	0	0	111.6	C10 W16 K17	C10-C13 HydrophobicContact CB-CB 4.43Å; C10-C13 WeakPolarHBondContact O-CA 3.46Å; C10-C13 VanDerWaalsContact O-CB 3.27Å; C10-C13 WeakPolarHBondContact O-CB 3.32Å; C10-C13 PolarHBondContact O-N 3.03Å; C13-W16 PolarHBondContact O-N 3.02Å; C13-K17 WeakPolarHBondContact O-CB 3.39Å; C13-K17 PolarHBondContact O-N 3.42Å
14	F	73.3	Confident	75.2	Confident	143 Å²	143	123.1 Å²	123.1	63%	0.627	62%	0.623	S	S	*	*	H	α-helix	trans	-62.7	-45.4	176.2	-175.7	-97.1	0	0	0	111.6	C10 S11 W16 K17 K18	C10-F14 PolarHBondContact O-N 2.8Å; C10-F14 VanDerWaalsContact O-N 3.12Å; S11-F14 PolarHBondContact O-N 3.39Å; F14-W16 PolarHBondContact O-N 2.96Å; F14-K17 PolarHBondContact O-N 3.16Å; F14-K18 WeakPolarHBondContact O-CB 3.37Å; F14-K18 PolarHBondContact O-N 3.32Å
15	N	79.5	Confident	77.2	Confident	102 Å²	102	118.3 Å²	118.3	55%	0.545	60%	0.6	S	S	.	*	H	α-helix	trans	-63.2	-41.5	176.1	-75.4	-15.4	0	0	0	112.3	S11 K12 K18 K19	S11-N15 PolarHBondContact O-N 3.45Å; K12-N15 PolarHBondContact O-N 3Å; N15-K18 PolarHBondContact O-N 3.02Å; N15-K19 WeakPolarHBondContact O-CB 3.09Å; N15-K19 PolarHBondContact O-N 3.4Å
16	W	80.3	Confident	79.1	Confident	198 Å²	198	115.7 Å²	115.7	75%	0.75	59%	0.592	S	S	*	*	H	α-helix	trans	-61.5	-47.3	175	-114.3	71	0	0	0	112	K12 C13 F14 K18 K19 Y20	K12-W16 WeakPolarHBondContact O-CB 3.32Å; K12-W16 PolarHBondContact O-N 3.5Å; C13-W16 PolarHBondContact O-N 3.02Å; F14-W16 PolarHBondContact O-N 2.96Å; W16-K18 VanDerWaalsContact C-N 3.34Å; W16-K18 PolarHBondContact O-N 3.29Å; W16-K19 PolarHBondContact O-N 3.22Å; W16-Y20 WeakPolarHBondContact O-CB 3.48Å; W16-Y20 PolarHBondContact O-N 3.48Å
17	K	81.4	Confident	80.8	Confident	162 Å²	162	111.1 Å²	111.1	70%	0.704	57%	0.574	S	S	*	*	H	α-helix	trans	-61	-42.8	177.7	-172.6	177.1	-178.3	179.3	0	111.6	C13 F14 Y20 N21	C13-K17 WeakPolarHBondContact O-CB 3.39Å; C13-K17 PolarHBondContact O-N 3.42Å; F14-K17 PolarHBondContact O-N 3.16Å; K17-Y20 PolarHBondContact O-N 2.92Å; K17-N21 WeakPolarHBondContact O-CB 3.43Å; K17-N21 PolarHBondContact O-N 2.97Å
18	K	83.4	Confident	82.6	Confident	137 Å²	137	108.9 Å²	108.9	60%	0.596	56%	0.562	S	S	*	*	H	α-helix	trans	-61.9	-46.9	175.3	-172.4	178.2	179.9	-179.5	0	111.3	F14 N15 W16 N21 V22	F14-K18 WeakPolarHBondContact O-CB 3.37Å; F14-K18 PolarHBondContact O-N 3.32Å; N15-K18 PolarHBondContact O-N 3.02Å; W16-K18 VanDerWaalsContact C-N 3.34Å; W16-K18 PolarHBondContact O-N 3.29Å; K18-N21 PolarHBondContact O-N 3.27Å; K18-V22 WeakPolarHBondContact O-CG2 3.37Å; K18-V22 PolarHBondContact O-N 2.97Å
19	K	84.6	Confident	84.5	Confident	131 Å²	131	107.4 Å²	107.4	57%	0.57	55%	0.553	S	S	*	*	H	α-helix	trans	-61	-46.6	177.9	-175.2	178	179.4	-179.7	0	111.6	N15 W16 N21 V22 Q23	N15-K19 WeakPolarHBondContact O-CB 3.09Å; N15-K19 PolarHBondContact O-N 3.4Å; W16-K19 PolarHBondContact O-N 3.22Å; K19-N21 PolarHBondContact O-N 3.49Å; K19-V22 PolarHBondContact O-N 3.26Å; K19-Q23 WeakPolarHBondContact O-CG 3.38Å; K19-Q23 PolarHBondContact O-N 3.14Å
20	Y	88.2	Confident	86.1	Confident	156 Å²	156	108.5 Å²	108.5	61%	0.612	54%	0.544	S	S	*	.	H	α-helix	trans	-61.4	-43.3	177.9	-174.5	-92.8	0	0	0	111.7	W16 K17 V22 Q23 S24	W16-Y20 WeakPolarHBondContact O-CB 3.48Å; W16-Y20 PolarHBondContact O-N 3.48Å; K17-Y20 PolarHBondContact O-N 2.92Å; Y20-V22 PolarHBondContact O-N 2.98Å; Y20-Q23 PolarHBondContact O-N 3.26Å; Y20-S24 WeakPolarHBondContact O-CB 3.49Å; Y20-S24 PolarHBondContact O-N 3Å
21	N	89.7	Confident	87.4	Confident	101 Å²	101	108.2 Å²	108.2	54%	0.54	54%	0.537	S	S	.	.	H	α-helix	trans	-62.3	-44.6	176.6	-171.1	64.9	0	0	0	112	K17 K18 K19 Q23 S24 V25	K17-N21 WeakPolarHBondContact O-CB 3.43Å; K17-N21 PolarHBondContact O-N 2.97Å; K18-N21 PolarHBondContact O-N 3.27Å; K19-N21 PolarHBondContact O-N 3.49Å; N21-Q23 VanDerWaalsContact C-N 3.34Å; N21-Q23 PolarHBondContact O-N 3.45Å; N21-S24 PolarHBondContact O-N 3.46Å; N21-V25 WeakPolarHBondContact O-CG2 3.33Å; N21-V25 PolarHBondContact O-N 2.9Å
22	V	91.6	Very high	88.5	Confident	89 Å²	89	107 Å²	107	54%	0.539	53%	0.529	S	S	.	.	H	α-helix	trans	-61.2	-44	176	171.3	0	0	0	0	111.1	K18 K19 Y20 V25 A26	K18-V22 WeakPolarHBondContact O-CG2 3.37Å; K18-V22 PolarHBondContact O-N 2.97Å; K19-V22 PolarHBondContact O-N 3.26Å; Y20-V22 PolarHBondContact O-N 2.98Å; V22-V25 PolarHBondContact O-N 3.47Å; V22-A26 WeakPolarHBondContact O-CB 3.45Å; V22-A26 PolarHBondContact O-N 2.98Å
23	Q	92	Very high	89.5	Confident	107 Å²	107	104.6 Å²	104.6	50%	0.5	52%	0.523	S	S	.	.	H	α-helix	trans	-63.1	-43.2	177.2	-74.5	178.2	-28.1	0	0	112.1	K19 Y20 N21 A26 H27	K19-Q23 WeakPolarHBondContact O-CG 3.38Å; K19-Q23 PolarHBondContact O-N 3.14Å; Y20-Q23 PolarHBondContact O-N 3.26Å; N21-Q23 VanDerWaalsContact C-N 3.34Å; N21-Q23 PolarHBondContact O-N 3.45Å; Q23-A26 PolarHBondContact O-N 3.38Å; Q23-H27 WeakPolarHBondContact O-CB 3.48Å; Q23-H27 PolarHBondContact O-N 2.84Å
24	S	93.8	Very high	90.5	Very high	48 Å²	48	106.9 Å²	106.9	34%	0.336	52%	0.524	S	S	.	.	H	α-helix	trans	-63.8	-43.6	177.6	179.1	0	0	0	0	111.9	Y20 N21 H27 N28	Y20-S24 WeakPolarHBondContact O-CB 3.49Å; Y20-S24 PolarHBondContact O-N 3Å; N21-S24 PolarHBondContact O-N 3.46Å; S24-H27 PolarHBondContact O-N 3.42Å; S24-N28 VanDerWaalsContact O-CG 3.29Å; S24-N28 PolarHBondContact O-N 3.28Å; S24-N28 PolarHBondContact O-ND2 2.85Å
25	V	95.3	Very high	91.5	Very high	69 Å²	69	103.7 Å²	103.7	42%	0.418	52%	0.517	S	S	.	.	H	α-helix	trans	-63.4	-44.3	175.9	171.5	0	0	0	0	110.8	N21 V22 H27 N28 L29	N21-V25 WeakPolarHBondContact O-CG2 3.33Å; N21-V25 PolarHBondContact O-N 2.9Å; V22-V25 PolarHBondContact O-N 3.47Å; V25-H27 VanDerWaalsContact C-N 3.34Å; V25-H27 PolarHBondContact O-N 3.36Å; V25-N28 PolarHBondContact O-N 3.47Å; V25-L29 HydrophobicContact CG1-CD1 3.98Å; V25-L29 HydrophobicContact CG1-CG 4.46Å; V25-L29 WeakPolarHBondContact O-CG 3.28Å; V25-L29 PolarHBondContact O-N 3.09Å
26	A	95.3	Very high	92.4	Very high	44 Å²	44	103.7 Å²	103.7	36%	0.364	52%	0.515	S	S	.	.	H	α-helix	trans	-60.8	-42.5	177.5	0	0	0	0	0	112	V22 Q23 L29 I30	V22-A26 WeakPolarHBondContact O-CB 3.45Å; V22-A26 PolarHBondContact O-N 2.98Å; Q23-A26 PolarHBondContact O-N 3.38Å; A26-L29 PolarHBondContact O-N 3.14Å; A26-I30 VanDerWaalsContact O-CG1 3.3Å; A26-I30 WeakPolarHBondContact O-CG1 3.04Å; A26-I30 PolarHBondContact O-N 3.32Å
27	H	95.5	Very high	93.1	Very high	111 Å²	111	97.7 Å²	97.7	51%	0.514	50%	0.501	S	S	.	.	H	α-helix	trans	-63.1	-47.1	177.6	-169.4	-136.2	0	0	0	111.9	Q23 S24 V25 L29 I30 D31	Q23-H27 WeakPolarHBondContact O-CB 3.48Å; Q23-H27 PolarHBondContact O-N 2.84Å; S24-H27 PolarHBondContact O-N 3.42Å; V25-H27 VanDerWaalsContact C-N 3.34Å; V25-H27 PolarHBondContact O-N 3.36Å; H27-L29 VanDerWaalsContact C-N 3.29Å; H27-L29 PolarHBondContact O-N 3.33Å; H27-I30 PolarHBondContact O-N 3.46Å; H27-I30 VanDerWaalsContact O-N 3.14Å; H27-D31 IonicContact CE1-OD2 3.58Å; H27-D31 IonicContact NE2-OD2 3.71Å; H27-D31 PolarHBondContact O-N 2.96Å
28	N	96	Very high	93.8	Very high	94 Å²	94	97.3 Å²	97.3	50%	0.503	50%	0.496	S	S	.	.	H	α-helix	trans	-60.8	-37.6	177.3	-70.2	-15.4	0	0	0	112.4	S24 V25 S32	S24-N28 VanDerWaalsContact O-CG 3.29Å; S24-N28 PolarHBondContact O-N 3.28Å; S24-N28 PolarHBondContact O-ND2 2.85Å; V25-N28 PolarHBondContact O-N 3.47Å; N28-S32 WeakPolarHBondContact O-CB 3.44Å; N28-S32 PolarHBondContact O-N 2.82Å; N28-S32 PolarHBondContact O-OG 3.49Å
29	L	97	Very high	94.3	Very high	105 Å²	105	95.9 Å²	95.9	55%	0.55	49%	0.491	S	S	.	.	H	α-helix	trans	-65.7	-43.2	175.4	-74.9	170.1	0	0	0	111.6	V25 A26 H27 D31 S32 L33	V25-L29 HydrophobicContact CG1-CD1 3.98Å; V25-L29 HydrophobicContact CG1-CG 4.46Å; V25-L29 WeakPolarHBondContact O-CG 3.28Å; V25-L29 PolarHBondContact O-N 3.09Å; A26-L29 PolarHBondContact O-N 3.14Å; H27-L29 VanDerWaalsContact C-N 3.29Å; H27-L29 PolarHBondContact O-N 3.33Å; L29-D31 PolarHBondContact O-N 3.02Å; L29-S32 PolarHBondContact O-N 2.98Å; L29-L33 WeakPolarHBondContact O-CB 3.37Å; L29-L33 VanDerWaalsContact O-CG 3.31Å; L29-L33 WeakPolarHBondContact O-CG 3.39Å; L29-L33 PolarHBondContact O-N 2.93Å
30	I	96.9	Very high	94.9	Very high	87 Å²	87	96.3 Å²	96.3	45%	0.446	49%	0.49	S	S	.	.	H	α-helix	trans	-61.3	-44.6	177	-70.2	165	0	0	0	110.8	A26 H27 L33 K34	A26-I30 VanDerWaalsContact O-CG1 3.3Å; A26-I30 WeakPolarHBondContact O-CG1 3.04Å; A26-I30 PolarHBondContact O-N 3.32Å; H27-I30 PolarHBondContact O-N 3.46Å; H27-I30 VanDerWaalsContact O-N 3.14Å; I30-L33 PolarHBondContact O-N 3.44Å; I30-K34 HydrophobicContact CG2-CD 4.48Å; I30-K34 WeakPolarHBondContact O-CG 3.38Å; I30-K34 PolarHBondContact O-N 3.29Å
31	D	96.4	Very high	95.2	Very high	60 Å²	60	95.6 Å²	95.6	32%	0.321	49%	0.488	S	S	.	.	H	α-helix	trans	-67.6	-37.4	179.4	-72.5	-17.8	0	0	0	112.5	H27 L29 K34 T35	H27-D31 IonicContact CE1-OD2 3.58Å; H27-D31 IonicContact NE2-OD2 3.71Å; H27-D31 PolarHBondContact O-N 2.96Å; L29-D31 PolarHBondContact O-N 3.02Å; D31-K34 PolarHBondContact O-N 3.08Å; D31-K34 IonicContact OD1-NZ 3.64Å; D31-T35 PolarHBondContact O-N 3.01Å; D31-T35 VanDerWaalsContact O-N 3.09Å; D31-T35 PolarHBondContact O-OG1 3.23Å
32	S	97.1	Very high	95.4	Very high	64 Å²	64	93.7 Å²	93.7	45%	0.448	48%	0.477	S	S	.	.	H	α-helix	trans	-63	-43.6	172.9	-58.7	0	0	0	0	111.5	N28 L29 T35 I36	N28-S32 WeakPolarHBondContact O-CB 3.44Å; N28-S32 PolarHBondContact O-N 2.82Å; N28-S32 PolarHBondContact O-OG 3.49Å; L29-S32 PolarHBondContact O-N 2.98Å; S32-T35 WeakPolarHBondContact O-CB 3.37Å; S32-T35 PolarHBondContact O-N 3.34Å; S32-I36 WeakPolarHBondContact O-CG1 3.39Å; S32-I36 PolarHBondContact O-N 2.88Å
33	L	97.1	Very high	95.6	Very high	109 Å²	109	95 Å²	95	57%	0.571	48%	0.48	S	S	*	.	H	α-helix	trans	-61.3	-45.9	176.9	-76	170.6	0	0	0	111.8	L29 I30 T35 I36 T37	L29-L33 WeakPolarHBondContact O-CB 3.37Å; L29-L33 VanDerWaalsContact O-CG 3.31Å; L29-L33 WeakPolarHBondContact O-CG 3.39Å; L29-L33 PolarHBondContact O-N 2.93Å; I30-L33 PolarHBondContact O-N 3.44Å; L33-T35 VanDerWaalsContact C-N 3.27Å; L33-T35 PolarHBondContact O-N 3.46Å; L33-I36 PolarHBondContact O-N 3.3Å; L33-T37 PolarHBondContact O-N 3.35Å; L33-T37 PolarHBondContact O-OG1 3.49Å; L33-T37 VanDerWaalsContact O-OG1 3.05Å
34	K	96.1	Very high	95.6	Very high	128 Å²	128	95.3 Å²	95.3	56%	0.557	48%	0.48	S	S	*	.	H	α-helix	trans	-57	-42.8	175.6	-72.9	172.7	-174.9	164.2	0	111.9	I30 D31 T37 Y38	I30-K34 HydrophobicContact CG2-CD 4.48Å; I30-K34 WeakPolarHBondContact O-CG 3.38Å; I30-K34 PolarHBondContact O-N 3.29Å; D31-K34 PolarHBondContact O-N 3.08Å; D31-K34 IonicContact OD1-NZ 3.64Å; K34-T37 PolarHBondContact O-N 3.09Å; K34-Y38 WeakPolarHBondContact O-CB 3.47Å; K34-Y38 PolarHBondContact O-N 2.92Å
35	T	95.7	Very high	95.6	Very high	76 Å²	76	96.1 Å²	96.1	47%	0.466	49%	0.485	S	S	.	.	H	α-helix	trans	-62.5	-46.7	179.1	-57.4	0	0	0	0	111.3	D31 S32 L33 T37 Y38 Q39	D31-T35 PolarHBondContact O-N 3.01Å; D31-T35 VanDerWaalsContact O-N 3.09Å; D31-T35 PolarHBondContact O-OG1 3.23Å; S32-T35 WeakPolarHBondContact O-CB 3.37Å; S32-T35 PolarHBondContact O-N 3.34Å; L33-T35 VanDerWaalsContact C-N 3.27Å; L33-T35 PolarHBondContact O-N 3.46Å; T35-T37 PolarHBondContact O-N 2.92Å; T35-Y38 PolarHBondContact O-N 3.4Å; T35-Q39 WeakPolarHBondContact O-CG 3.47Å; T35-Q39 PolarHBondContact O-N 3.03Å
36	I	96.7	Very high	95.4	Very high	101 Å²	101	97.5 Å²	97.5	52%	0.518	49%	0.491	S	S	.	.	H	α-helix	trans	-62.4	-44	177.5	-67.6	165.4	0	0	0	110.8	S32 L33 Y38 Q39 Y40	S32-I36 WeakPolarHBondContact O-CG1 3.39Å; S32-I36 PolarHBondContact O-N 2.88Å; L33-I36 PolarHBondContact O-N 3.3Å; I36-Y38 VanDerWaalsContact C-N 3.35Å; I36-Y38 PolarHBondContact O-N 2.96Å; I36-Q39 PolarHBondContact O-N 3.32Å; I36-Y40 WeakPolarHBondContact O-CB 3.46Å; I36-Y40 PolarHBondContact O-N 3.3Å
37	T	95.3	Very high	95.2	Very high	72 Å²	72	102.2 Å²	102.2	44%	0.442	50%	0.503	S	S	.	.	H	α-helix	trans	-60.3	-45	177.4	-60.8	0	0	0	0	111.4	L33 K34 T35 Y40 Y41	L33-T37 PolarHBondContact O-N 3.35Å; L33-T37 PolarHBondContact O-OG1 3.49Å; L33-T37 VanDerWaalsContact O-OG1 3.05Å; K34-T37 PolarHBondContact O-N 3.09Å; T35-T37 PolarHBondContact O-N 2.92Å; T37-Y40 WeakPolarHBondContact O-CB 3.47Å; T37-Y40 PolarHBondContact O-N 3.46Å; T37-Y41 HydrophobicContact CG2-CD2 3.82Å; T37-Y41 HydrophobicContact CG2-CE2 3.52Å; T37-Y41 WeakPolarHBondContact O-CD2 3.44Å; T37-Y41 PolarHBondContact O-N 3.09Å; T37-Y41 VanDerWaalsContact O-N 3.09Å
38	Y	95.7	Very high	95	Very high	154 Å²	154	100.2 Å²	100.2	60%	0.604	50%	0.499	S	S	*	.	H	α-helix	trans	-61.8	-45.9	177.2	-178.7	-104.9	0	0	0	112.1	K34 T35 I36 Y40 Y41 N42	K34-Y38 WeakPolarHBondContact O-CB 3.47Å; K34-Y38 PolarHBondContact O-N 2.92Å; T35-Y38 PolarHBondContact O-N 3.4Å; I36-Y38 VanDerWaalsContact C-N 3.35Å; I36-Y38 PolarHBondContact O-N 2.96Å; Y38-Y40 VanDerWaalsContact C-N 3.32Å; Y38-Y40 PolarHBondContact O-N 3.38Å; Y38-Y41 PolarHBondContact O-N 3.25Å; Y38-N42 WeakPolarHBondContact CE1-ND2 3.39Å; Y38-N42 VanDerWaalsContact CZ-ND2 3.32Å; Y38-N42 PolarHBondContact O-N 3.34Å
39	Q	95.4	Very high	94.6	Very high	107 Å²	107	98.5 Å²	98.5	50%	0.5	49%	0.491	S	S	.	.	H	α-helix	trans	-60.1	-41.4	175.8	-72.8	177.5	-5.7	0	0	112.2	T35 I36 Y41 N42 I43	T35-Q39 WeakPolarHBondContact O-CG 3.47Å; T35-Q39 PolarHBondContact O-N 3.03Å; I36-Q39 PolarHBondContact O-N 3.32Å; Q39-Y41 PolarHBondContact O-N 2.91Å; Q39-N42 PolarHBondContact O-N 3.44Å; Q39-I43 VanDerWaalsContact O-CG1 3.28Å; Q39-I43 WeakPolarHBondContact O-CG1 3.44Å; Q39-I43 PolarHBondContact O-N 2.79Å
40	Y	96.4	Very high	94	Very high	140 Å²	140	99 Å²	99	55%	0.549	49%	0.492	S	S	.	.	H	α-helix	trans	-59.2	-45.5	176.1	173.4	-93.8	0	0	0	111.9	I36 T37 Y38 I43 K44	I36-Y40 WeakPolarHBondContact O-CB 3.46Å; I36-Y40 PolarHBondContact O-N 3.3Å; T37-Y40 WeakPolarHBondContact O-CB 3.47Å; T37-Y40 PolarHBondContact O-N 3.46Å; Y38-Y40 VanDerWaalsContact C-N 3.32Å; Y38-Y40 PolarHBondContact O-N 3.38Å; Y40-I43 PolarHBondContact O-N 2.98Å; Y40-K44 HydrophobicContact CE1-CD 4.32Å; Y40-K44 WeakPolarHBondContact O-CB 3.31Å; Y40-K44 PolarHBondContact O-N 3.32Å
41	Y	95	Very high	93.5	Very high	142 Å²	142	99.1 Å²	99.1	56%	0.557	49%	0.494	S	S	*	.	H	α-helix	trans	-64.6	-40.5	177.5	-79.8	-67.6	0	0	0	112.4	T37 Y38 Q39 K44 S45	T37-Y41 HydrophobicContact CG2-CD2 3.82Å; T37-Y41 HydrophobicContact CG2-CE2 3.52Å; T37-Y41 WeakPolarHBondContact O-CD2 3.44Å; T37-Y41 PolarHBondContact O-N 3.09Å; T37-Y41 VanDerWaalsContact O-N 3.09Å; Y38-Y41 PolarHBondContact O-N 3.25Å; Q39-Y41 PolarHBondContact O-N 2.91Å; Y41-K44 PolarHBondContact O-N 2.92Å; Y41-S45 WeakPolarHBondContact O-CB 3.48Å; Y41-S45 PolarHBondContact O-N 3.37Å
42	N	94.4	Very high	92.9	Very high	61 Å²	61	100.7 Å²	100.7	33%	0.326	50%	0.502	S	S	.	.	H	α-helix	trans	-62.2	-48.4	175.7	-72.8	-8.4	0	0	0	111.5	Y38 Q39 K44 S45 D46	Y38-N42 WeakPolarHBondContact CE1-ND2 3.39Å; Y38-N42 VanDerWaalsContact CZ-ND2 3.32Å; Y38-N42 PolarHBondContact O-N 3.34Å; Q39-N42 PolarHBondContact O-N 3.44Å; N42-K44 VanDerWaalsContact C-N 3.29Å; N42-K44 PolarHBondContact O-N 2.95Å; N42-S45 WeakPolarHBondContact O-CB 3.16Å; N42-S45 PolarHBondContact O-N 3.46Å; N42-S45 VanDerWaalsContact O-N 3.14Å; N42-D46 WeakPolarHBondContact O-CB 3.34Å; N42-D46 VanDerWaalsContact O-CG 3.31Å; N42-D46 PolarHBondContact O-N 2.99Å
43	I	93.9	Very high	92.4	Very high	116 Å²	116	106.2 Å²	106.2	60%	0.595	51%	0.513	S	S	*	.	H	α-helix	trans	-59.7	-41.7	177.5	-67.8	164.1	0	0	0	111	Q39 Y40 D46 K47	Q39-I43 VanDerWaalsContact O-CG1 3.28Å; Q39-I43 WeakPolarHBondContact O-CG1 3.44Å; Q39-I43 PolarHBondContact O-N 2.79Å; Y40-I43 PolarHBondContact O-N 2.98Å; I43-D46 PolarHBondContact O-N 3.14Å; I43-K47 WeakPolarHBondContact O-CB 3.37Å; I43-K47 PolarHBondContact O-N 3.02Å
44	K	93.7	Very high	91.8	Very high	113 Å²	113	106.8 Å²	106.8	49%	0.491	51%	0.513	S	S	.	.	H	α-helix	trans	-63.8	-43.9	176.9	-173.5	177.8	-179.9	-179.4	0	111.4	Y40 Y41 N42 K47 T48	Y40-K44 HydrophobicContact CE1-CD 4.32Å; Y40-K44 WeakPolarHBondContact O-CB 3.31Å; Y40-K44 PolarHBondContact O-N 3.32Å; Y41-K44 PolarHBondContact O-N 2.92Å; N42-K44 VanDerWaalsContact C-N 3.29Å; N42-K44 PolarHBondContact O-N 2.95Å; K44-K47 PolarHBondContact O-N 3.05Å; K44-T48 PolarHBondContact O-N 2.98Å; K44-T48 VanDerWaalsContact O-N 3.08Å; K44-T48 PolarHBondContact O-OG1 3.25Å
45	S	91.9	Very high	91.2	Very high	65 Å²	65	104.3 Å²	104.3	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-61.2	-49.7	176.4	-174.9	0	0	0	0	111.1	Y41 N42 K47 T48 T49	Y41-S45 WeakPolarHBondContact O-CB 3.48Å; Y41-S45 PolarHBondContact O-N 3.37Å; N42-S45 WeakPolarHBondContact O-CB 3.16Å; N42-S45 PolarHBondContact O-N 3.46Å; N42-S45 VanDerWaalsContact O-N 3.14Å; S45-K47 VanDerWaalsContact C-N 3.31Å; S45-K47 PolarHBondContact O-N 3.36Å; S45-T48 PolarHBondContact O-N 3.36Å; S45-T48 VanDerWaalsContact O-N 3.09Å; S45-T49 PolarHBondContact O-N 3.04Å; S45-T49 PolarHBondContact O-OG1 2.94Å; S45-T49 VanDerWaalsContact O-OG1 3.14Å
46	D	92.2	Very high	90.5	Very high	99 Å²	99	104.8 Å²	104.8	53%	0.529	51%	0.511	S	S	.	.	H	α-helix	trans	-59.4	-42.3	179.2	-71.1	-17.5	0	0	0	111.5	N42 I43 T48 T49 M50	N42-D46 WeakPolarHBondContact O-CB 3.34Å; N42-D46 VanDerWaalsContact O-CG 3.31Å; N42-D46 PolarHBondContact O-N 2.99Å; I43-D46 PolarHBondContact O-N 3.14Å; D46-T48 PolarHBondContact O-N 3.01Å; D46-T49 PolarHBondContact O-N 3.49Å; D46-M50 WeakPolarHBondContact O-CB 3.3Å; D46-M50 WeakPolarHBondContact O-CG 3.37Å; D46-M50 PolarHBondContact O-N 3.38Å
47	K	91.7	Very high	90	Very high	142 Å²	142	106.7 Å²	106.7	62%	0.617	52%	0.516	S	S	*	.	H	α-helix	trans	-59.3	-46.2	174.4	-179	175.4	176.9	176.7	0	111.6	I43 K44 S45 M50 L51	I43-K47 WeakPolarHBondContact O-CB 3.37Å; I43-K47 PolarHBondContact O-N 3.02Å; K44-K47 PolarHBondContact O-N 3.05Å; S45-K47 VanDerWaalsContact C-N 3.31Å; S45-K47 PolarHBondContact O-N 3.36Å; K47-M50 PolarHBondContact O-N 3.33Å; K47-L51 HydrophobicContact CG-CD1 4.32Å; K47-L51 WeakPolarHBondContact O-CG 3.44Å; K47-L51 PolarHBondContact O-N 2.92Å
48	T	89.5	Confident	89.3	Confident	70 Å²	70	106.2 Å²	106.2	43%	0.429	52%	0.516	S	S	.	.	H	α-helix	trans	-64.1	-42.8	176.9	-65.4	0	0	0	0	111.5	K44 S45 D46 M50 L51 N52	K44-T48 PolarHBondContact O-N 2.98Å; K44-T48 VanDerWaalsContact O-N 3.08Å; K44-T48 PolarHBondContact O-OG1 3.25Å; S45-T48 PolarHBondContact O-N 3.36Å; S45-T48 VanDerWaalsContact O-N 3.09Å; D46-T48 PolarHBondContact O-N 3.01Å; T48-M50 VanDerWaalsContact C-N 3.34Å; T48-M50 PolarHBondContact O-N 2.86Å; T48-L51 PolarHBondContact O-N 2.93Å; T48-N52 VanDerWaalsContact O-CG 3.31Å; T48-N52 PolarHBondContact O-N 3.35Å
49	T	87.6	Confident	88.6	Confident	57 Å²	57	104 Å²	104	35%	0.35	51%	0.513	S	S	.	.	H	α-helix	trans	-61.3	-41.7	176	-59.4	0	0	0	0	111.8	S45 D46 N52 R53	S45-T49 PolarHBondContact O-N 3.04Å; S45-T49 PolarHBondContact O-OG1 2.94Å; S45-T49 VanDerWaalsContact O-OG1 3.14Å; D46-T49 PolarHBondContact O-N 3.49Å; T49-N52 PolarHBondContact O-N 3.33Å; T49-R53 WeakPolarHBondContact O-CG 3.37Å; T49-R53 PolarHBondContact O-N 3.43Å
50	M	86.4	Confident	87.9	Confident	116 Å²	116	105.9 Å²	105.9	57%	0.571	52%	0.52	S	S	*	.	H	α-helix	trans	-63.2	-45.1	175.9	-76.1	-173	69	0	0	112.3	D46 K47 T48 N52 R53 Q54	D46-M50 WeakPolarHBondContact O-CB 3.3Å; D46-M50 WeakPolarHBondContact O-CG 3.37Å; D46-M50 PolarHBondContact O-N 3.38Å; K47-M50 PolarHBondContact O-N 3.33Å; T48-M50 VanDerWaalsContact C-N 3.34Å; T48-M50 PolarHBondContact O-N 2.86Å; M50-N52 PolarHBondContact O-N 2.92Å; M50-R53 PolarHBondContact O-N 3.36Å; M50-Q54 WeakPolarHBondContact O-CG 3.34Å; M50-Q54 PolarHBondContact O-N 3.44Å
51	L	85.5	Confident	87.1	Confident	90 Å²	90	103.1 Å²	103.1	47%	0.471	52%	0.515	S	S	.	.	H	α-helix	trans	-62	-42.8	177.3	-72.4	170.9	0	0	0	111.8	K47 T48 R53 Q54 S55	K47-L51 HydrophobicContact CG-CD1 4.32Å; K47-L51 WeakPolarHBondContact O-CG 3.44Å; K47-L51 PolarHBondContact O-N 2.92Å; T48-L51 PolarHBondContact O-N 2.93Å; L51-R53 VanDerWaalsContact C-N 3.35Å; L51-R53 PolarHBondContact O-N 3.48Å; L51-Q54 PolarHBondContact O-N 3.3Å; L51-S55 WeakPolarHBondContact O-CB 3.33Å; L51-S55 PolarHBondContact O-N 3.5Å
52	N	84.3	Confident	86.3	Confident	92 Å²	92	100.3 Å²	100.3	49%	0.492	51%	0.509	S	S	.	.	H	α-helix	trans	-63.5	-40.7	176.5	-71.1	-12	0	0	0	111.8	T48 T49 M50 S55 N56	T48-N52 VanDerWaalsContact O-CG 3.31Å; T48-N52 PolarHBondContact O-N 3.35Å; T49-N52 PolarHBondContact O-N 3.33Å; M50-N52 PolarHBondContact O-N 2.92Å; N52-S55 PolarHBondContact O-N 3.47Å; N52-N56 WeakPolarHBondContact O-CB 3.36Å; N52-N56 VanDerWaalsContact O-CG 3.22Å; N52-N56 PolarHBondContact O-N 2.84Å
53	R	85.6	Confident	85.5	Confident	181 Å²	181	100.7 Å²	100.7	68%	0.683	51%	0.514	S	S	*	.	H	α-helix	trans	-63.5	-40.5	175	-75.3	179	178.1	179.1	1.1	112.2	T49 M50 L51 K57	T49-R53 WeakPolarHBondContact O-CG 3.37Å; T49-R53 PolarHBondContact O-N 3.43Å; M50-R53 PolarHBondContact O-N 3.36Å; L51-R53 VanDerWaalsContact C-N 3.35Å; L51-R53 PolarHBondContact O-N 3.48Å; R53-K57 WeakPolarHBondContact O-CB 3.27Å; R53-K57 PolarHBondContact O-N 3.24Å
54	Q	83.9	Confident	84.6	Confident	121 Å²	121	102.5 Å²	102.5	57%	0.565	52%	0.518	S	S	*	.	H	α-helix	trans	-65.4	-44.7	176.1	-74.1	178.5	-5	0	0	111.9	M50 L51 K57 S58	M50-Q54 WeakPolarHBondContact O-CG 3.34Å; M50-Q54 PolarHBondContact O-N 3.44Å; L51-Q54 PolarHBondContact O-N 3.3Å; Q54-K57 PolarHBondContact O-N 3.44Å; Q54-S58 PolarHBondContact O-N 3Å
55	S	83.3	Confident	83.7	Confident	76 Å²	76	101.3 Å²	101.3	53%	0.531	52%	0.52	S	S	.	.	H	α-helix	trans	-61.5	-45.9	176.6	177.9	0	0	0	0	111.6	L51 N52 K57 S58 L59	L51-S55 WeakPolarHBondContact O-CB 3.33Å; L51-S55 PolarHBondContact O-N 3.5Å; N52-S55 PolarHBondContact O-N 3.47Å; S55-K57 VanDerWaalsContact C-N 3.35Å; S55-K57 PolarHBondContact O-N 3.47Å; S55-S58 PolarHBondContact O-N 3.19Å; S55-L59 PolarHBondContact O-N 2.9Å
56	N	82.4	Confident	82.8	Confident	86 Å²	86	105 Å²	105	46%	0.46	53%	0.534	S	S	.	.	H	α-helix	trans	-62.5	-42	176.8	-72.3	-11	0	0	0	111.8	N52 S58 L59 F60	N52-N56 WeakPolarHBondContact O-CB 3.36Å; N52-N56 VanDerWaalsContact O-CG 3.22Å; N52-N56 PolarHBondContact O-N 2.84Å; N56-S58 PolarHBondContact O-N 2.83Å; N56-L59 WeakPolarHBondContact O-CB 3.4Å; N56-L59 PolarHBondContact O-N 3.03Å; N56-F60 WeakPolarHBondContact O-CD2 3.41Å; N56-F60 PolarHBondContact O-N 3.41Å
57	K	84.8	Confident	81.7	Confident	140 Å²	140	107.8 Å²	107.8	61%	0.609	54%	0.544	S	S	*	.	H	α-helix	trans	-59.6	-47.3	176.3	-176.4	178.6	176.6	-176.4	0	111.5	R53 Q54 S55 L59 F60 D61	R53-K57 WeakPolarHBondContact O-CB 3.27Å; R53-K57 PolarHBondContact O-N 3.24Å; Q54-K57 PolarHBondContact O-N 3.44Å; S55-K57 VanDerWaalsContact C-N 3.35Å; S55-K57 PolarHBondContact O-N 3.47Å; K57-L59 VanDerWaalsContact C-N 3.31Å; K57-L59 PolarHBondContact O-N 2.93Å; K57-F60 PolarHBondContact O-N 3.31Å; K57-D61 PolarHBondContact O-N 3.34Å
58	S	82.1	Confident	80.1	Confident	63 Å²	63	114.7 Å²	114.7	44%	0.441	57%	0.566	S	S	.	*	H	α-helix	trans	-58.3	-43.1	176.1	-179.5	0	0	0	0	111.9	Q54 S55 N56 F60 D61 N62	Q54-S58 PolarHBondContact O-N 3Å; S55-S58 PolarHBondContact O-N 3.19Å; N56-S58 PolarHBondContact O-N 2.83Å; S58-F60 PolarHBondContact O-N 3.35Å; S58-D61 PolarHBondContact O-N 3.12Å; S58-N62 VanDerWaalsContact O-CG 3.24Å; S58-N62 PolarHBondContact O-N 2.91Å; S58-N62 PolarHBondContact O-ND2 2.92Å; S58-N62 VanDerWaalsContact O-ND2 3.16Å
59	L	81.3	Confident	79.6	Confident	107 Å²	107	116.9 Å²	116.9	56%	0.56	57%	0.573	S	S	*	*	H	α-helix	trans	-60.5	-45.8	176.2	-174.5	67.7	0	0	0	112	S55 N56 K57 N62 V63	S55-L59 PolarHBondContact O-N 2.9Å; N56-L59 WeakPolarHBondContact O-CB 3.4Å; N56-L59 PolarHBondContact O-N 3.03Å; K57-L59 VanDerWaalsContact C-N 3.31Å; K57-L59 PolarHBondContact O-N 2.93Å; L59-N62 PolarHBondContact O-N 3.42Å; L59-V63 VanDerWaalsContact O-CG2 3.32Å; L59-V63 WeakPolarHBondContact O-CG2 3.35Å; L59-V63 PolarHBondContact O-N 3.43Å
60	F	80.4	Confident	79.2	Confident	147 Å²	147	120.1 Å²	120.1	65%	0.645	59%	0.585	S	S	*	*	H	α-helix	trans	-64.7	-38.7	177.6	-79.8	-66.2	0	0	0	113	N56 K57 S58 V63 K64	N56-F60 WeakPolarHBondContact O-CD2 3.41Å; N56-F60 PolarHBondContact O-N 3.41Å; K57-F60 PolarHBondContact O-N 3.31Å; S58-F60 PolarHBondContact O-N 3.35Å; F60-V63 PolarHBondContact O-N 3.49Å; F60-K64 PolarHBondContact O-N 2.94Å; F60-K64 VanDerWaalsContact O-N 3.09Å
61	D	79.5	Confident	78.8	Confident	81 Å²	81	120.3 Å²	120.3	43%	0.433	59%	0.586	S	S	.	*	H	α-helix	trans	-64.9	-42.4	177.7	-71.2	-26	0	0	0	110.7	K57 S58 K64 T65	K57-D61 PolarHBondContact O-N 3.34Å; S58-D61 PolarHBondContact O-N 3.12Å; D61-K64 WeakPolarHBondContact O-CB 3.39Å; D61-K64 PolarHBondContact O-N 3.06Å; D61-T65 PolarHBondContact O-N 3.2Å; D61-T65 PolarHBondContact O-OG1 3.38Å
62	N	76.9	Confident	78.4	Confident	83 Å²	83	122.1 Å²	122.1	44%	0.444	59%	0.592	S	S	.	*	H	α-helix	trans	-64.5	-43.2	176.2	-66.2	-28.3	0	0	0	112.6	S58 L59 K64 T65 D66	S58-N62 VanDerWaalsContact O-CG 3.24Å; S58-N62 PolarHBondContact O-N 2.91Å; S58-N62 PolarHBondContact O-ND2 2.92Å; S58-N62 VanDerWaalsContact O-ND2 3.16Å; L59-N62 PolarHBondContact O-N 3.42Å; N62-K64 PolarHBondContact O-N 3.05Å; N62-T65 WeakPolarHBondContact CA-OG1 3.44Å; N62-T65 PolarHBondContact O-N 3.29Å; N62-T65 VanDerWaalsContact O-N 3.16Å; N62-T65 PolarHBondContact O-OG1 2.92Å; N62-D66 PolarHBondContact O-N 3.28Å
63	V	79.5	Confident	78.1	Confident	69 Å²	69	123.9 Å²	123.9	42%	0.418	60%	0.599	S	S	.	*	H	α-helix	trans	-61.9	-34.4	176.2	171.7	0	0	0	0	111.2	L59 F60 Q67	L59-V63 VanDerWaalsContact O-CG2 3.32Å; L59-V63 WeakPolarHBondContact O-CG2 3.35Å; L59-V63 PolarHBondContact O-N 3.43Å; F60-V63 PolarHBondContact O-N 3.49Å; V63-Q67 VanDerWaalsContact O-CG 3.32Å; V63-Q67 WeakPolarHBondContact O-CG 3.47Å; V63-Q67 PolarHBondContact O-N 3.32Å
64	K	74.5	Confident	77.6	Confident	155 Å²	155	120.1 Å²	120.1	67%	0.674	59%	0.593	S	S	*	*	H	α-helix	trans	-71	-34.6	175.8	-111.1	-179	180	175.5	0	113.2	F60 D61 N62	F60-K64 PolarHBondContact O-N 2.94Å; F60-K64 VanDerWaalsContact O-N 3.09Å; D61-K64 WeakPolarHBondContact O-CB 3.39Å; D61-K64 PolarHBondContact O-N 3.06Å; N62-K64 PolarHBondContact O-N 3.05Å
65	T	74.6	Confident	77.1	Confident	88 Å²	88	120.1 Å²	120.1	54%	0.54	60%	0.595	S	S	.	*	H	α-helix	trans	-72.9	-35.4	177	48.7	0	0	0	0	112	D61 N62 Q67 R68	D61-T65 PolarHBondContact O-N 3.2Å; D61-T65 PolarHBondContact O-OG1 3.38Å; N62-T65 WeakPolarHBondContact CA-OG1 3.44Å; N62-T65 PolarHBondContact O-N 3.29Å; N62-T65 VanDerWaalsContact O-N 3.16Å; N62-T65 PolarHBondContact O-OG1 2.92Å; T65-Q67 PolarHBondContact O-N 3.45Å; T65-R68 PolarHBondContact O-N 3.12Å
66	D	73.2	Confident	76.6	Confident	141 Å²	141	123.5 Å²	123.5	75%	0.754	60%	0.6	S	S	*	*	H	α-helix	trans	-69.9	-16.9	176.3	-72.6	-24.3	0	0	0	113.2	N62	N62-D66 PolarHBondContact O-N 3.28Å
67	Q	68.5	Low	76.2	Confident	158 Å²	158	126.6 Å²	126.6	74%	0.738	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.2	3.5	178.6	-73.4	-177.9	-3.3	0	0	114.3	V63 T65	V63-Q67 VanDerWaalsContact O-CG 3.32Å; V63-Q67 WeakPolarHBondContact O-CG 3.47Å; V63-Q67 PolarHBondContact O-N 3.32Å; T65-Q67 PolarHBondContact O-N 3.45Å
68	R	58.6	Low	75.4	Confident	287 Å²	287	125.4 Å²	125.4	100%	1.083	61%	0.612	S	S	*	*			trans	-109.6	0	177.7	-86.9	-174.7	170.2	179.2	-3.6	111.8	T65	T65-R68 PolarHBondContact O-N 3.12Å

Retrieved 68 of 68 residues in 14.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).