A0A5K4F6J6_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession A0A5K4F6J6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 76 aa.

						>A0A5K4F6J6_SCHMA|A0A5K4F6J6
MICLKKAVAVFSLELVDRRTVTYGYPCVTSVPLVWVKALHAYNRAFELATMRLDTGTVRMFVTRVHPSTAVTRCSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.4	Very low	59.7	Low	163 Å²	163	62.6 Å²	62.6	80%	0.803	32%	0.32	S	S	*	.				0	100	0	-156.4	173.4	-75.6	0	0	113.4	C74 S75 S76	M1-C74 HydrophobicContact CG-CB 3.85Å; M1-C74 HydrophobicContact SD-CB 4.13Å; M1-S75 CarbonylContact C-O 3.54Å; M1-S75 WeakPolarHBondContact CA-O 3.11Å; M1-S75 WeakPolarHBondContact CG-O 3.09Å; M1-S76 WeakPolarHBondContact CA-OXT 3.33Å; M1-S76 PolarHBondContact N-OXT 3.13Å
2	I	54.5	Low	60.4	Low	126 Å²	126	59.2 Å²	59.2	65%	0.646	31%	0.306	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.4	117.4	175.2	-61.5	173.3	0	0	0	108.4	C74 S75	I2-C74 WeakPolarHBondContact O-CA 3.37Å; I2-S75 PolarHBondContact N-O 3.46Å; I2-S75 VanDerWaalsContact N-O 3.11Å; I2-S75 PolarHBondContact O-N 3.4Å; I2-S75 VanDerWaalsContact O-N 3.1Å
3	C	52.1	Low	61	Low	63 Å²	63	59.3 Å²	59.3	43%	0.426	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.8	116.7	176.9	-63.8	0	0	0	0	110.8	K5 V71 C74	C3-K5 PolarHBondContact O-N 2.83Å; C3-V71 HydrophobicContact CB-CG1 3.95Å; C3-C74 HydrophobicContact CB-CB 4.16Å; C3-C74 WeakPolarHBondContact CB-SG 3.5Å; C3-C74 WeakPolarHBondContact SG-CB 3.37Å; C3-C74 CovalentContact SG-SG 2.05Å; C3-C74 PolarHBondContact SG-SG 2.05Å
4	L	57.1	Low	61.9	Low	78 Å²	78	57.1 Å²	57.1	41%	0.408	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	102.8	174.6	-80.9	158.5	0	0	0	109.7	V34 T72 R73	L4-V34 HydrophobicContact CD2-CG2 3.51Å; L4-T72 PolarHBondContact O-N 2.82Å; L4-T72 VanDerWaalsContact O-N 3.11Å; L4-T72 PolarHBondContact O-OG1 3.21Å; L4-R73 PolarHBondContact N-O 2.79Å; L4-R73 VanDerWaalsContact N-O 3.09Å
5	K	56.6	Low	62.7	Low	121 Å²	121	56.8 Å²	56.8	53%	0.526	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.3	138.4	168.5	-74.7	-170.2	176.7	-174.5	0	109.8	C3 L33	C3-K5 PolarHBondContact O-N 2.83Å; K5-L33 HydrophobicContact CB-CB 4.46Å; K5-L33 HydrophobicContact CB-CD1 3.36Å; K5-L33 HydrophobicContact CD-CD1 4.43Å; K5-L33 WeakPolarHBondContact O-CB 3.49Å; K5-L33 PolarHBondContact O-N 3.25Å; K5-L33 VanDerWaalsContact O-N 3.09Å
6	K	58.6	Low	63.5	Low	61 Å²	61	56.4 Å²	56.4	27%	0.265	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.9	157.2	168.4	-101.2	158.7	178.1	-177.1	0	109.7	S68 A70 T72	K6-S68 WeakPolarHBondContact O-CA 3.39Å; K6-S68 WeakPolarHBondContact O-CB 3.34Å; K6-S68 PolarHBondContact O-N 2.78Å; K6-S68 VanDerWaalsContact O-O 3.11Å; K6-A70 HydrophobicContact CB-CB 4.39Å; K6-A70 WeakPolarHBondContact CB-O 3.24Å; K6-A70 PolarHBondContact N-O 3.17Å; K6-T72 HydrophobicContact CD-CG2 4.05Å; K6-T72 WeakPolarHBondContact CD-OG1 3.44Å; K6-T72 WeakPolarHBondContact CE-OG1 3.43Å; K6-T72 WeakPolarHBondContact CG-OG1 3.22Å
7	A	62.4	Low	64.4	Low	0 Å²	0	57.3 Å²	57.3	0%	0	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.5	149.1	165.3	0	0	0	0	0	108.2	S30 V31 L33 V36 V65 H66	A7-S30 CarbonylContact O-C 3.48Å; A7-S30 WeakPolarHBondContact O-CA 3.39Å; A7-V31 PolarHBondContact N-O 2.77Å; A7-V31 WeakPolarHBondContact O-CG2 3.35Å; A7-V31 PolarHBondContact O-N 2.68Å; A7-L33 HydrophobicContact CB-CD1 4.32Å; A7-L33 HydrophobicContact CB-CG 4.24Å; A7-V36 HydrophobicContact CB-CB 4.42Å; A7-V36 HydrophobicContact CB-CG2 3.51Å; A7-V65 HydrophobicContact CB-CG1 3.82Å; A7-H66 CarbonylContact C-O 3.56Å; A7-H66 WeakPolarHBondContact CA-O 3.31Å; A7-H66 WeakPolarHBondContact CB-O 3.12Å
8	V	63.3	Low	64	Low	39 Å²	39	67.7 Å²	67.7	24%	0.236	33%	0.334	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.2	110.3	174.8	162.8	0	0	0	0	106.8	V28 V65 H66	V8-V28 HydrophobicContact CG1-CG1 3.48Å; V8-V28 VanDerWaalsContact CG1-CG1 3.48Å; V8-V65 CarbonylContact O-C 3.56Å; V8-V65 WeakPolarHBondContact O-CA 3.18Å; V8-H66 HydrophobicContact CB-CB 4.42Å; V8-H66 PolarHBondContact N-O 2.89Å; V8-H66 PolarHBondContact O-N 3.11Å
9	A	65.6	Low	63.8	Low	0 Å²	0	77 Å²	77	0%	0	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.7	137.8	170.8	0	0	0	0	0	109.6	F11 T29 V31 V62 R64 V65	A9-F11 HydrophobicContact CB-CD2 4.25Å; A9-F11 HydrophobicContact CB-CE1 4.37Å; A9-F11 HydrophobicContact CB-CE2 3.35Å; A9-F11 HydrophobicContact CB-CZ 3.46Å; A9-F11 VanDerWaalsContact CB-CZ 3.46Å; A9-F11 WeakPolarHBondContact O-CD2 3.36Å; A9-F11 WeakPolarHBondContact O-CE2 3.33Å; A9-T29 PolarHBondContact N-O 2.94Å; A9-T29 VanDerWaalsContact N-O 3.08Å; A9-T29 PolarHBondContact O-N 3.29Å; A9-V31 HydrophobicContact CB-CG2 3.52Å; A9-V62 HydrophobicContact CB-CG1 4.24Å; A9-V62 HydrophobicContact CB-CG2 4.5Å; A9-R64 WeakPolarHBondContact CA-O 3.42Å; A9-V65 HydrophobicContact CB-CG1 4.39Å; A9-V65 HydrophobicContact CB-CG2 4.14Å
10	V	67.1	Low	63.3	Low	26 Å²	26	77.8 Å²	77.8	16%	0.158	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100	120.3	173	-177.9	0	0	0	0	107.1	P26 V28 V62 T63 R64	V10-P26 HydrophobicContact CG1-CB 3.42Å; V10-P26 VanDerWaalsContact CG1-CB 3.42Å; V10-V28 HydrophobicContact CG2-CG2 4.47Å; V10-V62 WeakPolarHBondContact O-CA 3.37Å; V10-T63 PolarHBondContact O-N 3.1Å; V10-T63 PolarHBondContact O-OG1 3.11Å; V10-R64 HydrophobicContact CB-CB 4.17Å; V10-R64 HydrophobicContact CG2-CB 4.18Å; V10-R64 PolarHBondContact N-O 3.09Å
11	F	70.2	Confident	63.4	Low	12 Å²	12	77.1 Å²	77.1	5%	0.053	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	132.4	-178.8	-55.5	-101.2	0	0	0	108.9	A9 P26 C27 T29 V31 L48 M60 F61 V62	A9-F11 HydrophobicContact CB-CD2 4.25Å; A9-F11 HydrophobicContact CB-CE1 4.37Å; A9-F11 HydrophobicContact CB-CE2 3.35Å; A9-F11 HydrophobicContact CB-CZ 3.46Å; A9-F11 VanDerWaalsContact CB-CZ 3.46Å; A9-F11 WeakPolarHBondContact O-CD2 3.36Å; A9-F11 WeakPolarHBondContact O-CE2 3.33Å; F11-P26 VanDerWaalsContact O-CA 3.24Å; F11-P26 WeakPolarHBondContact O-CA 3.4Å; F11-C27 WeakPolarHBondContact CD2-O 3.41Å; F11-C27 PolarHBondContact N-O 2.83Å; F11-C27 PolarHBondContact O-N 2.6Å; F11-C27 VanDerWaalsContact O-N 3.14Å; F11-T29 HydrophobicContact CD2-CG2 3.86Å; F11-T29 HydrophobicContact CE2-CG2 3.09Å; F11-T29 HydrophobicContact CZ-CG2 3.55Å; F11-V31 HydrophobicContact CZ-CG1 3.99Å; F11-L48 HydrophobicContact CD1-CD1 3.43Å; F11-L48 VanDerWaalsContact CD1-CD1 3.43Å; F11-L48 HydrophobicContact CE1-CD1 3.3Å; F11-M60 HydrophobicContact CB-CE 3.91Å; F11-M60 HydrophobicContact CD1-CE 3.17Å; F11-M60 HydrophobicContact CE1-CE 3.78Å; F11-M60 HydrophobicContact CG-CE 3.67Å; F11-F61 CarbonylContact C-O 3.57Å; F11-F61 WeakPolarHBondContact CA-O 3.45Å; F11-V62 HydrophobicContact CD1-CG2 3.39Å; F11-V62 HydrophobicContact CE1-CG2 3.33Å; F11-V62 HydrophobicContact CG-CG2 4.25Å; F11-V62 HydrophobicContact CZ-CG2 4.05Å
12	S	68.3	Low	64	Low	21 Å²	21	73 Å²	73	15%	0.147	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	135.3	173.6	-60.5	0	0	0	0	108.7	F61 T63	S12-F61 PolarHBondContact N-O 3.11Å; S12-F61 PolarHBondContact O-N 2.83Å; S12-T63 VanDerWaalsContact OG-CG2 3.29Å; S12-T63 WeakPolarHBondContact OG-CG2 3.43Å; S12-T63 PolarHBondContact OG-OG1 2.85Å; S12-T63 VanDerWaalsContact OG-OG1 3.13Å
13	L	68.4	Low	64.5	Low	61 Å²	61	75 Å²	75	32%	0.319	36%	0.36	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.4	139	172.7	-72.7	153.5	0	0	0	108.2	Y23 G24 V58 R59 M60	L13-Y23 CarbonylContact O-C 3.56Å; L13-Y23 WeakPolarHBondContact O-CA 3.32Å; L13-G24 PolarHBondContact O-N 3.17Å; L13-V58 HydrophobicContact CD2-CG1 3.74Å; L13-R59 CarbonylContact C-O 3.59Å; L13-R59 WeakPolarHBondContact CA-O 3.47Å; L13-M60 HydrophobicContact CD2-CB 3.86Å; L13-M60 HydrophobicContact CD2-CG 4.14Å
14	E	73.5	Confident	64.8	Low	28 Å²	28	73.4 Å²	73.4	13%	0.131	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	116.4	174.6	-167.8	-170.6	163.8	0	0	108	V16 V21 T22 Y23 V58 R59 F61	E14-V16 HydrophobicContact CG-CG2 3.95Å; E14-V16 WeakPolarHBondContact OE1-CG2 3.34Å; E14-V21 HydrophobicContact CG-CG1 3.35Å; E14-V21 WeakPolarHBondContact OE1-CG1 3.18Å; E14-V21 WeakPolarHBondContact OE1-CG2 3.12Å; E14-T22 WeakPolarHBondContact CA-O 3.5Å; E14-Y23 HydrophobicContact CG-CD1 4.47Å; E14-Y23 HydrophobicContact CG-CE1 4.21Å; E14-V58 CarbonylContact O-C 3.58Å; E14-V58 WeakPolarHBondContact O-CA 3.2Å; E14-R59 PolarHBondContact N-O 3.32Å; E14-R59 PolarHBondContact O-N 2.79Å; E14-F61 HydrophobicContact CB-CD2 4.4Å; E14-F61 HydrophobicContact CB-CE2 3.53Å; E14-F61 HydrophobicContact CB-CZ 4.35Å; E14-F61 HydrophobicContact CG-CE2 4.45Å; E14-F61 WeakPolarHBondContact OE2-CE2 3.37Å; E14-F61 WeakPolarHBondContact OE2-CZ 3.15Å
15	L	73.7	Confident	64.8	Low	53 Å²	53	80 Å²	80	28%	0.277	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.5	116.4	167	-177.1	75.2	0	0	0	107.9	V21 T22 V58	L15-V21 WeakPolarHBondContact O-CA 3.43Å; L15-T22 PolarHBondContact N-O 2.81Å; L15-T22 PolarHBondContact O-N 2.88Å; L15-V58 HydrophobicContact CD1-CG2 3.4Å
16	V	75.3	Confident	65	Low	51 Å²	51	78.2 Å²	78.2	31%	0.309	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	104.6	174	-173.1	0	0	0	0	108.2	E14 V21 T57	E14-V16 HydrophobicContact CG-CG2 3.95Å; E14-V16 WeakPolarHBondContact OE1-CG2 3.34Å; V16-V21 HydrophobicContact CG2-CG2 4.41Å; V16-T57 PolarHBondContact N-O 3.09Å; V16-T57 PolarHBondContact O-N 3.38Å
17	D	78.5	Confident	64.9	Low	71 Å²	71	78.1 Å²	78.1	38%	0.38	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	114.7	168.5	-178.6	20.4	0	0	0	110	R19 T20 T55	D17-R19 PolarHBondContact O-N 2.93Å; D17-T20 PolarHBondContact N-O 2.82Å; D17-T20 VanDerWaalsContact N-O 3.17Å; D17-T20 PolarHBondContact O-N 2.81Å; D17-T55 VanDerWaalsContact CB-O 3.24Å; D17-T55 WeakPolarHBondContact CB-O 3.48Å
18	R	58.1	Low	64.9	Low	244 Å²	244	83 Å²	83	92%	0.921	41%	0.412	S	S	*	.	T	Hydrogen-bonded Turn	trans	39.8	-34.7	173.8	-71.2	-176.6	-179.2	-170.3	2.1	119.5
19	R	59.6	Low	64.8	Low	245 Å²	245	84.6 Å²	84.6	93%	0.925	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-151.4	-6.2	171.2	-68.4	-169.1	174.9	166.4	-2.4	115.2	D17	D17-R19 PolarHBondContact O-N 2.93Å
20	T	54.5	Low	64.6	Low	92 Å²	92	87.6 Å²	87.6	56%	0.564	44%	0.443	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118	128.2	-171.8	-42.7	0	0	0	0	110.5	D17	D17-T20 PolarHBondContact N-O 2.82Å; D17-T20 VanDerWaalsContact N-O 3.17Å; D17-T20 PolarHBondContact O-N 2.81Å
21	V	64.8	Low	64.4	Low	64 Å²	64	87.4 Å²	87.4	39%	0.388	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	119.1	174.5	172	0	0	0	0	108.2	E14 L15 V16 Y23	E14-V21 HydrophobicContact CG-CG1 3.35Å; E14-V21 WeakPolarHBondContact OE1-CG1 3.18Å; E14-V21 WeakPolarHBondContact OE1-CG2 3.12Å; L15-V21 WeakPolarHBondContact O-CA 3.43Å; V16-V21 HydrophobicContact CG2-CG2 4.41Å; V21-Y23 HydrophobicContact CG1-CD2 4.15Å; V21-Y23 HydrophobicContact CG1-CE1 4.18Å; V21-Y23 HydrophobicContact CG1-CE2 3.57Å
22	T	62.4	Low	63.8	Low	78 Å²	78	89.8 Å²	89.8	48%	0.479	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	116.9	178.2	-13.4	0	0	0	0	109.5	E14 L15	E14-T22 WeakPolarHBondContact CA-O 3.5Å; L15-T22 PolarHBondContact N-O 2.81Å; L15-T22 PolarHBondContact O-N 2.88Å
23	Y	64.2	Low	63.3	Low	167 Å²	167	91.1 Å²	91.1	66%	0.655	46%	0.464	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.6	120	178.3	-64.2	-82.5	0	0	0	110.5	L13 E14 V21	L13-Y23 CarbonylContact O-C 3.56Å; L13-Y23 WeakPolarHBondContact O-CA 3.32Å; E14-Y23 HydrophobicContact CG-CD1 4.47Å; E14-Y23 HydrophobicContact CG-CE1 4.21Å; V21-Y23 HydrophobicContact CG1-CD2 4.15Å; V21-Y23 HydrophobicContact CG1-CE1 4.18Å; V21-Y23 HydrophobicContact CG1-CE2 3.57Å
24	G	58.5	Low	62.8	Low	30 Å²	30	92.9 Å²	92.9	31%	0.309	48%	0.477	S	S	.	.	P	Polyproline II helix	trans	-75.4	155.3	171.5	0	0	0	0	0	112.1	L13	L13-G24 PolarHBondContact O-N 3.17Å
25	Y	57.4	Low	61.9	Low	217 Å²	217	99.6 Å²	99.6	85%	0.851	50%	0.501	S	S	*	.	P	Polyproline II helix	trans	-57.6	139.6	-179	-78.7	-88.7	0	0	0	112	C27	Y25-C27 PolarHBondContact O-N 2.61Å; Y25-C27 VanDerWaalsContact O-N 3.13Å
26	P	60.7	Low	61	Low	82 Å²	82	97.9 Å²	97.9	53%	0.532	49%	0.493	S	S	.	.	P	Polyproline II helix	trans	-61.8	116.3	177.5	21.7	-29.7	0	0	0	110.9	V10 F11	V10-P26 HydrophobicContact CG1-CB 3.42Å; V10-P26 VanDerWaalsContact CG1-CB 3.42Å; F11-P26 VanDerWaalsContact O-CA 3.24Å; F11-P26 WeakPolarHBondContact O-CA 3.4Å
27	C	56.4	Low	59.8	Low	60 Å²	60	103.4 Å²	103.4	41%	0.405	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	135.6	169.3	23.4	0	0	0	0	109.4	F11 Y25	F11-C27 WeakPolarHBondContact CD2-O 3.41Å; F11-C27 PolarHBondContact N-O 2.83Å; F11-C27 PolarHBondContact O-N 2.6Å; F11-C27 VanDerWaalsContact O-N 3.14Å; Y25-C27 PolarHBondContact O-N 2.61Å; Y25-C27 VanDerWaalsContact O-N 3.13Å
28	V	62.4	Low	58.5	Low	101 Å²	101	102.5 Å²	102.5	61%	0.612	52%	0.515	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.2	114.3	179.4	168	0	0	0	0	107.9	V8 V10	V8-V28 HydrophobicContact CG1-CG1 3.48Å; V8-V28 VanDerWaalsContact CG1-CG1 3.48Å; V10-V28 HydrophobicContact CG2-CG2 4.47Å
29	T	61.1	Low	58.1	Low	73 Å²	73	92.2 Å²	92.2	45%	0.448	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.8	148.4	172	-173.5	0	0	0	0	112.6	A9 F11 V31	A9-T29 PolarHBondContact N-O 2.94Å; A9-T29 VanDerWaalsContact N-O 3.08Å; A9-T29 PolarHBondContact O-N 3.29Å; F11-T29 HydrophobicContact CD2-CG2 3.86Å; F11-T29 HydrophobicContact CE2-CG2 3.09Å; F11-T29 HydrophobicContact CZ-CG2 3.55Å; T29-V31 HydrophobicContact CG2-CG1 4.35Å; T29-V31 PolarHBondContact O-N 2.81Å
30	S	61.9	Low	57.7	Low	64 Å²	64	87.8 Å²	87.8	45%	0.448	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.8	105.4	177.9	-66.3	0	0	0	0	109.4	A7	A7-S30 CarbonylContact O-C 3.48Å; A7-S30 WeakPolarHBondContact O-CA 3.39Å
31	V	62.5	Low	57.6	Low	22 Å²	22	87.2 Å²	87.2	13%	0.133	47%	0.473	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.4	148	177.1	-78.3	0	0	0	0	111.8	A7 A9 F11 T29 L33 V36	A7-V31 PolarHBondContact N-O 2.77Å; A7-V31 WeakPolarHBondContact O-CG2 3.35Å; A7-V31 PolarHBondContact O-N 2.68Å; A9-V31 HydrophobicContact CB-CG2 3.52Å; F11-V31 HydrophobicContact CZ-CG1 3.99Å; T29-V31 HydrophobicContact CG2-CG1 4.35Å; T29-V31 PolarHBondContact O-N 2.81Å; V31-L33 PolarHBondContact O-N 3.48Å; V31-V36 HydrophobicContact CG2-CG2 3.99Å
32	P	56.9	Low	56.8	Low	61 Å²	61	92 Å²	92	40%	0.396	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.7	135.2	171.5	-17.5	29.4	0	0	0	110.8	V34 W35	P32-V34 PolarHBondContact O-N 2.86Å; P32-W35 PolarHBondContact O-N 2.82Å
33	L	57.6	Low	56.1	Low	49 Å²	49	95.3 Å²	95.3	26%	0.257	50%	0.5	S	S	.	.	H	α-helix	trans	-58.2	-19.8	-176.9	-127.8	132.4	0	0	0	114.5	K5 A7 V31 W35 V36 K37	K5-L33 HydrophobicContact CB-CB 4.46Å; K5-L33 HydrophobicContact CB-CD1 3.36Å; K5-L33 HydrophobicContact CD-CD1 4.43Å; K5-L33 WeakPolarHBondContact O-CB 3.49Å; K5-L33 PolarHBondContact O-N 3.25Å; K5-L33 VanDerWaalsContact O-N 3.09Å; A7-L33 HydrophobicContact CB-CD1 4.32Å; A7-L33 HydrophobicContact CB-CG 4.24Å; V31-L33 PolarHBondContact O-N 3.48Å; L33-W35 PolarHBondContact O-N 3.13Å; L33-V36 HydrophobicContact CG-CB 4.44Å; L33-V36 WeakPolarHBondContact O-CA 3.21Å; L33-V36 WeakPolarHBondContact O-CB 3.24Å; L33-V36 PolarHBondContact O-N 3.33Å; L33-K37 PolarHBondContact O-N 3.23Å; L33-K37 VanDerWaalsContact O-N 3.09Å
34	V	58.7	Low	55.5	Low	98 Å²	98	97.4 Å²	97.4	59%	0.594	51%	0.506	S	S	*	.	H	α-helix	trans	-59.7	-38.8	175.8	-156.8	0	0	0	0	111	L4 P32 V36	L4-V34 HydrophobicContact CD2-CG2 3.51Å; P32-V34 PolarHBondContact O-N 2.86Å; V34-V36 VanDerWaalsContact C-N 3.27Å; V34-V36 PolarHBondContact O-N 3.04Å
35	W	54.6	Low	55.4	Low	170 Å²	170	98.9 Å²	98.9	64%	0.644	52%	0.516	S	S	*	.	H	α-helix	trans	-71.3	-26.9	176.1	-76	50.5	0	0	0	111.7	P32 L33 A38 L39	P32-W35 PolarHBondContact O-N 2.82Å; L33-W35 PolarHBondContact O-N 3.13Å; W35-A38 PolarHBondContact O-N 3.14Å; W35-L39 PolarHBondContact O-N 3.46Å
36	V	53.8	Low	55.6	Low	16 Å²	16	93.1 Å²	93.1	10%	0.097	50%	0.495	C	S	.	.	H	α-helix	trans	-76.5	-34.2	-178.8	180	0	0	0	0	112.9	A7 V31 L33 V34 A38 L39 H40 V65	A7-V36 HydrophobicContact CB-CB 4.42Å; A7-V36 HydrophobicContact CB-CG2 3.51Å; V31-V36 HydrophobicContact CG2-CG2 3.99Å; L33-V36 HydrophobicContact CG-CB 4.44Å; L33-V36 WeakPolarHBondContact O-CA 3.21Å; L33-V36 WeakPolarHBondContact O-CB 3.24Å; L33-V36 PolarHBondContact O-N 3.33Å; V34-V36 VanDerWaalsContact C-N 3.27Å; V34-V36 PolarHBondContact O-N 3.04Å; V36-A38 PolarHBondContact O-N 2.78Å; V36-L39 WeakPolarHBondContact O-CA 3.29Å; V36-L39 WeakPolarHBondContact O-CB 3.41Å; V36-L39 PolarHBondContact O-N 3.13Å; V36-L39 VanDerWaalsContact O-N 3.07Å; V36-H40 PolarHBondContact O-N 3.49Å; V36-V65 HydrophobicContact CB-CG1 4.03Å; V36-V65 HydrophobicContact CG1-CB 3.86Å; V36-V65 HydrophobicContact CG1-CG1 3.33Å; V36-V65 HydrophobicContact CG1-CG2 4.29Å; V36-V65 HydrophobicContact CG2-CG1 3.53Å
37	K	50.3	Low	55.9	Low	167 Å²	167	92 Å²	92	73%	0.726	48%	0.483	S	S	*	.	H	α-helix	trans	-60.8	-36.3	173.4	-89.7	-171.9	172.4	-175	0	111.9	L33 A41	L33-K37 PolarHBondContact O-N 3.23Å; L33-K37 VanDerWaalsContact O-N 3.09Å; K37-A41 PolarHBondContact O-N 2.94Å
38	A	51.4	Low	56.3	Low	53 Å²	53	92.1 Å²	92.1	44%	0.438	48%	0.479	S	S	.	.	H	α-helix	trans	-64.9	-41.2	172.4	0	0	0	0	0	111.3	W35 V36 Y42	W35-A38 PolarHBondContact O-N 3.14Å; V36-A38 PolarHBondContact O-N 2.78Å; A38-Y42 WeakPolarHBondContact O-CD2 3.42Å
39	L	50.5	Low	56.6	Low	27 Å²	27	89.7 Å²	89.7	14%	0.141	47%	0.47	C	S	.	.	H	α-helix	trans	-63.6	-42.2	177.9	-87.9	149.8	0	0	0	114	W35 V36 F46 V62 V65	W35-L39 PolarHBondContact O-N 3.46Å; V36-L39 WeakPolarHBondContact O-CA 3.29Å; V36-L39 WeakPolarHBondContact O-CB 3.41Å; V36-L39 PolarHBondContact O-N 3.13Å; V36-L39 VanDerWaalsContact O-N 3.07Å; L39-F46 HydrophobicContact CD2-CB 3.6Å; L39-F46 HydrophobicContact CG-CB 4.47Å; L39-V62 HydrophobicContact CD1-CB 4.21Å; L39-V62 HydrophobicContact CD1-CG1 3.98Å; L39-V62 HydrophobicContact CD1-CG2 4.1Å; L39-V62 HydrophobicContact CD2-CB 3.5Å; L39-V62 HydrophobicContact CD2-CG1 3.6Å; L39-V62 HydrophobicContact CD2-CG2 4.16Å; L39-V62 HydrophobicContact CG-CG1 4.4Å; L39-V65 HydrophobicContact CB-CG2 4.32Å; L39-V65 HydrophobicContact CD1-CG2 4Å
40	H	51.8	Low	57.2	Low	153 Å²	153	90.2 Å²	90.2	71%	0.708	47%	0.473	S	S	*	.	H	α-helix	trans	-74.3	-30.4	-176.1	-137.5	5.1	0	0	0	112.7	V36 Y42	V36-H40 PolarHBondContact O-N 3.49Å; H40-Y42 VanDerWaalsContact C-N 3.26Å; H40-Y42 PolarHBondContact O-N 3.07Å
41	A	51	Low	57.9	Low	80 Å²	80	92.8 Å²	92.8	66%	0.661	48%	0.479	S	S	*	.	H	α-helix	trans	-64.7	-27.6	179.1	0	0	0	0	0	113.5	K37	K37-A41 PolarHBondContact O-N 2.94Å
42	Y	48.2	Very low	58.8	Low	164 Å²	164	102 Å²	102	64%	0.643	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.5	-7.4	-174.1	-80.8	-78.7	0	0	0	115.3	A38 H40 R44	A38-Y42 WeakPolarHBondContact O-CD2 3.42Å; H40-Y42 VanDerWaalsContact C-N 3.26Å; H40-Y42 PolarHBondContact O-N 3.07Å; Y42-R44 WeakPolarHBondContact O-CB 3.35Å; Y42-R44 PolarHBondContact O-N 3.38Å
43	N	48	Very low	59.8	Low	148 Å²	148	102.7 Å²	102.7	79%	0.791	51%	0.512	S	S	*	.			trans	43.5	30.2	175.7	-129.8	6.1	0	0	0	114.7
44	R	51.5	Low	61	Low	211 Å²	211	109 Å²	109	80%	0.796	55%	0.545	S	S	*	.	S	Bend	trans	-145.3	150.5	-178	-75.3	-169.1	-179.7	-172.9	1.4	108.6	Y42 F46	Y42-R44 WeakPolarHBondContact O-CB 3.35Å; Y42-R44 PolarHBondContact O-N 3.38Å; R44-F46 PolarHBondContact O-N 2.83Å
45	A	57.2	Low	61.9	Low	61 Å²	61	108.6 Å²	108.6	50%	0.504	54%	0.543	S	S	.	.			trans	-54.3	114	171.6	0	0	0	0	0	108.8	E47 F61 V62	A45-E47 PolarHBondContact O-N 3.23Å; A45-F61 HydrophobicContact CB-CB 4.04Å; A45-V62 WeakPolarHBondContact CA-O 3.01Å
46	F	62.2	Low	63.2	Low	95 Å²	95	101 Å²	101	42%	0.417	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84	116.5	-180	-162	-90.3	0	0	0	107.9	L39 R44 L48 F61 V62	L39-F46 HydrophobicContact CD2-CB 3.6Å; L39-F46 HydrophobicContact CG-CB 4.47Å; R44-F46 PolarHBondContact O-N 2.83Å; F46-L48 HydrophobicContact CD1-CD2 4.14Å; F46-L48 PolarHBondContact O-N 3Å; F46-F61 WeakPolarHBondContact O-CA 3.49Å; F46-V62 PolarHBondContact O-N 3.33Å
47	E	65.5	Low	64.5	Low	60 Å²	60	102.1 Å²	102.1	28%	0.28	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.2	114.6	172.6	-170.6	170.3	-167.5	0	0	108.5	A45 T50 R59 M60 F61	A45-E47 PolarHBondContact O-N 3.23Å; E47-T50 VanDerWaalsContact CD-OG1 3.28Å; E47-T50 PolarHBondContact OE1-OG1 2.88Å; E47-R59 VanDerWaalsContact CD-NE 3.28Å; E47-R59 VanDerWaalsContact OE1-CG 3.31Å; E47-R59 WeakPolarHBondContact OE1-CG 3.5Å; E47-R59 IonicContact OE1-CZ 3.78Å; E47-R59 IonicContact OE1-NE 3.29Å; E47-R59 PolarHBondContact OE1-NE 3.49Å; E47-R59 IonicContact OE1-NH2 2.83Å; E47-R59 IonicContact OE2-CZ 3.4Å; E47-R59 IonicContact OE2-NE 3.73Å; E47-R59 PolarHBondContact OE2-NE 3.35Å; E47-R59 IonicContact OE2-NH2 2.68Å; E47-R59 PolarHBondContact OE2-NH2 3.09Å; E47-M60 CarbonylContact C-O 3.45Å; E47-M60 WeakPolarHBondContact CA-O 3.35Å; E47-F61 HydrophobicContact CB-CD1 3.77Å; E47-F61 HydrophobicContact CB-CE1 3.89Å; E47-F61 HydrophobicContact CG-CD1 4.05Å; E47-F61 HydrophobicContact CG-CE1 3.87Å
48	L	66.3	Low	65.9	Low	61 Å²	61	95.7 Å²	95.7	32%	0.319	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.5	-35.9	-178.7	-74.8	169	0	0	0	112.2	F11 F46 M60 V62	F11-L48 HydrophobicContact CD1-CD1 3.43Å; F11-L48 VanDerWaalsContact CD1-CD1 3.43Å; F11-L48 HydrophobicContact CE1-CD1 3.3Å; F46-L48 HydrophobicContact CD1-CD2 4.14Å; F46-L48 PolarHBondContact O-N 3Å; L48-M60 HydrophobicContact CD1-CE 4.04Å; L48-M60 PolarHBondContact N-O 2.93Å; L48-V62 HydrophobicContact CD1-CG2 3.52Å; L48-V62 HydrophobicContact CG-CG2 4.31Å
49	A	67	Low	67	Low	51 Å²	51	97.3 Å²	97.3	42%	0.421	50%	0.495	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155	142.7	-175.8	0	0	0	0	0	109.7	M60	A49-M60 HydrophobicContact CB-CB 4.39Å; A49-M60 PolarHBondContact O-N 2.96Å
50	T	75.4	Confident	68.1	Low	83 Å²	83	98.7 Å²	98.7	51%	0.509	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	126.1	171.2	-41.7	0	0	0	0	107.4	E47 T57 V58 R59	E47-T50 VanDerWaalsContact CD-OG1 3.28Å; E47-T50 PolarHBondContact OE1-OG1 2.88Å; T50-T57 HydrophobicContact CG2-CG2 3.43Å; T50-T57 VanDerWaalsContact CG2-CG2 3.43Å; T50-V58 CarbonylContact C-O 3.51Å; T50-V58 WeakPolarHBondContact CA-O 3.39Å; T50-R59 HydrophobicContact CG2-CG 4.24Å
51	M	76.5	Confident	69.1	Low	119 Å²	119	92.4 Å²	92.4	59%	0.586	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119.2	127.1	174	-169.8	175.6	-165.8	0	0	108.7	L53 T57 V58	M51-L53 HydrophobicContact CE-CD2 4.15Å; M51-L53 HydrophobicContact CG-CD2 4.43Å; M51-L53 HydrophobicContact SD-CD2 4.23Å; M51-T57 CarbonylContact O-C 3.58Å; M51-V58 HydrophobicContact CB-CB 4.39Å; M51-V58 PolarHBondContact N-O 3.35Å; M51-V58 PolarHBondContact O-N 2.84Å
52	R	80.5	Confident	70.1	Confident	215 Å²	215	88.8 Å²	88.8	81%	0.811	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.3	125.5	170.2	-79.6	-177.1	169.4	143	-2.4	109	T57	R52-T57 HydrophobicContact CG-CG2 4.35Å
53	L	78.4	Confident	70.9	Confident	76 Å²	76	84.4 Å²	84.4	40%	0.398	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.9	161.8	172.1	-61.3	166.9	0	0	0	107.9	M51 T55 G56 V58	M51-L53 HydrophobicContact CE-CD2 4.15Å; M51-L53 HydrophobicContact CG-CD2 4.43Å; M51-L53 HydrophobicContact SD-CD2 4.23Å; L53-T55 PolarHBondContact O-N 3.02Å; L53-T55 VanDerWaalsContact O-N 3.17Å; L53-G56 CarbonylContact C-O 3.52Å; L53-G56 WeakPolarHBondContact CA-O 3.42Å; L53-G56 PolarHBondContact N-O 3.08Å; L53-G56 PolarHBondContact O-N 3.03Å; L53-G56 VanDerWaalsContact O-N 3.11Å; L53-V58 HydrophobicContact CD1-CG2 3.59Å
54	D	83.3	Confident	71.7	Confident	181 Å²	181	85.5 Å²	85.5	97%	0.968	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.4	-26.5	173.9	-59	-32.5	0	0	0	111.9
55	T	77.4	Confident	72.4	Confident	89 Å²	89	77.3 Å²	77.3	55%	0.546	40%	0.398	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.9	-1.7	-179.9	54.5	0	0	0	0	114.3	D17 L53	D17-T55 VanDerWaalsContact CB-O 3.24Å; D17-T55 WeakPolarHBondContact CB-O 3.48Å; L53-T55 PolarHBondContact O-N 3.02Å; L53-T55 VanDerWaalsContact O-N 3.17Å
56	G	81.4	Confident	72.8	Confident	12 Å²	12	78.9 Å²	78.9	12%	0.124	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	142.7	-173.1	-179	0	0	0	0	0	114	L53	L53-G56 CarbonylContact C-O 3.52Å; L53-G56 WeakPolarHBondContact CA-O 3.42Å; L53-G56 PolarHBondContact N-O 3.08Å; L53-G56 PolarHBondContact O-N 3.03Å; L53-G56 VanDerWaalsContact O-N 3.11Å
57	T	81.6	Confident	72.7	Confident	38 Å²	38	79.7 Å²	79.7	23%	0.233	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	123	177.1	-54.9	0	0	0	0	110	V16 T50 M51 R52 R59	V16-T57 PolarHBondContact N-O 3.09Å; V16-T57 PolarHBondContact O-N 3.38Å; T50-T57 HydrophobicContact CG2-CG2 3.43Å; T50-T57 VanDerWaalsContact CG2-CG2 3.43Å; M51-T57 CarbonylContact O-C 3.58Å; R52-T57 HydrophobicContact CG-CG2 4.35Å; T57-R59 HydrophobicContact CG2-CG 4.15Å
58	V	78.2	Confident	72.5	Confident	32 Å²	32	78.3 Å²	78.3	19%	0.194	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	127	170.7	178.9	0	0	0	0	108.8	L13 E14 L15 T50 M51 L53	L13-V58 HydrophobicContact CD2-CG1 3.74Å; E14-V58 CarbonylContact O-C 3.58Å; E14-V58 WeakPolarHBondContact O-CA 3.2Å; L15-V58 HydrophobicContact CD1-CG2 3.4Å; T50-V58 CarbonylContact C-O 3.51Å; T50-V58 WeakPolarHBondContact CA-O 3.39Å; M51-V58 HydrophobicContact CB-CB 4.39Å; M51-V58 PolarHBondContact N-O 3.35Å; M51-V58 PolarHBondContact O-N 2.84Å; L53-V58 HydrophobicContact CD1-CG2 3.59Å
59	R	76.2	Confident	72.1	Confident	88 Å²	88	82.1 Å²	82.1	33%	0.332	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	132.2	175	-56	176.4	72.6	-166.6	3.1	108.7	L13 E14 E47 T50 T57 F61	L13-R59 CarbonylContact C-O 3.59Å; L13-R59 WeakPolarHBondContact CA-O 3.47Å; E14-R59 PolarHBondContact N-O 3.32Å; E14-R59 PolarHBondContact O-N 2.79Å; E47-R59 VanDerWaalsContact CD-NE 3.28Å; E47-R59 VanDerWaalsContact OE1-CG 3.31Å; E47-R59 WeakPolarHBondContact OE1-CG 3.5Å; E47-R59 IonicContact OE1-CZ 3.78Å; E47-R59 IonicContact OE1-NE 3.29Å; E47-R59 PolarHBondContact OE1-NE 3.49Å; E47-R59 IonicContact OE1-NH2 2.83Å; E47-R59 IonicContact OE2-CZ 3.4Å; E47-R59 IonicContact OE2-NE 3.73Å; E47-R59 PolarHBondContact OE2-NE 3.35Å; E47-R59 IonicContact OE2-NH2 2.68Å; E47-R59 PolarHBondContact OE2-NH2 3.09Å; T50-R59 HydrophobicContact CG2-CG 4.24Å; T57-R59 HydrophobicContact CG2-CG 4.15Å; R59-F61 HydrophobicContact CB-CD2 4.45Å; R59-F61 HydrophobicContact CB-CE1 3.79Å; R59-F61 HydrophobicContact CB-CE2 3.53Å; R59-F61 HydrophobicContact CB-CZ 3.15Å; R59-F61 HydrophobicContact CG-CZ 4.03Å
60	M	73.2	Confident	71.4	Confident	56 Å²	56	81.9 Å²	81.9	28%	0.276	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	125.6	175.8	-178.2	175.1	164.5	0	0	108.8	F11 L13 E47 L48 A49	F11-M60 HydrophobicContact CB-CE 3.91Å; F11-M60 HydrophobicContact CD1-CE 3.17Å; F11-M60 HydrophobicContact CE1-CE 3.78Å; F11-M60 HydrophobicContact CG-CE 3.67Å; L13-M60 HydrophobicContact CD2-CB 3.86Å; L13-M60 HydrophobicContact CD2-CG 4.14Å; E47-M60 CarbonylContact C-O 3.45Å; E47-M60 WeakPolarHBondContact CA-O 3.35Å; L48-M60 HydrophobicContact CD1-CE 4.04Å; L48-M60 PolarHBondContact N-O 2.93Å; A49-M60 HydrophobicContact CB-CB 4.39Å; A49-M60 PolarHBondContact O-N 2.96Å
61	F	72.5	Confident	70.5	Confident	20 Å²	20	81.6 Å²	81.6	9%	0.088	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	150.6	179.2	-39.1	-88.7	0	0	0	111.5	F11 S12 E14 A45 F46 E47 R59	F11-F61 CarbonylContact C-O 3.57Å; F11-F61 WeakPolarHBondContact CA-O 3.45Å; S12-F61 PolarHBondContact N-O 3.11Å; S12-F61 PolarHBondContact O-N 2.83Å; E14-F61 HydrophobicContact CB-CD2 4.4Å; E14-F61 HydrophobicContact CB-CE2 3.53Å; E14-F61 HydrophobicContact CB-CZ 4.35Å; E14-F61 HydrophobicContact CG-CE2 4.45Å; E14-F61 WeakPolarHBondContact OE2-CE2 3.37Å; E14-F61 WeakPolarHBondContact OE2-CZ 3.15Å; A45-F61 HydrophobicContact CB-CB 4.04Å; F46-F61 WeakPolarHBondContact O-CA 3.49Å; E47-F61 HydrophobicContact CB-CD1 3.77Å; E47-F61 HydrophobicContact CB-CE1 3.89Å; E47-F61 HydrophobicContact CG-CD1 4.05Å; E47-F61 HydrophobicContact CG-CE1 3.87Å; R59-F61 HydrophobicContact CB-CD2 4.45Å; R59-F61 HydrophobicContact CB-CE1 3.79Å; R59-F61 HydrophobicContact CB-CE2 3.53Å; R59-F61 HydrophobicContact CB-CZ 3.15Å; R59-F61 HydrophobicContact CG-CZ 4.03Å
62	V	71.5	Confident	69.4	Low	5 Å²	5	79.2 Å²	79.2	3%	0.03	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	123.4	163.1	173.6	0	0	0	0	108.8	A9 V10 F11 L39 A45 F46 L48 V65	A9-V62 HydrophobicContact CB-CG1 4.24Å; A9-V62 HydrophobicContact CB-CG2 4.5Å; V10-V62 WeakPolarHBondContact O-CA 3.37Å; F11-V62 HydrophobicContact CD1-CG2 3.39Å; F11-V62 HydrophobicContact CE1-CG2 3.33Å; F11-V62 HydrophobicContact CG-CG2 4.25Å; F11-V62 HydrophobicContact CZ-CG2 4.05Å; L39-V62 HydrophobicContact CD1-CB 4.21Å; L39-V62 HydrophobicContact CD1-CG1 3.98Å; L39-V62 HydrophobicContact CD1-CG2 4.1Å; L39-V62 HydrophobicContact CD2-CB 3.5Å; L39-V62 HydrophobicContact CD2-CG1 3.6Å; L39-V62 HydrophobicContact CD2-CG2 4.16Å; L39-V62 HydrophobicContact CG-CG1 4.4Å; A45-V62 WeakPolarHBondContact CA-O 3.01Å; F46-V62 PolarHBondContact O-N 3.33Å; L48-V62 HydrophobicContact CD1-CG2 3.52Å; L48-V62 HydrophobicContact CG-CG2 4.31Å; V62-V65 HydrophobicContact CG1-CG2 3.5Å; V62-V65 VanDerWaalsContact CG1-CG2 3.5Å
63	T	66.2	Low	68.1	Low	72 Å²	72	78.8 Å²	78.8	44%	0.442	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	-32.3	-178.8	44.9	0	0	0	0	112.5	V10 S12	V10-T63 PolarHBondContact O-N 3.1Å; V10-T63 PolarHBondContact O-OG1 3.11Å; S12-T63 VanDerWaalsContact OG-CG2 3.29Å; S12-T63 WeakPolarHBondContact OG-CG2 3.43Å; S12-T63 PolarHBondContact OG-OG1 2.85Å; S12-T63 VanDerWaalsContact OG-OG1 3.13Å
64	R	64.6	Low	66.8	Low	170 Å²	170	77.9 Å²	77.9	64%	0.642	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-143.3	151.2	173.6	-80.3	-173.4	-172.3	178.8	3.1	111.5	A9 V10	A9-R64 WeakPolarHBondContact CA-O 3.42Å; V10-R64 HydrophobicContact CB-CB 4.17Å; V10-R64 HydrophobicContact CG2-CB 4.18Å; V10-R64 PolarHBondContact N-O 3.09Å
65	V	65.8	Low	65.4	Low	40 Å²	40	73 Å²	73	24%	0.242	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.8	129.1	167.8	-167.6	0	0	0	0	109.8	A7 V8 A9 V36 L39 V62	A7-V65 HydrophobicContact CB-CG1 3.82Å; V8-V65 CarbonylContact O-C 3.56Å; V8-V65 WeakPolarHBondContact O-CA 3.18Å; A9-V65 HydrophobicContact CB-CG1 4.39Å; A9-V65 HydrophobicContact CB-CG2 4.14Å; V36-V65 HydrophobicContact CB-CG1 4.03Å; V36-V65 HydrophobicContact CG1-CB 3.86Å; V36-V65 HydrophobicContact CG1-CG1 3.33Å; V36-V65 HydrophobicContact CG1-CG2 4.29Å; V36-V65 HydrophobicContact CG2-CG1 3.53Å; L39-V65 HydrophobicContact CB-CG2 4.32Å; L39-V65 HydrophobicContact CD1-CG2 4Å; V62-V65 HydrophobicContact CG1-CG2 3.5Å; V62-V65 VanDerWaalsContact CG1-CG2 3.5Å
66	H	65.4	Low	64.2	Low	94 Å²	94	75.5 Å²	75.5	44%	0.435	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	127.3	175	-65.3	-73.8	0	0	0	109.2	A7 V8 S68	A7-H66 CarbonylContact C-O 3.56Å; A7-H66 WeakPolarHBondContact CA-O 3.31Å; A7-H66 WeakPolarHBondContact CB-O 3.12Å; V8-H66 HydrophobicContact CB-CB 4.42Å; V8-H66 PolarHBondContact N-O 2.89Å; V8-H66 PolarHBondContact O-N 3.11Å; H66-S68 PolarHBondContact O-N 3.48Å
67	P	60.8	Low	63.4	Low	111 Å²	111	78.7 Å²	78.7	72%	0.721	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-61.4	124.3	172.1	24.6	-30.3	0	0	0	108.5
68	S	60.7	Low	62.4	Low	31 Å²	31	80.8 Å²	80.8	22%	0.217	45%	0.445	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	142.8	172.5	-178.6	0	0	0	0	108.6	K6 H66 A70	K6-S68 WeakPolarHBondContact O-CA 3.39Å; K6-S68 WeakPolarHBondContact O-CB 3.34Å; K6-S68 PolarHBondContact O-N 2.78Å; K6-S68 VanDerWaalsContact O-O 3.11Å; H66-S68 PolarHBondContact O-N 3.48Å; S68-A70 PolarHBondContact O-N 3.3Å; S68-A70 WeakPolarHBondContact OG-CB 3.11Å; S68-A70 PolarHBondContact OG-N 3.07Å; S68-A70 VanDerWaalsContact OG-N 3.13Å
69	T	57	Low	61.5	Low	142 Å²	142	83.5 Å²	83.5	87%	0.871	46%	0.459	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75.1	-9.8	169.6	48.7	0	0	0	0	112.1	V71	T69-V71 PolarHBondContact O-N 2.87Å
70	A	52.9	Low	60.7	Low	46 Å²	46	83.2 Å²	83.2	38%	0.38	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.7	123.7	178.8	0	0	0	0	0	111.4	K6 S68	K6-A70 HydrophobicContact CB-CB 4.39Å; K6-A70 WeakPolarHBondContact CB-O 3.24Å; K6-A70 PolarHBondContact N-O 3.17Å; S68-A70 PolarHBondContact O-N 3.3Å; S68-A70 WeakPolarHBondContact OG-CB 3.11Å; S68-A70 PolarHBondContact OG-N 3.07Å; S68-A70 VanDerWaalsContact OG-N 3.13Å
71	V	55.6	Low	59.9	Low	77 Å²	77	84.9 Å²	84.9	47%	0.467	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	124.9	171.5	-177.9	0	0	0	0	107.8	C3 T69	C3-V71 HydrophobicContact CB-CG1 3.95Å; T69-V71 PolarHBondContact O-N 2.87Å
72	T	55.1	Low	59	Low	68 Å²	68	89.3 Å²	89.3	42%	0.417	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.3	-36.8	-174.7	-33.7	0	0	0	0	112.6	L4 K6	L4-T72 PolarHBondContact O-N 2.82Å; L4-T72 VanDerWaalsContact O-N 3.11Å; L4-T72 PolarHBondContact O-OG1 3.21Å; K6-T72 HydrophobicContact CD-CG2 4.05Å; K6-T72 WeakPolarHBondContact CD-OG1 3.44Å; K6-T72 WeakPolarHBondContact CE-OG1 3.43Å; K6-T72 WeakPolarHBondContact CG-OG1 3.22Å
73	R	51.5	Low	58.2	Low	207 Å²	207	95.3 Å²	95.3	78%	0.781	54%	0.538	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-170.4	140	179	-114.9	174.3	-169.5	-179.6	2.4	108.6	L4	L4-R73 PolarHBondContact N-O 2.79Å; L4-R73 VanDerWaalsContact N-O 3.09Å
74	C	52.7	Low	57.5	Low	57 Å²	57	97.1 Å²	97.1	39%	0.385	55%	0.545	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	120	162.9	-60	0	0	0	0	106.3	M1 I2 C3	M1-C74 HydrophobicContact CG-CB 3.85Å; M1-C74 HydrophobicContact SD-CB 4.13Å; I2-C74 WeakPolarHBondContact O-CA 3.37Å; C3-C74 HydrophobicContact CB-CB 4.16Å; C3-C74 WeakPolarHBondContact CB-SG 3.5Å; C3-C74 WeakPolarHBondContact SG-CB 3.37Å; C3-C74 CovalentContact SG-SG 2.05Å; C3-C74 PolarHBondContact SG-SG 2.05Å
75	S	53.7	Low	56.9	Low	78 Å²	78	91 Å²	91	55%	0.545	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.2	130.1	167	78.9	0	0	0	0	107.1	M1 I2	M1-S75 CarbonylContact C-O 3.54Å; M1-S75 WeakPolarHBondContact CA-O 3.11Å; M1-S75 WeakPolarHBondContact CG-O 3.09Å; I2-S75 PolarHBondContact N-O 3.46Å; I2-S75 VanDerWaalsContact N-O 3.11Å; I2-S75 PolarHBondContact O-N 3.4Å; I2-S75 VanDerWaalsContact O-N 3.1Å
76	S	52.2	Low	56.1	Low	141 Å²	141	95.6 Å²	95.6	99%	0.986	56%	0.564	S	S	*	*			trans	-54.5	0	176.2	51.1	0	0	0	0	111	M1	M1-S76 WeakPolarHBondContact CA-OXT 3.33Å; M1-S76 PolarHBondContact N-OXT 3.13Å

Retrieved 76 of 76 residues in 23.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).