A0A5K4F6D2_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F6D2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 72 aa.

						>A0A5K4F6D2_SCHMA|A0A5K4F6D2
MHIQYLFVIFLITLDVICSQNPLGNAGLSEQDKKDLALIKKTPAYQQVKTKVLAILDEKIDKFVLDQIRKKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.5	Low	71.5	Confident	189 Å²	189	121.7 Å²	121.7	93%	0.931	59%	0.589	S	S	*	*				0	-22.5	0	-84.2	-173.6	168.1	0	0	114.9	Y5	M1-Y5 WeakPolarHBondContact O-CD2 3.43Å
2	H	57.5	Low	72	Confident	161 Å²	161	119.8 Å²	119.8	75%	0.745	58%	0.582	S	S	*	*	H	α-helix	trans	-67.9	-34.9	-177.5	-72.9	-70.1	0	0	0	115.6	Q4 Y5 L6	H2-Q4 VanDerWaalsContact C-N 3.31Å; H2-Q4 PolarHBondContact O-N 3.02Å; H2-Y5 PolarHBondContact O-N 3.49Å; H2-L6 PolarHBondContact O-N 3.19Å
3	I	72.6	Confident	72.6	Confident	144 Å²	144	115.5 Å²	115.5	74%	0.738	57%	0.567	S	S	*	*	H	α-helix	trans	-62.5	-34.9	-177.6	-72.3	162.4	0	0	0	112.7	Y5 L6 F7	I3-Y5 PolarHBondContact O-N 3.03Å; I3-L6 PolarHBondContact O-N 3.01Å; I3-F7 PolarHBondContact O-N 3.46Å
4	Q	66	Low	72.7	Confident	138 Å²	138	112.1 Å²	112.1	65%	0.645	55%	0.552	S	S	*	*	H	α-helix	trans	-66.3	-36.4	179.5	-71.2	179.4	-33.6	0	0	112.3	H2 F7 V8	H2-Q4 VanDerWaalsContact C-N 3.31Å; H2-Q4 PolarHBondContact O-N 3.02Å; Q4-F7 PolarHBondContact O-N 3.48Å; Q4-V8 WeakPolarHBondContact O-CG2 3.3Å; Q4-V8 PolarHBondContact O-N 2.93Å; Q4-V8 VanDerWaalsContact O-N 3.08Å
5	Y	72	Confident	72.8	Confident	95 Å²	95	112.3 Å²	112.3	37%	0.373	56%	0.556	S	S	.	*	H	α-helix	trans	-68.2	-39.7	175.9	-70.3	-73.9	0	0	0	112	M1 H2 I3 F7 V8 I9 I55	M1-Y5 WeakPolarHBondContact O-CD2 3.43Å; H2-Y5 PolarHBondContact O-N 3.49Å; I3-Y5 PolarHBondContact O-N 3.03Å; Y5-F7 VanDerWaalsContact C-N 3.26Å; Y5-F7 PolarHBondContact O-N 3.05Å; Y5-V8 PolarHBondContact O-N 3.37Å; Y5-I9 WeakPolarHBondContact O-CG1 3.48Å; Y5-I9 PolarHBondContact O-N 3.32Å; Y5-I55 HydrophobicContact CE1-CG2 4.32Å
6	L	74.6	Confident	72.7	Confident	120 Å²	120	109.4 Å²	109.4	63%	0.628	55%	0.546	S	S	*	.	H	α-helix	trans	-60.8	-39.4	174.4	-69.7	176.3	0	0	0	110.9	H2 I3 F10	H2-L6 PolarHBondContact O-N 3.19Å; I3-L6 PolarHBondContact O-N 3.01Å; L6-F10 WeakPolarHBondContact O-CB 3.19Å; L6-F10 PolarHBondContact O-N 2.89Å
7	F	75.7	Confident	72.4	Confident	125 Å²	125	108.1 Å²	108.1	55%	0.548	54%	0.541	S	S	.	.	H	α-helix	trans	-64.1	-43.6	176	-171.6	-105.6	0	0	0	112.5	I3 Q4 Y5 F10 L11	I3-F7 PolarHBondContact O-N 3.46Å; Q4-F7 PolarHBondContact O-N 3.48Å; Y5-F7 VanDerWaalsContact C-N 3.26Å; Y5-F7 PolarHBondContact O-N 3.05Å; F7-F10 PolarHBondContact O-N 3.26Å; F7-L11 HydrophobicContact CD1-CD1 3.87Å; F7-L11 HydrophobicContact CD1-CG 4.35Å; F7-L11 HydrophobicContact CE1-CD1 3.47Å; F7-L11 VanDerWaalsContact CE1-CD1 3.47Å; F7-L11 HydrophobicContact CE1-CG 4.09Å; F7-L11 HydrophobicContact CZ-CD1 4.02Å; F7-L11 HydrophobicContact CZ-CD2 4.29Å; F7-L11 HydrophobicContact CZ-CG 4.26Å; F7-L11 WeakPolarHBondContact O-CG 3.34Å; F7-L11 PolarHBondContact O-N 2.84Å
8	V	75.4	Confident	71.8	Confident	68 Å²	68	105.7 Å²	105.7	41%	0.412	54%	0.535	S	S	.	.	H	α-helix	trans	-66.2	-44.5	177.3	175.1	0	0	0	0	111.7	Q4 Y5 F10 L11 I12	Q4-V8 WeakPolarHBondContact O-CG2 3.3Å; Q4-V8 PolarHBondContact O-N 2.93Å; Q4-V8 VanDerWaalsContact O-N 3.08Å; Y5-V8 PolarHBondContact O-N 3.37Å; V8-F10 VanDerWaalsContact C-N 3.3Å; V8-F10 PolarHBondContact O-N 2.88Å; V8-L11 PolarHBondContact O-N 3.39Å; V8-I12 HydrophobicContact CG1-CD1 3.98Å; V8-I12 WeakPolarHBondContact O-CG1 3.39Å; V8-I12 PolarHBondContact O-N 2.82Å
9	I	78.9	Confident	71	Confident	96 Å²	96	104.3 Å²	104.3	49%	0.492	54%	0.536	S	S	.	.	H	α-helix	trans	-61.5	-44.5	175.6	-67.3	169.5	0	0	0	109.4	Y5 L11 I12 T13	Y5-I9 WeakPolarHBondContact O-CG1 3.48Å; Y5-I9 PolarHBondContact O-N 3.32Å; I9-L11 VanDerWaalsContact C-N 3.33Å; I9-L11 PolarHBondContact O-N 3.44Å; I9-I12 PolarHBondContact O-N 3.34Å; I9-I12 VanDerWaalsContact O-N 3.16Å; I9-T13 WeakPolarHBondContact O-CB 3.2Å; I9-T13 PolarHBondContact O-N 3.5Å; I9-T13 PolarHBondContact O-OG1 3.41Å
10	F	79.2	Confident	70.2	Confident	118 Å²	118	106.8 Å²	106.8	52%	0.518	55%	0.545	S	S	.	.	H	α-helix	trans	-60.2	-40.9	177.1	-178.8	-107.7	0	0	0	112.3	L6 F7 V8 T13 L14	L6-F10 WeakPolarHBondContact O-CB 3.19Å; L6-F10 PolarHBondContact O-N 2.89Å; F7-F10 PolarHBondContact O-N 3.26Å; V8-F10 VanDerWaalsContact C-N 3.3Å; V8-F10 PolarHBondContact O-N 2.88Å; F10-T13 PolarHBondContact O-N 3.15Å; F10-L14 HydrophobicContact CD1-CD1 3.67Å; F10-L14 HydrophobicContact CD1-CG 4.31Å; F10-L14 HydrophobicContact CE1-CD1 3.23Å; F10-L14 HydrophobicContact CE1-CG 4Å; F10-L14 HydrophobicContact CE2-CD1 4.36Å; F10-L14 HydrophobicContact CE2-CG 4.26Å; F10-L14 HydrophobicContact CG-CD1 4.41Å; F10-L14 HydrophobicContact CZ-CD1 3.62Å; F10-L14 HydrophobicContact CZ-CD2 4.27Å; F10-L14 HydrophobicContact CZ-CG 3.96Å; F10-L14 VanDerWaalsContact O-CB 3.27Å; F10-L14 WeakPolarHBondContact O-CB 3.33Å; F10-L14 WeakPolarHBondContact O-CG 3.32Å; F10-L14 PolarHBondContact O-N 2.95Å
11	L	78.9	Confident	69.2	Low	85 Å²	85	105.8 Å²	105.8	45%	0.445	54%	0.541	S	S	.	.	H	α-helix	trans	-64.8	-40.2	174.2	-72.4	178.2	0	0	0	112.5	F7 V8 I9 D15	F7-L11 HydrophobicContact CD1-CD1 3.87Å; F7-L11 HydrophobicContact CD1-CG 4.35Å; F7-L11 HydrophobicContact CE1-CD1 3.47Å; F7-L11 VanDerWaalsContact CE1-CD1 3.47Å; F7-L11 HydrophobicContact CE1-CG 4.09Å; F7-L11 HydrophobicContact CZ-CD1 4.02Å; F7-L11 HydrophobicContact CZ-CD2 4.29Å; F7-L11 HydrophobicContact CZ-CG 4.26Å; F7-L11 WeakPolarHBondContact O-CG 3.34Å; F7-L11 PolarHBondContact O-N 2.84Å; V8-L11 PolarHBondContact O-N 3.39Å; I9-L11 VanDerWaalsContact C-N 3.33Å; I9-L11 PolarHBondContact O-N 3.44Å; L11-D15 WeakPolarHBondContact O-CB 3.48Å; L11-D15 PolarHBondContact O-N 2.94Å
12	I	78.4	Confident	68.9	Low	99 Å²	99	102 Å²	102	51%	0.508	53%	0.531	S	S	.	.	H	α-helix	trans	-68.1	-41.9	175.7	-65.2	165.7	0	0	0	110.5	V8 I9 D15 V16	V8-I12 HydrophobicContact CG1-CD1 3.98Å; V8-I12 WeakPolarHBondContact O-CG1 3.39Å; V8-I12 PolarHBondContact O-N 2.82Å; I9-I12 PolarHBondContact O-N 3.34Å; I9-I12 VanDerWaalsContact O-N 3.16Å; I12-D15 WeakPolarHBondContact O-CB 3.41Å; I12-D15 PolarHBondContact O-N 3.48Å; I12-V16 WeakPolarHBondContact O-CG2 3.41Å; I12-V16 PolarHBondContact O-N 3.03Å
13	T	78.8	Confident	68.5	Low	64 Å²	64	101.7 Å²	101.7	39%	0.393	53%	0.533	S	S	.	.	H	α-helix	trans	-66.2	-40.4	177	-56.4	0	0	0	0	110.9	I9 F10 V16 I17	I9-T13 WeakPolarHBondContact O-CB 3.2Å; I9-T13 PolarHBondContact O-N 3.5Å; I9-T13 PolarHBondContact O-OG1 3.41Å; F10-T13 PolarHBondContact O-N 3.15Å; T13-V16 PolarHBondContact O-N 2.82Å; T13-I17 HydrophobicContact CG2-CD1 3.65Å; T13-I17 HydrophobicContact CG2-CG1 4.24Å; T13-I17 WeakPolarHBondContact O-CB 3.49Å; T13-I17 WeakPolarHBondContact O-CG1 3.44Å; T13-I17 PolarHBondContact O-N 3.36Å
14	L	74.4	Confident	67.1	Low	68 Å²	68	96.5 Å²	96.5	36%	0.356	52%	0.516	S	S	.	.	H	α-helix	trans	-60.9	-45.5	170	-82.1	174.7	0	0	0	111.1	F10 V16 I17 C18	F10-L14 HydrophobicContact CD1-CD1 3.67Å; F10-L14 HydrophobicContact CD1-CG 4.31Å; F10-L14 HydrophobicContact CE1-CD1 3.23Å; F10-L14 HydrophobicContact CE1-CG 4Å; F10-L14 HydrophobicContact CE2-CD1 4.36Å; F10-L14 HydrophobicContact CE2-CG 4.26Å; F10-L14 HydrophobicContact CG-CD1 4.41Å; F10-L14 HydrophobicContact CZ-CD1 3.62Å; F10-L14 HydrophobicContact CZ-CD2 4.27Å; F10-L14 HydrophobicContact CZ-CG 3.96Å; F10-L14 VanDerWaalsContact O-CB 3.27Å; F10-L14 WeakPolarHBondContact O-CB 3.33Å; F10-L14 WeakPolarHBondContact O-CG 3.32Å; F10-L14 PolarHBondContact O-N 2.95Å; L14-V16 VanDerWaalsContact C-N 3.32Å; L14-V16 PolarHBondContact O-N 3.48Å; L14-I17 PolarHBondContact O-N 2.91Å; L14-C18 WeakPolarHBondContact O-CA 3.26Å; L14-C18 WeakPolarHBondContact O-CB 3.32Å; L14-C18 PolarHBondContact O-N 3.27Å; L14-C18 PolarHBondContact O-SG 3.42Å
15	D	74.2	Confident	66.1	Low	115 Å²	115	96.3 Å²	96.3	62%	0.615	52%	0.519	S	S	*	.	H	α-helix	trans	-58.8	-43.9	177.1	-170.4	70.2	0	0	0	111.3	L11 I12 S19	L11-D15 WeakPolarHBondContact O-CB 3.48Å; L11-D15 PolarHBondContact O-N 2.94Å; I12-D15 WeakPolarHBondContact O-CB 3.41Å; I12-D15 PolarHBondContact O-N 3.48Å; D15-S19 WeakPolarHBondContact O-CA 3.49Å; D15-S19 WeakPolarHBondContact O-CB 3.32Å; D15-S19 PolarHBondContact O-N 2.65Å
16	V	70.6	Confident	65.1	Low	65 Å²	65	95.7 Å²	95.7	39%	0.394	53%	0.534	S	S	.	.	H	α-helix	trans	-68.7	-44.8	176.9	172	0	0	0	0	112.3	I12 T13 L14 S19 Q20	I12-V16 WeakPolarHBondContact O-CG2 3.41Å; I12-V16 PolarHBondContact O-N 3.03Å; T13-V16 PolarHBondContact O-N 2.82Å; L14-V16 VanDerWaalsContact C-N 3.32Å; L14-V16 PolarHBondContact O-N 3.48Å; V16-S19 PolarHBondContact O-N 3.34Å; V16-Q20 HydrophobicContact CG1-CG 4.48Å; V16-Q20 WeakPolarHBondContact O-CB 3.33Å; V16-Q20 WeakPolarHBondContact O-CG 3.32Å; V16-Q20 PolarHBondContact O-N 3.07Å
17	I	68.1	Low	63.9	Low	88 Å²	88	92.3 Å²	92.3	45%	0.451	53%	0.528	S	S	.	.	H	α-helix	trans	-66.8	-41.5	178.4	-69.4	170.7	0	0	0	110.5	T13 L14 N21	T13-I17 HydrophobicContact CG2-CD1 3.65Å; T13-I17 HydrophobicContact CG2-CG1 4.24Å; T13-I17 WeakPolarHBondContact O-CB 3.49Å; T13-I17 WeakPolarHBondContact O-CG1 3.44Å; T13-I17 PolarHBondContact O-N 3.36Å; L14-I17 PolarHBondContact O-N 2.91Å; I17-N21 WeakPolarHBondContact O-CB 3.45Å; I17-N21 PolarHBondContact O-N 3.35Å; I17-N21 PolarHBondContact O-ND2 3.32Å
18	C	61.2	Low	63	Low	64 Å²	64	90.9 Å²	90.9	43%	0.432	53%	0.526	S	S	.	.	H	α-helix	trans	-64.8	-43.3	173.8	-71.4	0	0	0	0	110.6	L14 Q20 N21 G24	L14-C18 WeakPolarHBondContact O-CA 3.26Å; L14-C18 WeakPolarHBondContact O-CB 3.32Å; L14-C18 PolarHBondContact O-N 3.27Å; L14-C18 PolarHBondContact O-SG 3.42Å; C18-Q20 PolarHBondContact O-N 3.32Å; C18-N21 PolarHBondContact O-N 3.46Å; C18-G24 VanDerWaalsContact O-CA 3.27Å; C18-G24 WeakPolarHBondContact O-CA 3.09Å
19	S	57.5	Low	62.8	Low	79 Å²	79	90.7 Å²	90.7	55%	0.552	53%	0.527	S	S	*	.	H	α-helix	trans	-66.8	-34.1	178.4	-174.5	0	0	0	0	113	D15 V16	D15-S19 WeakPolarHBondContact O-CA 3.49Å; D15-S19 WeakPolarHBondContact O-CB 3.32Å; D15-S19 PolarHBondContact O-N 2.65Å; V16-S19 PolarHBondContact O-N 3.34Å
20	Q	55.2	Low	62.6	Low	154 Å²	154	91.8 Å²	91.8	72%	0.72	53%	0.53	S	S	*	.	H	α-helix	trans	-82.5	-23	176.3	-74.2	-174.5	4.3	0	0	113.8	V16 C18 P22	V16-Q20 HydrophobicContact CG1-CG 4.48Å; V16-Q20 WeakPolarHBondContact O-CB 3.33Å; V16-Q20 WeakPolarHBondContact O-CG 3.32Å; V16-Q20 PolarHBondContact O-N 3.07Å; C18-Q20 PolarHBondContact O-N 3.32Å; Q20-P22 WeakPolarHBondContact O-CD 3.34Å
21	N	48.6	Very low	62.5	Low	87 Å²	87	92.2 Å²	92.2	47%	0.465	53%	0.534	S	S	.	.	S	Bend	trans	-71	125	169.9	-94.2	-41.6	0	0	0	108.8	I17 C18 L23 G24	I17-N21 WeakPolarHBondContact O-CB 3.45Å; I17-N21 PolarHBondContact O-N 3.35Å; I17-N21 PolarHBondContact O-ND2 3.32Å; C18-N21 PolarHBondContact O-N 3.46Å; N21-L23 PolarHBondContact O-N 2.94Å; N21-G24 PolarHBondContact O-N 3.25Å
22	P	50.5	Low	62.5	Low	110 Å²	110	91.6 Å²	91.6	71%	0.714	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.7	-13.1	173	22.4	-31.2	0	0	0	112.7	Q20	Q20-P22 WeakPolarHBondContact O-CD 3.34Å
23	L	47.3	Very low	62.7	Low	153 Å²	153	91.8 Å²	91.8	80%	0.801	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.1	-26.8	168.9	-136.2	84.3	0	0	0	113.7	N21 N25 A26	N21-L23 PolarHBondContact O-N 2.94Å; L23-N25 VanDerWaalsContact C-N 3.34Å; L23-A26 WeakPolarHBondContact O-CB 3.39Å; L23-A26 PolarHBondContact O-N 3.39Å; L23-A26 VanDerWaalsContact O-N 3.14Å
24	G	43.6	Very low	62.9	Low	36 Å²	36	95.3 Å²	95.3	37%	0.371	54%	0.538	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.3	-4.4	174.3	0	0	0	0	0	114.1	C18 N21 A26	C18-G24 VanDerWaalsContact O-CA 3.27Å; C18-G24 WeakPolarHBondContact O-CA 3.09Å; N21-G24 PolarHBondContact O-N 3.25Å; G24-A26 PolarHBondContact O-N 2.95Å
25	N	46	Very low	63.3	Low	133 Å²	133	95.4 Å²	95.4	71%	0.711	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.7	6.3	155.2	-94.6	-9.6	0	0	0	112.6	L23 G27	L23-N25 VanDerWaalsContact C-N 3.34Å; N25-G27 PolarHBondContact O-N 2.79Å
26	A	49.6	Very low	63.7	Low	82 Å²	82	92.8 Å²	92.8	68%	0.678	53%	0.525	S	S	*	.	S	Bend	trans	-62	77.3	148.1	0	0	0	0	0	106.7	L23 G24 L28	L23-A26 WeakPolarHBondContact O-CB 3.39Å; L23-A26 PolarHBondContact O-N 3.39Å; L23-A26 VanDerWaalsContact O-N 3.14Å; G24-A26 PolarHBondContact O-N 2.95Å; A26-L28 PolarHBondContact O-N 3.49Å
27	G	50.5	Low	64.3	Low	49 Å²	49	91.9 Å²	91.9	51%	0.505	52%	0.524	S	S	.	.			trans	-51.9	137.4	-169.1	0	0	0	0	0	108.2	N25 S29	N25-G27 PolarHBondContact O-N 2.79Å; G27-S29 PolarHBondContact O-N 2.83Å
28	L	57.2	Low	65	Low	96 Å²	96	92.8 Å²	92.8	50%	0.503	53%	0.529	S	S	.	.			trans	-29	117.3	153.4	-75	165.1	0	0	0	107	A26 D32 K33 L36	A26-L28 PolarHBondContact O-N 3.49Å; L28-D32 HydrophobicContact CB-CB 3.79Å; L28-D32 HydrophobicContact CD2-CB 3.5Å; L28-D32 HydrophobicContact CG-CB 4.25Å; L28-K33 HydrophobicContact CB-CG 3.82Å; L28-K33 WeakPolarHBondContact O-CE 3.49Å; L28-L36 HydrophobicContact CD1-CD2 4.39Å
29	S	69.8	Low	66.1	Low	64 Å²	64	93.9 Å²	93.9	45%	0.448	53%	0.53	S	S	.	.			trans	-48	152.2	177.7	172.5	0	0	0	0	107.4	G27 Q31 D32 K33	G27-S29 PolarHBondContact O-N 2.83Å; S29-Q31 CarbonylContact O-C 3.46Å; S29-Q31 PolarHBondContact O-N 3.34Å; S29-Q31 PolarHBondContact OG-N 3.36Å; S29-D32 WeakPolarHBondContact CB-OD2 3.38Å; S29-D32 PolarHBondContact N-OD2 3.46Å; S29-D32 PolarHBondContact O-N 2.78Å; S29-K33 PolarHBondContact O-N 2.75Å
30	E	75.3	Confident	67.3	Low	118 Å²	118	94.5 Å²	94.5	55%	0.551	52%	0.522	S	S	*	.	H	α-helix	trans	-51.4	-24.7	171.9	-72.5	-59.2	122.9	0	0	111.4	K33 K34	E30-K33 IonicContact OE1-NZ 2.77Å; E30-K33 PolarHBondContact OE1-NZ 3.25Å; E30-K34 WeakPolarHBondContact O-CD 3.43Å; E30-K34 VanDerWaalsContact O-CG 3.22Å; E30-K34 WeakPolarHBondContact O-CG 3.36Å; E30-K34 PolarHBondContact O-N 2.81Å
31	Q	77.8	Confident	68.8	Low	127 Å²	127	95.2 Å²	95.2	59%	0.593	52%	0.523	S	S	*	.	H	α-helix	trans	-69.5	-50.4	168.3	-171	159.9	-12.1	0	0	114	S29 K33 K34 D35	S29-Q31 CarbonylContact O-C 3.46Å; S29-Q31 PolarHBondContact O-N 3.34Å; S29-Q31 PolarHBondContact OG-N 3.36Å; Q31-K33 PolarHBondContact O-N 2.86Å; Q31-K34 CarbonylContact O-C 3.58Å; Q31-K34 WeakPolarHBondContact O-CA 3.27Å; Q31-K34 WeakPolarHBondContact O-CB 3.49Å; Q31-K34 PolarHBondContact O-N 2.84Å; Q31-D35 PolarHBondContact O-N 3.42Å
32	D	79	Confident	70.6	Confident	73 Å²	73	93.6 Å²	93.6	39%	0.39	52%	0.517	S	S	.	.	H	α-helix	trans	-61.1	-34.9	178.7	-56.5	-37.3	0	0	0	111.9	L28 S29 D35 L36	L28-D32 HydrophobicContact CB-CB 3.79Å; L28-D32 HydrophobicContact CD2-CB 3.5Å; L28-D32 HydrophobicContact CG-CB 4.25Å; S29-D32 WeakPolarHBondContact CB-OD2 3.38Å; S29-D32 PolarHBondContact N-OD2 3.46Å; S29-D32 PolarHBondContact O-N 2.78Å; D32-D35 PolarHBondContact O-N 3.39Å; D32-L36 WeakPolarHBondContact O-CB 3.08Å; D32-L36 PolarHBondContact O-N 3.41Å
33	K	81.4	Confident	72.3	Confident	103 Å²	103	93.1 Å²	93.1	45%	0.448	51%	0.513	S	S	.	.	H	α-helix	trans	-64.4	-39.7	172.9	-66.9	-179.9	-169.7	164	0	111.8	L28 S29 E30 Q31 A37	L28-K33 HydrophobicContact CB-CG 3.82Å; L28-K33 WeakPolarHBondContact O-CE 3.49Å; S29-K33 PolarHBondContact O-N 2.75Å; E30-K33 IonicContact OE1-NZ 2.77Å; E30-K33 PolarHBondContact OE1-NZ 3.25Å; Q31-K33 PolarHBondContact O-N 2.86Å; K33-A37 VanDerWaalsContact O-CB 3.31Å; K33-A37 WeakPolarHBondContact O-CB 3Å; K33-A37 PolarHBondContact O-N 3.17Å
34	K	82.5	Confident	74.1	Confident	137 Å²	137	88.7 Å²	88.7	60%	0.596	50%	0.499	S	S	*	.	H	α-helix	trans	-67.7	-44.9	175.8	-74.2	171.2	-174.2	-178.2	0	111.2	E30 Q31 L36 A37 L38	E30-K34 WeakPolarHBondContact O-CD 3.43Å; E30-K34 VanDerWaalsContact O-CG 3.22Å; E30-K34 WeakPolarHBondContact O-CG 3.36Å; E30-K34 PolarHBondContact O-N 2.81Å; Q31-K34 CarbonylContact O-C 3.58Å; Q31-K34 WeakPolarHBondContact O-CA 3.27Å; Q31-K34 WeakPolarHBondContact O-CB 3.49Å; Q31-K34 PolarHBondContact O-N 2.84Å; K34-L36 VanDerWaalsContact C-N 3.35Å; K34-L36 PolarHBondContact O-N 2.9Å; K34-A37 WeakPolarHBondContact O-CB 3.47Å; K34-A37 PolarHBondContact O-N 2.77Å; K34-A37 VanDerWaalsContact O-N 3.13Å; K34-L38 WeakPolarHBondContact O-CG 3.34Å; K34-L38 PolarHBondContact O-N 2.76Å
35	D	83.9	Confident	76.1	Confident	70 Å²	70	90.9 Å²	90.9	37%	0.374	50%	0.497	S	S	.	.	H	α-helix	trans	-64.2	-42.4	178.4	-68.8	-18.1	0	0	0	110.8	Q31 D32 A37 L38 I39	Q31-D35 PolarHBondContact O-N 3.42Å; D32-D35 PolarHBondContact O-N 3.39Å; D35-A37 VanDerWaalsContact C-N 3.34Å; D35-A37 PolarHBondContact O-N 3.41Å; D35-L38 WeakPolarHBondContact O-CB 3.24Å; D35-L38 PolarHBondContact O-N 3.16Å; D35-I39 VanDerWaalsContact O-CG1 3.26Å; D35-I39 WeakPolarHBondContact O-CG1 3.49Å; D35-I39 PolarHBondContact O-N 2.98Å
36	L	82.2	Confident	78	Confident	61 Å²	61	88.3 Å²	88.3	32%	0.319	48%	0.48	S	S	.	.	H	α-helix	trans	-62.8	-39.9	172.6	-176.6	62.1	0	0	0	111.9	L28 D32 K34 L38 I39 K40	L28-L36 HydrophobicContact CD1-CD2 4.39Å; D32-L36 WeakPolarHBondContact O-CB 3.08Å; D32-L36 PolarHBondContact O-N 3.41Å; K34-L36 VanDerWaalsContact C-N 3.35Å; K34-L36 PolarHBondContact O-N 2.9Å; L36-L38 VanDerWaalsContact C-N 3.3Å; L36-L38 PolarHBondContact O-N 3.04Å; L36-I39 PolarHBondContact O-N 3.24Å; L36-K40 HydrophobicContact CG-CD 4.27Å; L36-K40 WeakPolarHBondContact O-CB 3.27Å; L36-K40 WeakPolarHBondContact O-CG 3.34Å; L36-K40 PolarHBondContact O-N 3.23Å
37	A	83.6	Confident	79.7	Confident	46 Å²	46	90.3 Å²	90.3	38%	0.38	48%	0.476	S	S	.	.	H	α-helix	trans	-65.1	-33.3	175.7	0	0	0	0	0	112.3	K33 K34 D35 K41	K33-A37 VanDerWaalsContact O-CB 3.31Å; K33-A37 WeakPolarHBondContact O-CB 3Å; K33-A37 PolarHBondContact O-N 3.17Å; K34-A37 WeakPolarHBondContact O-CB 3.47Å; K34-A37 PolarHBondContact O-N 2.77Å; K34-A37 VanDerWaalsContact O-N 3.13Å; D35-A37 VanDerWaalsContact C-N 3.34Å; D35-A37 PolarHBondContact O-N 3.41Å; A37-K41 WeakPolarHBondContact O-CG 3.33Å
38	L	82.6	Confident	81.4	Confident	106 Å²	106	92.2 Å²	92.2	56%	0.555	48%	0.478	S	S	*	.	H	α-helix	trans	-70.2	-47.8	172.6	-69.2	171.8	0	0	0	111.2	K34 D35 L36 K40 K41 T42	K34-L38 WeakPolarHBondContact O-CG 3.34Å; K34-L38 PolarHBondContact O-N 2.76Å; D35-L38 WeakPolarHBondContact O-CB 3.24Å; D35-L38 PolarHBondContact O-N 3.16Å; L36-L38 VanDerWaalsContact C-N 3.3Å; L36-L38 PolarHBondContact O-N 3.04Å; L38-K40 VanDerWaalsContact C-N 3.26Å; L38-K40 PolarHBondContact O-N 2.87Å; L38-K41 WeakPolarHBondContact O-CB 3.42Å; L38-K41 PolarHBondContact O-N 3.12Å; L38-T42 PolarHBondContact O-N 3.14Å
39	I	83.8	Confident	82.8	Confident	88 Å²	88	92.4 Å²	92.4	45%	0.451	47%	0.474	S	S	.	.	H	α-helix	trans	-57.9	-41.5	176.5	-68.1	164.3	0	0	0	110.4	D35 L36 K41 T42 Y45	D35-I39 VanDerWaalsContact O-CG1 3.26Å; D35-I39 WeakPolarHBondContact O-CG1 3.49Å; D35-I39 PolarHBondContact O-N 2.98Å; L36-I39 PolarHBondContact O-N 3.24Å; I39-K41 PolarHBondContact O-N 2.97Å; I39-K41 VanDerWaalsContact O-N 3.15Å; I39-T42 WeakPolarHBondContact O-CB 3.36Å; I39-T42 WeakPolarHBondContact O-CG2 3.33Å; I39-T42 PolarHBondContact O-N 2.82Å; I39-T42 PolarHBondContact O-OG1 3.28Å; I39-Y45 HydrophobicContact CG2-CD2 3.91Å; I39-Y45 HydrophobicContact CG2-CG 4.38Å; I39-Y45 WeakPolarHBondContact O-CB 3.32Å
40	K	83.8	Confident	83.6	Confident	91 Å²	91	93.6 Å²	93.6	40%	0.396	48%	0.479	S	S	.	.	H	α-helix	trans	-59	-24.9	176.2	-79.9	174.7	176.4	-180	0	113.6	L36 L38 Y45 Q46	L36-K40 HydrophobicContact CG-CD 4.27Å; L36-K40 WeakPolarHBondContact O-CB 3.27Å; L36-K40 WeakPolarHBondContact O-CG 3.34Å; L36-K40 PolarHBondContact O-N 3.23Å; L38-K40 VanDerWaalsContact C-N 3.26Å; L38-K40 PolarHBondContact O-N 2.87Å; K40-Y45 HydrophobicContact CB-CD1 4.25Å; K40-Y45 HydrophobicContact CB-CE1 4.19Å; K40-Y45 HydrophobicContact CG-CD1 4.07Å; K40-Y45 HydrophobicContact CG-CE1 3.58Å; K40-Y45 HydrophobicContact CG-CE2 4.28Å; K40-Q46 PolarHBondContact O-NE2 3.47Å
41	K	85.5	Confident	84.2	Confident	169 Å²	169	94.7 Å²	94.7	74%	0.735	48%	0.482	S	S	*	.	H	α-helix	trans	-85.8	-11.5	175.8	-65.1	176.7	-173	-177.6	0	113	A37 L38 I39	A37-K41 WeakPolarHBondContact O-CG 3.33Å; L38-K41 WeakPolarHBondContact O-CB 3.42Å; L38-K41 PolarHBondContact O-N 3.12Å; I39-K41 PolarHBondContact O-N 2.97Å; I39-K41 VanDerWaalsContact O-N 3.15Å
42	T	86.1	Confident	84.7	Confident	54 Å²	54	92 Å²	92	33%	0.331	47%	0.474	S	S	.	.	S	Bend	trans	-68.7	141.7	179.1	67.8	0	0	0	0	110.9	L38 I39 A44 Y45 Q46	L38-T42 PolarHBondContact O-N 3.14Å; I39-T42 WeakPolarHBondContact O-CB 3.36Å; I39-T42 WeakPolarHBondContact O-CG2 3.33Å; I39-T42 PolarHBondContact O-N 2.82Å; I39-T42 PolarHBondContact O-OG1 3.28Å; T42-A44 PolarHBondContact O-N 3.06Å; T42-Y45 PolarHBondContact O-N 2.88Å; T42-Y45 WeakPolarHBondContact OG1-CB 3.46Å; T42-Y45 PolarHBondContact OG1-N 3.08Å; T42-Q46 PolarHBondContact O-N 3.43Å
43	P	86.5	Confident	85.1	Confident	99 Å²	99	92.9 Å²	92.9	64%	0.643	48%	0.478	S	S	*	.	H	α-helix	trans	-57.3	-34.9	175.3	-26.1	34.3	0	0	0	112.8	Q46 Q47	P43-Q46 PolarHBondContact O-N 2.93Å; P43-Q47 WeakPolarHBondContact O-CB 3.16Å; P43-Q47 VanDerWaalsContact O-CG 3.3Å; P43-Q47 WeakPolarHBondContact O-CG 3.28Å; P43-Q47 PolarHBondContact O-N 3.42Å
44	A	85.1	Confident	85.5	Confident	61 Å²	61	90.8 Å²	90.8	50%	0.504	48%	0.48	S	S	.	.	H	α-helix	trans	-62.9	-47.3	178.7	0	0	0	0	0	112.1	T42 Q46 Q47 V48	T42-A44 PolarHBondContact O-N 3.06Å; A44-Q46 VanDerWaalsContact C-N 3.34Å; A44-Q46 PolarHBondContact O-N 3.39Å; A44-Q47 PolarHBondContact O-N 3.37Å; A44-V48 WeakPolarHBondContact O-CG2 3.43Å; A44-V48 PolarHBondContact O-N 3.5Å
45	Y	85.9	Confident	85.8	Confident	81 Å²	81	87.4 Å²	87.4	32%	0.318	47%	0.468	S	S	.	.	H	α-helix	trans	-61.6	-43.3	176.1	-176.6	-86.9	0	0	0	111.6	I39 K40 T42 Q47 V48 K49	I39-Y45 HydrophobicContact CG2-CD2 3.91Å; I39-Y45 HydrophobicContact CG2-CG 4.38Å; I39-Y45 WeakPolarHBondContact O-CB 3.32Å; K40-Y45 HydrophobicContact CB-CD1 4.25Å; K40-Y45 HydrophobicContact CB-CE1 4.19Å; K40-Y45 HydrophobicContact CG-CD1 4.07Å; K40-Y45 HydrophobicContact CG-CE1 3.58Å; K40-Y45 HydrophobicContact CG-CE2 4.28Å; T42-Y45 PolarHBondContact O-N 2.88Å; T42-Y45 WeakPolarHBondContact OG1-CB 3.46Å; T42-Y45 PolarHBondContact OG1-N 3.08Å; Y45-Q47 PolarHBondContact O-N 3.14Å; Y45-V48 PolarHBondContact O-N 3.1Å; Y45-K49 HydrophobicContact CE1-CB 4.38Å; Y45-K49 HydrophobicContact CE1-CD 4.32Å; Y45-K49 VanDerWaalsContact O-CB 3.32Å; Y45-K49 WeakPolarHBondContact O-CB 3.48Å; Y45-K49 PolarHBondContact O-N 3.36Å
46	Q	85.3	Confident	86	Confident	79 Å²	79	88.5 Å²	88.5	37%	0.369	47%	0.473	S	S	.	.	H	α-helix	trans	-63.4	-40.7	178.2	-68.3	-63.5	-24.5	0	0	112	K40 T42 P43 A44 K49 T50	K40-Q46 PolarHBondContact O-NE2 3.47Å; T42-Q46 PolarHBondContact O-N 3.43Å; P43-Q46 PolarHBondContact O-N 2.93Å; A44-Q46 VanDerWaalsContact C-N 3.34Å; A44-Q46 PolarHBondContact O-N 3.39Å; Q46-K49 PolarHBondContact O-N 2.95Å; Q46-T50 WeakPolarHBondContact O-CB 3.35Å; Q46-T50 PolarHBondContact O-N 3.43Å; Q46-T50 PolarHBondContact O-OG1 2.94Å
47	Q	86.8	Confident	86.3	Confident	124 Å²	124	90.5 Å²	90.5	58%	0.579	48%	0.484	S	S	*	.	H	α-helix	trans	-62.2	-44.3	174.8	-75.6	178.2	4.5	0	0	112.3	P43 A44 Y45 T50 K51	P43-Q47 WeakPolarHBondContact O-CB 3.16Å; P43-Q47 VanDerWaalsContact O-CG 3.3Å; P43-Q47 WeakPolarHBondContact O-CG 3.28Å; P43-Q47 PolarHBondContact O-N 3.42Å; A44-Q47 PolarHBondContact O-N 3.37Å; Y45-Q47 PolarHBondContact O-N 3.14Å; Q47-T50 PolarHBondContact O-N 3.49Å; Q47-K51 WeakPolarHBondContact O-CB 3.28Å; Q47-K51 VanDerWaalsContact O-CG 3.31Å; Q47-K51 WeakPolarHBondContact O-CG 3.48Å; Q47-K51 PolarHBondContact O-N 2.89Å
48	V	85.7	Confident	86.7	Confident	90 Å²	90	93.1 Å²	93.1	55%	0.545	49%	0.489	S	S	.	.	H	α-helix	trans	-64.2	-45.7	176.8	173.9	0	0	0	0	110.3	A44 Y45 T50 K51 V52	A44-V48 WeakPolarHBondContact O-CG2 3.43Å; A44-V48 PolarHBondContact O-N 3.5Å; Y45-V48 PolarHBondContact O-N 3.1Å; V48-T50 PolarHBondContact O-N 2.9Å; V48-K51 PolarHBondContact O-N 2.71Å; V48-V52 HydrophobicContact CG1-CG2 4.23Å; V48-V52 WeakPolarHBondContact O-CB 3.45Å; V48-V52 VanDerWaalsContact O-CG2 3.28Å; V48-V52 WeakPolarHBondContact O-CG2 3.31Å; V48-V52 PolarHBondContact O-N 3.37Å
49	K	86.1	Confident	87	Confident	100 Å²	100	92.9 Å²	92.9	44%	0.435	48%	0.483	S	S	.	.	H	α-helix	trans	-55.8	-50.2	176.6	-177.5	-175.3	175.3	-171.5	0	111.4	Y45 Q46 K51 V52 L53	Y45-K49 HydrophobicContact CE1-CB 4.38Å; Y45-K49 HydrophobicContact CE1-CD 4.32Å; Y45-K49 VanDerWaalsContact O-CB 3.32Å; Y45-K49 WeakPolarHBondContact O-CB 3.48Å; Y45-K49 PolarHBondContact O-N 3.36Å; Q46-K49 PolarHBondContact O-N 2.95Å; K49-K51 PolarHBondContact O-N 3.32Å; K49-V52 PolarHBondContact O-N 3.48Å; K49-L53 HydrophobicContact CG-CD1 4.13Å; K49-L53 WeakPolarHBondContact O-CG 3.47Å; K49-L53 PolarHBondContact O-N 3.3Å
50	T	87.3	Confident	87.2	Confident	88 Å²	88	92.6 Å²	92.6	54%	0.54	48%	0.482	S	S	.	.	H	α-helix	trans	-63	-42.3	179.5	-59.6	0	0	0	0	111.9	Q46 Q47 V48 V52 L53 A54	Q46-T50 WeakPolarHBondContact O-CB 3.35Å; Q46-T50 PolarHBondContact O-N 3.43Å; Q46-T50 PolarHBondContact O-OG1 2.94Å; Q47-T50 PolarHBondContact O-N 3.49Å; V48-T50 PolarHBondContact O-N 2.9Å; T50-V52 PolarHBondContact O-N 2.83Å; T50-L53 PolarHBondContact O-N 3.01Å; T50-A54 WeakPolarHBondContact O-CB 3.4Å; T50-A54 PolarHBondContact O-N 2.77Å
51	K	88	Confident	87.5	Confident	141 Å²	141	93.2 Å²	93.2	61%	0.613	49%	0.489	S	S	*	.	H	α-helix	trans	-62.3	-43.3	176.1	-75.7	179.1	-180	-177	0	112.2	Q47 V48 K49 A54 I55	Q47-K51 WeakPolarHBondContact O-CB 3.28Å; Q47-K51 VanDerWaalsContact O-CG 3.31Å; Q47-K51 WeakPolarHBondContact O-CG 3.48Å; Q47-K51 PolarHBondContact O-N 2.89Å; V48-K51 PolarHBondContact O-N 2.71Å; K49-K51 PolarHBondContact O-N 3.32Å; K51-A54 PolarHBondContact O-N 3.34Å; K51-I55 WeakPolarHBondContact O-CD1 3.32Å; K51-I55 VanDerWaalsContact O-CG1 3.28Å; K51-I55 WeakPolarHBondContact O-CG1 3.37Å; K51-I55 PolarHBondContact O-N 2.89Å; K51-I55 VanDerWaalsContact O-N 3.1Å
52	V	87.2	Confident	87.8	Confident	71 Å²	71	90.6 Å²	90.6	43%	0.43	48%	0.478	S	S	.	.	H	α-helix	trans	-64.2	-45.1	178.1	171	0	0	0	0	110.5	V48 K49 T50 I55 L56	V48-V52 HydrophobicContact CG1-CG2 4.23Å; V48-V52 WeakPolarHBondContact O-CB 3.45Å; V48-V52 VanDerWaalsContact O-CG2 3.28Å; V48-V52 WeakPolarHBondContact O-CG2 3.31Å; V48-V52 PolarHBondContact O-N 3.37Å; K49-V52 PolarHBondContact O-N 3.48Å; T50-V52 PolarHBondContact O-N 2.83Å; V52-I55 PolarHBondContact O-N 3.26Å; V52-L56 WeakPolarHBondContact O-CB 3.42Å; V52-L56 PolarHBondContact O-N 2.81Å
53	L	88.1	Confident	88	Confident	91 Å²	91	94.2 Å²	94.2	48%	0.476	49%	0.489	S	S	.	.	H	α-helix	trans	-61	-45	177.1	-72.5	174.3	0	0	0	112	K49 T50 I55 L56 D57	K49-L53 HydrophobicContact CG-CD1 4.13Å; K49-L53 WeakPolarHBondContact O-CG 3.47Å; K49-L53 PolarHBondContact O-N 3.3Å; T50-L53 PolarHBondContact O-N 3.01Å; L53-I55 PolarHBondContact O-N 2.99Å; L53-L56 PolarHBondContact O-N 2.97Å; L53-L56 VanDerWaalsContact O-N 3.12Å; L53-D57 PolarHBondContact O-N 2.84Å
54	A	89	Confident	88.1	Confident	59 Å²	59	92.9 Å²	92.9	49%	0.488	48%	0.479	S	S	.	.	H	α-helix	trans	-61.6	-41.3	178.6	0	0	0	0	0	112.7	T50 K51 L56 E58	T50-A54 WeakPolarHBondContact O-CB 3.4Å; T50-A54 PolarHBondContact O-N 2.77Å; K51-A54 PolarHBondContact O-N 3.34Å; A54-L56 VanDerWaalsContact C-N 3.31Å; A54-E58 PolarHBondContact O-N 3.26Å
55	I	89.8	Confident	88.3	Confident	66 Å²	66	94.2 Å²	94.2	34%	0.338	48%	0.477	S	S	.	.	H	α-helix	trans	-66.4	-36.7	175.7	-67.5	165.5	0	0	0	111	Y5 K51 V52 L53 K59	Y5-I55 HydrophobicContact CE1-CG2 4.32Å; K51-I55 WeakPolarHBondContact O-CD1 3.32Å; K51-I55 VanDerWaalsContact O-CG1 3.28Å; K51-I55 WeakPolarHBondContact O-CG1 3.37Å; K51-I55 PolarHBondContact O-N 2.89Å; K51-I55 VanDerWaalsContact O-N 3.1Å; V52-I55 PolarHBondContact O-N 3.26Å; L53-I55 PolarHBondContact O-N 2.99Å; I55-K59 HydrophobicContact CG2-CD 4.29Å; I55-K59 WeakPolarHBondContact O-CB 3.2Å; I55-K59 VanDerWaalsContact O-CG 3.32Å; I55-K59 WeakPolarHBondContact O-CG 3.32Å; I55-K59 PolarHBondContact O-N 2.85Å; I55-K59 VanDerWaalsContact O-N 3.14Å
56	L	86.8	Confident	88.5	Confident	94 Å²	94	94.2 Å²	94.2	49%	0.492	48%	0.483	S	S	.	.	H	α-helix	trans	-69.6	-44.1	179.7	-150.2	72.6	0	0	0	110.9	V52 L53 A54 K59 I60	V52-L56 WeakPolarHBondContact O-CB 3.42Å; V52-L56 PolarHBondContact O-N 2.81Å; L53-L56 PolarHBondContact O-N 2.97Å; L53-L56 VanDerWaalsContact O-N 3.12Å; A54-L56 VanDerWaalsContact C-N 3.31Å; L56-K59 PolarHBondContact O-N 3.49Å; L56-I60 HydrophobicContact CG-CD1 4.38Å; L56-I60 VanDerWaalsContact O-CG1 3.24Å; L56-I60 WeakPolarHBondContact O-CG1 3.14Å; L56-I60 PolarHBondContact O-N 3.32Å
57	D	89.8	Confident	88.6	Confident	102 Å²	102	94.4 Å²	94.4	55%	0.545	48%	0.484	S	S	.	.	H	α-helix	trans	-57.2	-49.9	173.5	-95.7	2.9	0	0	0	111.1	L53 K59 I60 D61	L53-D57 PolarHBondContact O-N 2.84Å; D57-K59 PolarHBondContact O-N 3.48Å; D57-I60 WeakPolarHBondContact O-CB 3.39Å; D57-I60 PolarHBondContact O-N 3.46Å; D57-D61 PolarHBondContact O-N 3.47Å
58	E	90.5	Very high	88.6	Confident	102 Å²	102	93.3 Å²	93.3	48%	0.477	48%	0.481	S	S	.	.	H	α-helix	trans	-60	-37	179.6	-166.9	-165.5	152.8	0	0	112.1	A54 K62	A54-E58 PolarHBondContact O-N 3.26Å; E58-K62 WeakPolarHBondContact O-CB 3.48Å; E58-K62 WeakPolarHBondContact O-CG 3.2Å; E58-K62 PolarHBondContact O-N 3.27Å; E58-K62 WeakPolarHBondContact OE1-CE 3.22Å; E58-K62 IonicContact OE1-NZ 2.65Å; E58-K62 PolarHBondContact OE1-NZ 3.26Å
59	K	89.5	Confident	88.5	Confident	100 Å²	100	97.7 Å²	97.7	44%	0.435	49%	0.487	S	S	.	.	H	α-helix	trans	-69.6	-38.5	175.7	-77.2	178.5	178.4	-174.8	0	112.2	I55 L56 D57 F63	I55-K59 HydrophobicContact CG2-CD 4.29Å; I55-K59 WeakPolarHBondContact O-CB 3.2Å; I55-K59 VanDerWaalsContact O-CG 3.32Å; I55-K59 WeakPolarHBondContact O-CG 3.32Å; I55-K59 PolarHBondContact O-N 2.85Å; I55-K59 VanDerWaalsContact O-N 3.14Å; L56-K59 PolarHBondContact O-N 3.49Å; D57-K59 PolarHBondContact O-N 3.48Å; K59-F63 WeakPolarHBondContact O-CB 3.31Å; K59-F63 PolarHBondContact O-N 2.85Å
60	I	89.4	Confident	88.3	Confident	83 Å²	83	100.9 Å²	100.9	43%	0.426	50%	0.501	S	S	.	.	H	α-helix	trans	-64.9	-47.4	175.7	-69.5	163.3	0	0	0	109.5	L56 D57 K62 F63 V64	L56-I60 HydrophobicContact CG-CD1 4.38Å; L56-I60 VanDerWaalsContact O-CG1 3.24Å; L56-I60 WeakPolarHBondContact O-CG1 3.14Å; L56-I60 PolarHBondContact O-N 3.32Å; D57-I60 WeakPolarHBondContact O-CB 3.39Å; D57-I60 PolarHBondContact O-N 3.46Å; I60-K62 PolarHBondContact O-N 3.38Å; I60-F63 WeakPolarHBondContact O-CB 3.45Å; I60-F63 PolarHBondContact O-N 2.74Å; I60-F63 VanDerWaalsContact O-N 3.15Å; I60-V64 HydrophobicContact CG2-CG2 4.26Å; I60-V64 WeakPolarHBondContact O-CG2 3.44Å; I60-V64 PolarHBondContact O-N 3.02Å
61	D	90.1	Very high	87.8	Confident	103 Å²	103	105.4 Å²	105.4	55%	0.551	51%	0.514	S	S	*	.	H	α-helix	trans	-58.1	-47	177.6	-76.6	-16.3	0	0	0	111.6	D57 F63 V64 L65	D57-D61 PolarHBondContact O-N 3.47Å; D61-F63 PolarHBondContact O-N 2.89Å; D61-V64 PolarHBondContact O-N 3.36Å; D61-L65 VanDerWaalsContact O-CB 3.32Å; D61-L65 WeakPolarHBondContact O-CB 3.3Å; D61-L65 VanDerWaalsContact O-CG 3.26Å; D61-L65 WeakPolarHBondContact O-CG 3.49Å; D61-L65 PolarHBondContact O-N 2.97Å
62	K	91.6	Very high	86.7	Confident	114 Å²	114	105.2 Å²	105.2	50%	0.496	54%	0.538	S	S	.	.	H	α-helix	trans	-60.3	-45.1	175.1	-78.6	173.5	173.8	165.9	0	112	E58 I60 V64 L65 D66	E58-K62 WeakPolarHBondContact O-CB 3.48Å; E58-K62 WeakPolarHBondContact O-CG 3.2Å; E58-K62 PolarHBondContact O-N 3.27Å; E58-K62 WeakPolarHBondContact OE1-CE 3.22Å; E58-K62 IonicContact OE1-NZ 2.65Å; E58-K62 PolarHBondContact OE1-NZ 3.26Å; I60-K62 PolarHBondContact O-N 3.38Å; K62-V64 PolarHBondContact O-N 3.18Å; K62-L65 PolarHBondContact O-N 2.94Å; K62-D66 WeakPolarHBondContact O-CB 3.47Å; K62-D66 PolarHBondContact O-N 2.83Å
63	F	89.4	Confident	86.7	Confident	131 Å²	131	106.9 Å²	106.9	58%	0.575	54%	0.543	S	S	*	.	H	α-helix	trans	-61.7	-44.3	177.6	179.2	-98.7	0	0	0	111.8	K59 I60 D61 D66 Q67	K59-F63 WeakPolarHBondContact O-CB 3.31Å; K59-F63 PolarHBondContact O-N 2.85Å; I60-F63 WeakPolarHBondContact O-CB 3.45Å; I60-F63 PolarHBondContact O-N 2.74Å; I60-F63 VanDerWaalsContact O-N 3.15Å; D61-F63 PolarHBondContact O-N 2.89Å; F63-D66 PolarHBondContact O-N 3.32Å; F63-Q67 HydrophobicContact CD1-CG 4.34Å; F63-Q67 HydrophobicContact CE1-CG 4.05Å; F63-Q67 HydrophobicContact CZ-CG 4.17Å; F63-Q67 VanDerWaalsContact CZ-NE2 3.35Å; F63-Q67 WeakPolarHBondContact O-CG 3.45Å; F63-Q67 PolarHBondContact O-N 3.44Å
64	V	88	Confident	86.6	Confident	70 Å²	70	107.7 Å²	107.7	42%	0.424	55%	0.547	S	S	.	.	H	α-helix	trans	-64.9	-44.7	177.5	172.1	0	0	0	0	110.8	I60 D61 K62 D66 Q67 I68	I60-V64 HydrophobicContact CG2-CG2 4.26Å; I60-V64 WeakPolarHBondContact O-CG2 3.44Å; I60-V64 PolarHBondContact O-N 3.02Å; D61-V64 PolarHBondContact O-N 3.36Å; K62-V64 PolarHBondContact O-N 3.18Å; V64-D66 PolarHBondContact O-N 3.46Å; V64-Q67 WeakPolarHBondContact O-CB 3.37Å; V64-Q67 PolarHBondContact O-N 2.89Å; V64-I68 HydrophobicContact CG1-CD1 3.94Å; V64-I68 WeakPolarHBondContact O-CG1 3.37Å; V64-I68 PolarHBondContact O-N 3.29Å
65	L	89.2	Confident	86.5	Confident	90 Å²	90	110.4 Å²	110.4	47%	0.471	55%	0.55	S	S	.	*	H	α-helix	trans	-61.2	-42.9	176.5	-76.7	170.8	0	0	0	112.2	D61 K62 Q67 I68 R69	D61-L65 VanDerWaalsContact O-CB 3.32Å; D61-L65 WeakPolarHBondContact O-CB 3.3Å; D61-L65 VanDerWaalsContact O-CG 3.26Å; D61-L65 WeakPolarHBondContact O-CG 3.49Å; D61-L65 PolarHBondContact O-N 2.97Å; K62-L65 PolarHBondContact O-N 2.94Å; L65-Q67 VanDerWaalsContact C-N 3.3Å; L65-Q67 PolarHBondContact O-N 3.13Å; L65-I68 PolarHBondContact O-N 3.15Å; L65-R69 WeakPolarHBondContact O-CG 3.26Å; L65-R69 PolarHBondContact O-N 2.97Å
66	D	91.3	Very high	86.3	Confident	81 Å²	81	113.1 Å²	113.1	43%	0.433	56%	0.563	S	S	.	*	H	α-helix	trans	-63.9	-37.1	176	-77.9	-14.3	0	0	0	111.6	K62 F63 V64 R69 K70	K62-D66 WeakPolarHBondContact O-CB 3.47Å; K62-D66 PolarHBondContact O-N 2.83Å; F63-D66 PolarHBondContact O-N 3.32Å; V64-D66 PolarHBondContact O-N 3.46Å; D66-R69 PolarHBondContact O-N 2.84Å; D66-K70 WeakPolarHBondContact O-CB 3.44Å; D66-K70 VanDerWaalsContact O-CG 3.3Å; D66-K70 WeakPolarHBondContact O-CG 3.46Å; D66-K70 PolarHBondContact O-N 3.19Å
67	Q	87.3	Confident	86.2	Confident	83 Å²	83	114.3 Å²	114.3	39%	0.388	57%	0.567	S	S	.	*	H	α-helix	trans	-67.9	-36.9	174.9	-69.2	-74.9	19.9	0	0	112.5	F63 V64 L65 K71	F63-Q67 HydrophobicContact CD1-CG 4.34Å; F63-Q67 HydrophobicContact CE1-CG 4.05Å; F63-Q67 HydrophobicContact CZ-CG 4.17Å; F63-Q67 VanDerWaalsContact CZ-NE2 3.35Å; F63-Q67 WeakPolarHBondContact O-CG 3.45Å; F63-Q67 PolarHBondContact O-N 3.44Å; V64-Q67 WeakPolarHBondContact O-CB 3.37Å; V64-Q67 PolarHBondContact O-N 2.89Å; L65-Q67 VanDerWaalsContact C-N 3.3Å; L65-Q67 PolarHBondContact O-N 3.13Å; Q67-K71 WeakPolarHBondContact O-CG 3.33Å; Q67-K71 PolarHBondContact O-N 2.66Å
68	I	87.2	Confident	86	Confident	101 Å²	101	115.1 Å²	115.1	52%	0.518	57%	0.568	S	S	.	*	H	α-helix	trans	-66.9	-47	174.2	-66.7	165.9	0	0	0	110	V64 L65 K70 K71 A72	V64-I68 HydrophobicContact CG1-CD1 3.94Å; V64-I68 WeakPolarHBondContact O-CG1 3.37Å; V64-I68 PolarHBondContact O-N 3.29Å; L65-I68 PolarHBondContact O-N 3.15Å; I68-K70 VanDerWaalsContact C-N 3.28Å; I68-K70 PolarHBondContact O-N 3.46Å; I68-K71 PolarHBondContact O-N 3.25Å; I68-A72 PolarHBondContact O-N 2.92Å
69	R	83.7	Confident	85.7	Confident	182 Å²	182	116 Å²	116	69%	0.687	58%	0.575	S	S	*	*	H	α-helix	trans	-62.6	-30.4	178.8	-76.1	-179.5	-176	172.5	0.7	114	L65 D66 K71	L65-R69 WeakPolarHBondContact O-CG 3.26Å; L65-R69 PolarHBondContact O-N 2.97Å; D66-R69 PolarHBondContact O-N 2.84Å; R69-K71 VanDerWaalsContact C-N 3.33Å
70	K	81.3	Confident	85.4	Confident	167 Å²	167	117.2 Å²	117.2	73%	0.726	59%	0.586	S	S	*	*	H	α-helix	trans	-76.8	-20.1	175	-75.4	177.1	-178	-179.5	0	113.3	D66 I68	D66-K70 WeakPolarHBondContact O-CB 3.44Å; D66-K70 VanDerWaalsContact O-CG 3.3Å; D66-K70 WeakPolarHBondContact O-CG 3.46Å; D66-K70 PolarHBondContact O-N 3.19Å; I68-K70 VanDerWaalsContact C-N 3.28Å; I68-K70 PolarHBondContact O-N 3.46Å
71	K	77.4	Confident	85	Confident	183 Å²	183	120.1 Å²	120.1	80%	0.796	60%	0.599	S	S	*	*	H	α-helix	trans	-94.6	-22.8	179.1	-76	-174.8	176.7	-173.4	0	113.4	Q67 I68 R69	Q67-K71 WeakPolarHBondContact O-CG 3.33Å; Q67-K71 PolarHBondContact O-N 2.66Å; I68-K71 PolarHBondContact O-N 3.25Å; R69-K71 VanDerWaalsContact C-N 3.33Å
72	A	64	Low	84.6	Confident	136 Å²	136	121.6 Å²	121.6	100%	1.124	60%	0.603	S	S	*	*			trans	-81.4	0	170.9	0	0	0	0	0	110.5	I68	I68-A72 PolarHBondContact O-N 2.92Å

Retrieved 72 of 72 residues in 47.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).