A0A5K4F6M9_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession A0A5K4F6M9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 85 aa.

						>A0A5K4F6M9_SCHMA|A0A5K4F6M9
MHQCLFLASVLLVSVIYVLGDELNVPTNNDDNSSMDTNIRWRNFWYNFYCAILGMALHLASRFAAMITPDGTYYNSITNTTEHIW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.2	Low	67.6	Low	181 Å²	181	109.8 Å²	109.8	89%	0.892	57%	0.57	S	S	*	*				0	-16	0	-64.3	-146	-148.2	0	0	115.5	R62	M1-R62 PolarHBondContact O-NH2 3.14Å
2	H	62.8	Low	67.9	Low	165 Å²	165	106 Å²	106	76%	0.764	55%	0.551	S	S	*	*			trans	-80.5	-32.2	-176.2	-76.2	90.2	0	0	0	115	C4 L5 F6	H2-C4 PolarHBondContact O-N 3.31Å; H2-L5 PolarHBondContact O-N 3.3Å; H2-F6 PolarHBondContact O-N 3.37Å
3	Q	63.9	Low	68.6	Low	174 Å²	174	105.2 Å²	105.2	81%	0.813	55%	0.553	S	S	*	*	H	α-helix	trans	-64.3	-35.8	-174.7	-69.4	178.4	-33.9	0	0	113.6	L5 F6 L7	Q3-L5 VanDerWaalsContact C-N 3.34Å; Q3-L5 PolarHBondContact O-N 3.36Å; Q3-F6 PolarHBondContact O-N 2.68Å; Q3-L7 PolarHBondContact O-N 2.87Å; Q3-L7 VanDerWaalsContact O-N 3.12Å
4	C	61.6	Low	69	Low	70 Å²	70	101.5 Å²	101.5	47%	0.473	54%	0.54	S	S	.	.	H	α-helix	trans	-69.1	-32.6	178.7	-50.7	0	0	0	0	112.6	H2 A8	H2-C4 PolarHBondContact O-N 3.31Å; C4-A8 WeakPolarHBondContact O-CB 3.42Å; C4-A8 PolarHBondContact O-N 3.04Å; C4-A8 VanDerWaalsContact O-N 3.09Å
5	L	65.2	Low	69.2	Low	110 Å²	110	99.1 Å²	99.1	58%	0.576	53%	0.531	S	S	*	.	H	α-helix	trans	-66.3	-43.1	178.3	-167.2	87.5	0	0	0	110.4	H2 Q3 A8 S9	H2-L5 PolarHBondContact O-N 3.3Å; Q3-L5 VanDerWaalsContact C-N 3.34Å; Q3-L5 PolarHBondContact O-N 3.36Å; L5-A8 PolarHBondContact O-N 3.18Å; L5-S9 PolarHBondContact O-N 2.96Å; L5-S9 PolarHBondContact O-OG 3.4Å
6	F	71.6	Confident	69.5	Low	144 Å²	144	98.8 Å²	98.8	63%	0.632	53%	0.527	S	S	*	.	H	α-helix	trans	-66	-44.7	179.2	-174.6	-98.4	0	0	0	112	H2 Q3 A8 S9 V10	H2-F6 PolarHBondContact O-N 3.37Å; Q3-F6 PolarHBondContact O-N 2.68Å; F6-A8 VanDerWaalsContact C-N 3.33Å; F6-A8 PolarHBondContact O-N 2.95Å; F6-S9 WeakPolarHBondContact CA-OG 3.33Å; F6-S9 PolarHBondContact O-N 2.96Å; F6-S9 PolarHBondContact O-OG 3.04Å; F6-V10 HydrophobicContact CD1-CG2 4.12Å; F6-V10 HydrophobicContact CE1-CG2 3.75Å; F6-V10 HydrophobicContact CE2-CG2 4.34Å; F6-V10 HydrophobicContact CZ-CG2 3.88Å; F6-V10 VanDerWaalsContact O-CG2 3.29Å; F6-V10 WeakPolarHBondContact O-CG2 3.05Å; F6-V10 PolarHBondContact O-N 3.43Å
7	L	73.2	Confident	69.5	Low	116 Å²	116	103.8 Å²	103.8	61%	0.607	54%	0.539	S	S	*	.	H	α-helix	trans	-62.4	-42.4	178.3	-159.8	81.3	0	0	0	111.4	Q3 V10 L11	Q3-L7 PolarHBondContact O-N 2.87Å; Q3-L7 VanDerWaalsContact O-N 3.12Å; L7-V10 PolarHBondContact O-N 3.47Å; L7-L11 HydrophobicContact CG-CD1 4.32Å; L7-L11 WeakPolarHBondContact O-CB 3.48Å; L7-L11 VanDerWaalsContact O-CG 3.29Å; L7-L11 WeakPolarHBondContact O-CG 3.39Å; L7-L11 PolarHBondContact O-N 3.12Å
8	A	67.4	Low	69.4	Low	21 Å²	21	102.9 Å²	102.9	17%	0.174	54%	0.539	C	S	.	.	H	α-helix	trans	-63.4	-43.2	176.4	0	0	0	0	0	112.1	C4 L5 F6 L11 L12 M55	C4-A8 WeakPolarHBondContact O-CB 3.42Å; C4-A8 PolarHBondContact O-N 3.04Å; C4-A8 VanDerWaalsContact O-N 3.09Å; L5-A8 PolarHBondContact O-N 3.18Å; F6-A8 VanDerWaalsContact C-N 3.33Å; F6-A8 PolarHBondContact O-N 2.95Å; A8-L11 PolarHBondContact O-N 3.1Å; A8-L12 PolarHBondContact O-N 3.03Å; A8-M55 HydrophobicContact CB-CE 4.21Å; A8-M55 HydrophobicContact CB-SD 4.38Å; A8-M55 VanDerWaalsContact O-CE 3.27Å; A8-M55 WeakPolarHBondContact O-CE 3.49Å
9	S	73.9	Confident	69.1	Low	55 Å²	55	98.8 Å²	98.8	39%	0.385	52%	0.517	S	S	.	.	H	α-helix	trans	-65.7	-39.3	177.5	58	0	0	0	0	112.8	L5 F6 L12 V13	L5-S9 PolarHBondContact O-N 2.96Å; L5-S9 PolarHBondContact O-OG 3.4Å; F6-S9 WeakPolarHBondContact CA-OG 3.33Å; F6-S9 PolarHBondContact O-N 2.96Å; F6-S9 PolarHBondContact O-OG 3.04Å; S9-L12 WeakPolarHBondContact O-CB 3.44Å; S9-L12 PolarHBondContact O-N 3.28Å; S9-V13 WeakPolarHBondContact O-CG2 3.37Å; S9-V13 PolarHBondContact O-N 3.11Å
10	V	75.4	Confident	68.9	Low	72 Å²	72	95.7 Å²	95.7	44%	0.436	51%	0.51	S	S	.	.	H	α-helix	trans	-65.5	-42.8	177	172	0	0	0	0	110.5	F6 L7 L12 V13 S14	F6-V10 HydrophobicContact CD1-CG2 4.12Å; F6-V10 HydrophobicContact CE1-CG2 3.75Å; F6-V10 HydrophobicContact CE2-CG2 4.34Å; F6-V10 HydrophobicContact CZ-CG2 3.88Å; F6-V10 VanDerWaalsContact O-CG2 3.29Å; F6-V10 WeakPolarHBondContact O-CG2 3.05Å; F6-V10 PolarHBondContact O-N 3.43Å; L7-V10 PolarHBondContact O-N 3.47Å; V10-L12 VanDerWaalsContact C-N 3.35Å; V10-L12 PolarHBondContact O-N 3.03Å; V10-V13 PolarHBondContact O-N 3.43Å; V10-S14 PolarHBondContact O-N 3.45Å
11	L	73.8	Confident	68.8	Low	100 Å²	100	96.5 Å²	96.5	52%	0.524	52%	0.515	S	S	.	.	H	α-helix	trans	-61.6	-43.1	175.1	-74.5	167.7	0	0	0	111.5	L7 A8 V13 S14 V15	L7-L11 HydrophobicContact CG-CD1 4.32Å; L7-L11 WeakPolarHBondContact O-CB 3.48Å; L7-L11 VanDerWaalsContact O-CG 3.29Å; L7-L11 WeakPolarHBondContact O-CG 3.39Å; L7-L11 PolarHBondContact O-N 3.12Å; A8-L11 PolarHBondContact O-N 3.1Å; L11-V13 PolarHBondContact O-N 2.86Å; L11-S14 WeakPolarHBondContact CA-OG 3.18Å; L11-S14 PolarHBondContact O-N 3.47Å; L11-S14 PolarHBondContact O-OG 2.96Å; L11-V15 WeakPolarHBondContact O-CG2 3.46Å; L11-V15 PolarHBondContact O-N 3.44Å
12	L	71.1	Confident	69	Low	64 Å²	64	93.8 Å²	93.8	34%	0.335	50%	0.5	S	S	.	.	H	α-helix	trans	-57.1	-49.2	175.7	-169.8	83.2	0	0	0	111.8	A8 S9 V10 S14 V15 I16 M55	A8-L12 PolarHBondContact O-N 3.03Å; S9-L12 WeakPolarHBondContact O-CB 3.44Å; S9-L12 PolarHBondContact O-N 3.28Å; V10-L12 VanDerWaalsContact C-N 3.35Å; V10-L12 PolarHBondContact O-N 3.03Å; L12-S14 VanDerWaalsContact C-N 3.29Å; L12-S14 PolarHBondContact O-N 2.81Å; L12-V15 PolarHBondContact O-N 2.84Å; L12-I16 HydrophobicContact CD2-CD1 4.15Å; L12-I16 HydrophobicContact CG-CD1 3.89Å; L12-I16 VanDerWaalsContact O-CG1 3.32Å; L12-I16 WeakPolarHBondContact O-CG1 3.29Å; L12-I16 PolarHBondContact O-N 3.3Å; L12-M55 HydrophobicContact CB-CE 3.62Å; L12-M55 HydrophobicContact CD1-CE 3.57Å; L12-M55 HydrophobicContact CD1-CG 4.15Å; L12-M55 HydrophobicContact CG-CE 4.11Å
13	V	76.1	Confident	68.8	Low	96 Å²	96	89.7 Å²	89.7	58%	0.582	48%	0.483	S	S	*	.	H	α-helix	trans	-61.7	-41.3	180	173.4	0	0	0	0	110.5	S9 V10 L11 V15 I16 Y17	S9-V13 WeakPolarHBondContact O-CG2 3.37Å; S9-V13 PolarHBondContact O-N 3.11Å; V10-V13 PolarHBondContact O-N 3.43Å; L11-V13 PolarHBondContact O-N 2.86Å; V13-V15 PolarHBondContact O-N 3.27Å; V13-I16 PolarHBondContact O-N 2.9Å; V13-Y17 VanDerWaalsContact O-CB 3.31Å; V13-Y17 WeakPolarHBondContact O-CB 3.42Å; V13-Y17 PolarHBondContact O-N 3.39Å
14	S	74.2	Confident	68.7	Low	53 Å²	53	87.6 Å²	87.6	37%	0.371	48%	0.477	S	S	.	.	H	α-helix	trans	-63.7	-40.3	177.5	72.4	0	0	0	0	112.7	V10 L11 L12 Y17 V18	V10-S14 PolarHBondContact O-N 3.45Å; L11-S14 WeakPolarHBondContact CA-OG 3.18Å; L11-S14 PolarHBondContact O-N 3.47Å; L11-S14 PolarHBondContact O-OG 2.96Å; L12-S14 VanDerWaalsContact C-N 3.29Å; L12-S14 PolarHBondContact O-N 2.81Å; S14-Y17 PolarHBondContact O-N 3.23Å; S14-V18 WeakPolarHBondContact O-CG2 3.38Å; S14-V18 PolarHBondContact O-N 3.47Å
15	V	72.7	Confident	68.4	Low	66 Å²	66	87.8 Å²	87.8	40%	0.4	48%	0.476	S	S	.	.	H	α-helix	trans	-66.4	-45	177.7	171	0	0	0	0	110.4	L11 L12 V13 Y17 L19	L11-V15 WeakPolarHBondContact O-CG2 3.46Å; L11-V15 PolarHBondContact O-N 3.44Å; L12-V15 PolarHBondContact O-N 2.84Å; V13-V15 PolarHBondContact O-N 3.27Å; V15-Y17 VanDerWaalsContact C-N 3.32Å; V15-Y17 PolarHBondContact O-N 3.36Å; V15-L19 HydrophobicContact CG1-CD1 3.57Å; V15-L19 HydrophobicContact CG1-CG 4.43Å; V15-L19 VanDerWaalsContact O-CB 3.31Å; V15-L19 WeakPolarHBondContact O-CB 3.36Å; V15-L19 WeakPolarHBondContact O-CD1 3.29Å; V15-L19 WeakPolarHBondContact O-CG 3.46Å; V15-L19 PolarHBondContact O-N 3.01Å
16	I	73.2	Confident	67.8	Low	93 Å²	93	87.5 Å²	87.5	48%	0.477	48%	0.481	S	S	.	.	H	α-helix	trans	-63.2	-40.2	176.9	-65.5	167.3	0	0	0	110.9	L12 V13 L19 G20	L12-I16 HydrophobicContact CD2-CD1 4.15Å; L12-I16 HydrophobicContact CG-CD1 3.89Å; L12-I16 VanDerWaalsContact O-CG1 3.32Å; L12-I16 WeakPolarHBondContact O-CG1 3.29Å; L12-I16 PolarHBondContact O-N 3.3Å; V13-I16 PolarHBondContact O-N 2.9Å; I16-L19 PolarHBondContact O-N 3.4Å; I16-G20 PolarHBondContact O-N 3.49Å
17	Y	70	Confident	66.9	Low	184 Å²	184	86.6 Å²	86.6	72%	0.722	49%	0.487	S	S	*	.	H	α-helix	trans	-65	-47.9	-179.7	-171.4	-94.9	0	0	0	111.9	V13 S14 V15 L19 G20 D21	V13-Y17 VanDerWaalsContact O-CB 3.31Å; V13-Y17 WeakPolarHBondContact O-CB 3.42Å; V13-Y17 PolarHBondContact O-N 3.39Å; S14-Y17 PolarHBondContact O-N 3.23Å; V15-Y17 VanDerWaalsContact C-N 3.32Å; V15-Y17 PolarHBondContact O-N 3.36Å; Y17-L19 VanDerWaalsContact C-N 3.34Å; Y17-L19 PolarHBondContact O-N 2.93Å; Y17-G20 PolarHBondContact O-N 2.69Å; Y17-D21 PolarHBondContact O-N 3.48Å
18	V	68.6	Low	65.9	Low	88 Å²	88	87 Å²	87	53%	0.533	49%	0.491	S	S	.	.	H	α-helix	trans	-63	-41.9	176.9	174.1	0	0	0	0	111	S14 G20 D21 E22	S14-V18 WeakPolarHBondContact O-CG2 3.38Å; S14-V18 PolarHBondContact O-N 3.47Å; V18-G20 VanDerWaalsContact C-N 3.34Å; V18-G20 PolarHBondContact O-N 3.09Å; V18-D21 PolarHBondContact O-N 2.97Å; V18-E22 PolarHBondContact O-N 3.42Å
19	L	63.1	Low	65.2	Low	25 Å²	25	92.9 Å²	92.9	13%	0.131	52%	0.519	C	S	.	.	H	α-helix	trans	-67.6	-33.2	176.5	-72.7	165.1	0	0	0	112.9	V15 I16 Y17 E22 L23 F44 N47	V15-L19 HydrophobicContact CG1-CD1 3.57Å; V15-L19 HydrophobicContact CG1-CG 4.43Å; V15-L19 VanDerWaalsContact O-CB 3.31Å; V15-L19 WeakPolarHBondContact O-CB 3.36Å; V15-L19 WeakPolarHBondContact O-CD1 3.29Å; V15-L19 WeakPolarHBondContact O-CG 3.46Å; V15-L19 PolarHBondContact O-N 3.01Å; I16-L19 PolarHBondContact O-N 3.4Å; Y17-L19 VanDerWaalsContact C-N 3.34Å; Y17-L19 PolarHBondContact O-N 2.93Å; L19-E22 PolarHBondContact O-N 2.86Å; L19-L23 PolarHBondContact O-N 3.3Å; L19-L23 VanDerWaalsContact O-N 3.11Å; L19-F44 HydrophobicContact CB-CD2 4.49Å; L19-F44 HydrophobicContact CB-CE2 4.29Å; L19-N47 HydrophobicContact CD2-CB 4.18Å
20	G	65.2	Low	64.3	Low	37 Å²	37	95.7 Å²	95.7	38%	0.381	53%	0.529	S	S	.	.	H	α-helix	trans	-68	-35.9	176.2	0	0	0	0	0	112.4	I16 Y17 V18 L23 N24	I16-G20 PolarHBondContact O-N 3.49Å; Y17-G20 PolarHBondContact O-N 2.69Å; V18-G20 VanDerWaalsContact C-N 3.34Å; V18-G20 PolarHBondContact O-N 3.09Å; G20-L23 PolarHBondContact O-N 3.36Å; G20-N24 PolarHBondContact O-N 2.89Å
21	D	66.4	Low	63.5	Low	113 Å²	113	99.4 Å²	99.4	60%	0.604	55%	0.547	S	S	*	.	H	α-helix	trans	-67.6	-42	173.9	-164.4	60	0	0	0	111.4	Y17 V18 L23 N24	Y17-D21 PolarHBondContact O-N 3.48Å; V18-D21 PolarHBondContact O-N 2.97Å; D21-L23 PolarHBondContact O-N 2.83Å; D21-N24 PolarHBondContact O-N 3.34Å
22	E	60.5	Low	62.7	Low	124 Å²	124	101.6 Å²	101.6	58%	0.579	56%	0.559	S	S	*	*	H	α-helix	trans	-64.8	-24.8	173.7	-72.5	-162.1	166.1	0	0	113.6	V18 L19 R40	V18-E22 PolarHBondContact O-N 3.42Å; L19-E22 PolarHBondContact O-N 2.86Å; E22-R40 PolarHBondContact O-NH2 3.3Å
23	L	58.2	Low	62	Low	79 Å²	79	100.3 Å²	100.3	41%	0.414	56%	0.555	S	S	.	*	H	α-helix	trans	-79.3	-19.9	173.8	-89.4	163.3	0	0	0	113.3	L19 G20 D21 V25 W41 F44	L19-L23 PolarHBondContact O-N 3.3Å; L19-L23 VanDerWaalsContact O-N 3.11Å; G20-L23 PolarHBondContact O-N 3.36Å; D21-L23 PolarHBondContact O-N 2.83Å; L23-V25 PolarHBondContact O-N 2.86Å; L23-V25 VanDerWaalsContact O-N 3.1Å; L23-W41 HydrophobicContact CD2-CE3 4.25Å; L23-W41 HydrophobicContact CD2-CZ3 4.22Å; L23-F44 HydrophobicContact CD1-CD1 4.35Å; L23-F44 HydrophobicContact CD1-CD2 3.36Å; L23-F44 HydrophobicContact CD1-CE1 4.21Å; L23-F44 HydrophobicContact CD1-CE2 3.19Å; L23-F44 HydrophobicContact CD1-CG 3.96Å; L23-F44 HydrophobicContact CD1-CZ 3.64Å; L23-F44 HydrophobicContact CD2-CG 4.45Å; L23-F44 HydrophobicContact CG-CD2 4Å; L23-F44 HydrophobicContact CG-CE2 4.28Å; L23-F44 HydrophobicContact CG-CG 4.41Å
24	N	61	Low	61.1	Low	129 Å²	129	99 Å²	99	69%	0.69	55%	0.551	S	S	*	*			trans	-82.6	24.2	-176.9	-161.6	28.6	0	0	0	113.7	G20 D21	G20-N24 PolarHBondContact O-N 2.89Å; D21-N24 PolarHBondContact O-N 3.34Å
25	V	55	Low	60.3	Low	75 Å²	75	102.9 Å²	102.9	46%	0.455	57%	0.565	S	S	.	*			trans	-75.4	124.1	175	174.4	0	0	0	0	109.1	L23 T27 R40	L23-V25 PolarHBondContact O-N 2.86Å; L23-V25 VanDerWaalsContact O-N 3.1Å; V25-T27 PolarHBondContact O-N 3.27Å; V25-R40 VanDerWaalsContact CB-NH2 3.34Å
26	P	52.9	Low	59.8	Low	104 Å²	104	104.6 Å²	104.6	68%	0.675	57%	0.571	S	S	*	*			trans	-57.5	130.8	-176.7	21.1	-31.7	0	0	0	110.7	N28	P26-N28 PolarHBondContact O-N 2.98Å
27	T	52.6	Low	59.4	Low	124 Å²	124	103.4 Å²	103.4	76%	0.761	57%	0.569	S	S	*	*			trans	-63.5	79.2	168.4	45.8	0	0	0	0	109.2	V25 N29	V25-T27 PolarHBondContact O-N 3.27Å; T27-N29 PolarHBondContact O-N 2.69Å
28	N	52.5	Low	59.3	Low	126 Å²	126	99.5 Å²	99.5	67%	0.674	56%	0.56	S	S	*	*			trans	-75.3	111.8	160.1	-108.6	-2.3	0	0	0	106.9	P26 D30	P26-N28 PolarHBondContact O-N 2.98Å; N28-D30 PolarHBondContact O-N 3.23Å
29	N	52	Low	59.5	Low	143 Å²	143	98 Å²	98	77%	0.765	55%	0.549	S	S	*	.			trans	-65.2	63.4	177.1	-88.3	-10	0	0	0	111.8	T27	T27-N29 PolarHBondContact O-N 2.69Å
30	D	56.5	Low	59.8	Low	114 Å²	114	102 Å²	102	61%	0.61	56%	0.562	S	S	*	*			trans	-89.3	121.4	159.1	-69.6	-29.4	0	0	0	106.3	N28 N32 S33	N28-D30 PolarHBondContact O-N 3.23Å; D30-N32 PolarHBondContact O-N 3.41Å; D30-S33 WeakPolarHBondContact O-CA 3.17Å; D30-S33 WeakPolarHBondContact O-CB 3.31Å; D30-S33 PolarHBondContact O-N 3.33Å; D30-S33 PolarHBondContact O-OG 3.48Å
31	D	57.8	Low	60.1	Low	151 Å²	151	106.3 Å²	106.3	81%	0.807	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.5	-10.6	-173	-71.2	-41.8	0	0	0	114.2	S34	D31-S34 PolarHBondContact O-OG 2.91Å
32	N	57.1	Low	60.6	Low	145 Å²	145	108 Å²	108	78%	0.775	57%	0.565	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.4	-16.3	167.6	-81.5	-4	0	0	0	114.1	D30 S34	D30-N32 PolarHBondContact O-N 3.41Å; N32-S34 VanDerWaalsContact C-N 3.25Å; N32-S34 PolarHBondContact O-N 3.34Å
33	S	55.6	Low	61.2	Low	37 Å²	37	106 Å²	106	26%	0.259	56%	0.558	S	S	.	*	H	α-helix	trans	-71.7	-14.8	-179.5	71.1	0	0	0	0	113.5	D30 M35 D36 T37	D30-S33 WeakPolarHBondContact O-CA 3.17Å; D30-S33 WeakPolarHBondContact O-CB 3.31Å; D30-S33 PolarHBondContact O-N 3.33Å; D30-S33 PolarHBondContact O-OG 3.48Å; S33-M35 VanDerWaalsContact C-N 3.25Å; S33-M35 PolarHBondContact O-N 3.39Å; S33-D36 PolarHBondContact O-N 3.04Å; S33-T37 VanDerWaalsContact O-CB 3.3Å; S33-T37 WeakPolarHBondContact O-CB 3.46Å; S33-T37 WeakPolarHBondContact O-CG2 3.45Å; S33-T37 PolarHBondContact O-N 2.96Å; S33-T37 PolarHBondContact O-OG1 3.24Å
34	S	57.3	Low	61.9	Low	69 Å²	69	104.3 Å²	104.3	48%	0.483	55%	0.547	S	S	.	.	H	α-helix	trans	-63.9	-31.4	179.7	62.9	0	0	0	0	112.3	D31 N32 T37 N38	D31-S34 PolarHBondContact O-OG 2.91Å; N32-S34 VanDerWaalsContact C-N 3.25Å; N32-S34 PolarHBondContact O-N 3.34Å; S34-T37 VanDerWaalsContact CA-OG1 3.28Å; S34-T37 WeakPolarHBondContact CA-OG1 3.27Å; S34-T37 PolarHBondContact O-OG1 3.28Å; S34-N38 PolarHBondContact O-N 2.94Å; S34-N38 PolarHBondContact O-ND2 3.49Å
35	M	57.3	Low	62.6	Low	135 Å²	135	102.5 Å²	102.5	67%	0.665	53%	0.531	S	S	*	.	H	α-helix	trans	-77.3	-41.9	176.2	-169.7	158.5	157.1	0	0	111.5	S33 N38 I39	S33-M35 VanDerWaalsContact C-N 3.25Å; S33-M35 PolarHBondContact O-N 3.39Å; M35-N38 PolarHBondContact O-N 3.46Å; M35-I39 HydrophobicContact CG-CD1 4.44Å; M35-I39 WeakPolarHBondContact O-CG1 3.32Å; M35-I39 PolarHBondContact O-N 3.2Å; M35-I39 VanDerWaalsContact O-N 3.14Å
36	D	62.9	Low	63.5	Low	101 Å²	101	106.2 Å²	106.2	54%	0.54	54%	0.538	S	S	.	.	H	α-helix	trans	-69.4	-37.4	178.5	-70.7	-31.2	0	0	0	112.5	S33 I39 R40	S33-D36 PolarHBondContact O-N 3.04Å; D36-I39 PolarHBondContact O-N 2.99Å; D36-R40 WeakPolarHBondContact O-CB 3.43Å; D36-R40 VanDerWaalsContact O-CG 3.25Å; D36-R40 WeakPolarHBondContact O-CG 3.45Å; D36-R40 PolarHBondContact O-N 3.45Å
37	T	64.6	Low	64.5	Low	68 Å²	68	104.8 Å²	104.8	42%	0.417	53%	0.525	S	S	.	.	H	α-helix	trans	-64.2	-40.9	175	48.6	0	0	0	0	111.6	S33 S34 R40 W41	S33-T37 VanDerWaalsContact O-CB 3.3Å; S33-T37 WeakPolarHBondContact O-CB 3.46Å; S33-T37 WeakPolarHBondContact O-CG2 3.45Å; S33-T37 PolarHBondContact O-N 2.96Å; S33-T37 PolarHBondContact O-OG1 3.24Å; S34-T37 VanDerWaalsContact CA-OG1 3.28Å; S34-T37 WeakPolarHBondContact CA-OG1 3.27Å; S34-T37 PolarHBondContact O-OG1 3.28Å; T37-R40 PolarHBondContact O-N 3.37Å; T37-W41 VanDerWaalsContact O-CB 3.24Å; T37-W41 WeakPolarHBondContact O-CB 3.34Å; T37-W41 PolarHBondContact O-N 2.88Å
38	N	68.2	Low	65.6	Low	102 Å²	102	102.5 Å²	102.5	55%	0.545	50%	0.504	S	S	.	.	H	α-helix	trans	-64.6	-39.1	174.6	-84.9	-53.9	0	0	0	112.8	S34 M35 R42	S34-N38 PolarHBondContact O-N 2.94Å; S34-N38 PolarHBondContact O-ND2 3.49Å; M35-N38 PolarHBondContact O-N 3.46Å; N38-R42 WeakPolarHBondContact O-CB 3.36Å; N38-R42 PolarHBondContact O-N 3.43Å
39	I	73.3	Confident	66.6	Low	57 Å²	57	103.4 Å²	103.4	29%	0.292	50%	0.499	S	S	.	.	H	α-helix	trans	-65.6	-45.4	176.4	-67.1	166.4	0	0	0	110.4	M35 D36 R42 N43	M35-I39 HydrophobicContact CG-CD1 4.44Å; M35-I39 WeakPolarHBondContact O-CG1 3.32Å; M35-I39 PolarHBondContact O-N 3.2Å; M35-I39 VanDerWaalsContact O-N 3.14Å; D36-I39 PolarHBondContact O-N 2.99Å; I39-R42 PolarHBondContact O-N 2.86Å; I39-N43 WeakPolarHBondContact O-CB 3.34Å; I39-N43 PolarHBondContact O-N 2.89Å
40	R	69.8	Low	67.8	Low	109 Å²	109	99.4 Å²	99.4	41%	0.411	48%	0.481	S	S	.	.	H	α-helix	trans	-64.2	-42.3	178	-69.7	176.2	69.4	-171	-0.2	112	E22 V25 D36 T37 N43 F44	E22-R40 PolarHBondContact O-NH2 3.3Å; V25-R40 VanDerWaalsContact CB-NH2 3.34Å; D36-R40 WeakPolarHBondContact O-CB 3.43Å; D36-R40 VanDerWaalsContact O-CG 3.25Å; D36-R40 WeakPolarHBondContact O-CG 3.45Å; D36-R40 PolarHBondContact O-N 3.45Å; T37-R40 PolarHBondContact O-N 3.37Å; R40-N43 PolarHBondContact O-N 2.89Å; R40-F44 WeakPolarHBondContact O-CB 3.5Å; R40-F44 PolarHBondContact O-N 3.32Å
41	W	71.6	Confident	68.5	Low	127 Å²	127	95.4 Å²	95.4	48%	0.481	47%	0.465	S	S	.	.	H	α-helix	trans	-62	-44	174.8	-175.2	-115.2	0	0	0	112.2	L23 T37 N43 F44 W45	L23-W41 HydrophobicContact CD2-CE3 4.25Å; L23-W41 HydrophobicContact CD2-CZ3 4.22Å; T37-W41 VanDerWaalsContact O-CB 3.24Å; T37-W41 WeakPolarHBondContact O-CB 3.34Å; T37-W41 PolarHBondContact O-N 2.88Å; W41-N43 PolarHBondContact O-N 3.46Å; W41-F44 HydrophobicContact CE3-CD1 4.23Å; W41-F44 HydrophobicContact CZ3-CD1 4.09Å; W41-F44 HydrophobicContact CZ3-CE1 4.39Å; W41-F44 WeakPolarHBondContact O-CB 3.31Å; W41-F44 PolarHBondContact O-N 3.4Å; W41-W45 AromaticContact CD1-CD1 3.82Å; W41-W45 AromaticContact CD1-NE1 3.89Å; W41-W45 AromaticContact CD2-CD1 3.9Å; W41-W45 AromaticContact CD2-NE1 3.61Å; W41-W45 AromaticContact CE2-CD1 3.6Å; W41-W45 AromaticContact CE2-NE1 2.93Å; W41-W45 HydrophobicContact CH2-CZ2 4.2Å; W41-W45 AromaticContact CH2-NE1 3.69Å; W41-W45 AromaticContact CZ2-CE2 3.72Å; W41-W45 AromaticContact CZ2-CZ2 3.86Å; W41-W45 HydrophobicContact CZ2-CZ2 3.86Å; W41-W45 AromaticContact CZ2-NE1 3Å; W41-W45 AromaticContact NE1-CD1 3.51Å; W41-W45 AromaticContact NE1-NE1 3.12Å; W41-W45 VanDerWaalsContact NE1-NE1 3.12Å; W41-W45 VanDerWaalsContact O-CD1 3.22Å; W41-W45 PolarHBondContact O-N 3.48Å
42	R	76.5	Confident	69.5	Low	150 Å²	150	92.3 Å²	92.3	57%	0.566	45%	0.447	S	S	*	.	H	α-helix	trans	-62.5	-43.1	175.1	-175.3	177.8	63.6	-123.9	-0.7	111.7	N38 I39 F44 W45 Y46	N38-R42 WeakPolarHBondContact O-CB 3.36Å; N38-R42 PolarHBondContact O-N 3.43Å; I39-R42 PolarHBondContact O-N 2.86Å; R42-F44 VanDerWaalsContact C-N 3.3Å; R42-F44 PolarHBondContact O-N 3.48Å; R42-W45 PolarHBondContact O-N 3.46Å; R42-Y46 WeakPolarHBondContact O-CB 3.47Å; R42-Y46 PolarHBondContact O-N 3.41Å
43	N	73.3	Confident	70.4	Confident	80 Å²	80	91.3 Å²	91.3	43%	0.428	44%	0.441	S	S	.	.	H	α-helix	trans	-63.1	-38.5	176	-75.5	-9.3	0	0	0	111.5	I39 R40 W41 Y46 N47	I39-N43 WeakPolarHBondContact O-CB 3.34Å; I39-N43 PolarHBondContact O-N 2.89Å; R40-N43 PolarHBondContact O-N 2.89Å; W41-N43 PolarHBondContact O-N 3.46Å; N43-Y46 PolarHBondContact O-N 3.38Å; N43-N47 WeakPolarHBondContact O-CB 3.33Å; N43-N47 PolarHBondContact O-N 2.99Å; N43-N47 PolarHBondContact O-ND2 3.49Å
44	F	72.3	Confident	71.5	Confident	44 Å²	44	91.5 Å²	91.5	19%	0.193	45%	0.449	C	S	.	.	H	α-helix	trans	-58.7	-52.3	173.8	172.6	-100.2	0	0	0	111.6	L19 L23 R40 W41 R42 Y46 N47 F48	L19-F44 HydrophobicContact CB-CD2 4.49Å; L19-F44 HydrophobicContact CB-CE2 4.29Å; L23-F44 HydrophobicContact CD1-CD1 4.35Å; L23-F44 HydrophobicContact CD1-CD2 3.36Å; L23-F44 HydrophobicContact CD1-CE1 4.21Å; L23-F44 HydrophobicContact CD1-CE2 3.19Å; L23-F44 HydrophobicContact CD1-CG 3.96Å; L23-F44 HydrophobicContact CD1-CZ 3.64Å; L23-F44 HydrophobicContact CD2-CG 4.45Å; L23-F44 HydrophobicContact CG-CD2 4Å; L23-F44 HydrophobicContact CG-CE2 4.28Å; L23-F44 HydrophobicContact CG-CG 4.41Å; R40-F44 WeakPolarHBondContact O-CB 3.5Å; R40-F44 PolarHBondContact O-N 3.32Å; W41-F44 HydrophobicContact CE3-CD1 4.23Å; W41-F44 HydrophobicContact CZ3-CD1 4.09Å; W41-F44 HydrophobicContact CZ3-CE1 4.39Å; W41-F44 WeakPolarHBondContact O-CB 3.31Å; W41-F44 PolarHBondContact O-N 3.4Å; R42-F44 VanDerWaalsContact C-N 3.3Å; R42-F44 PolarHBondContact O-N 3.48Å; F44-Y46 VanDerWaalsContact C-N 3.33Å; F44-Y46 PolarHBondContact O-N 3.43Å; F44-N47 PolarHBondContact O-N 3.17Å; F44-F48 WeakPolarHBondContact O-CB 3.31Å; F44-F48 PolarHBondContact O-N 3.03Å
45	W	76.1	Confident	72	Confident	91 Å²	91	90.9 Å²	90.9	35%	0.345	44%	0.439	S	S	.	.	H	α-helix	trans	-62.2	-40.3	177.3	-77.5	104.1	0	0	0	112.4	W41 R42 F48 Y49	W41-W45 AromaticContact CD1-CD1 3.82Å; W41-W45 AromaticContact CD1-NE1 3.89Å; W41-W45 AromaticContact CD2-CD1 3.9Å; W41-W45 AromaticContact CD2-NE1 3.61Å; W41-W45 AromaticContact CE2-CD1 3.6Å; W41-W45 AromaticContact CE2-NE1 2.93Å; W41-W45 HydrophobicContact CH2-CZ2 4.2Å; W41-W45 AromaticContact CH2-NE1 3.69Å; W41-W45 AromaticContact CZ2-CE2 3.72Å; W41-W45 AromaticContact CZ2-CZ2 3.86Å; W41-W45 HydrophobicContact CZ2-CZ2 3.86Å; W41-W45 AromaticContact CZ2-NE1 3Å; W41-W45 AromaticContact NE1-CD1 3.51Å; W41-W45 AromaticContact NE1-NE1 3.12Å; W41-W45 VanDerWaalsContact NE1-NE1 3.12Å; W41-W45 VanDerWaalsContact O-CD1 3.22Å; W41-W45 PolarHBondContact O-N 3.48Å; R42-W45 PolarHBondContact O-N 3.46Å; W45-F48 AromaticContact CE3-CD1 3.98Å; W45-F48 HydrophobicContact CE3-CD1 3.98Å; W45-F48 AromaticContact CZ3-CD1 3.97Å; W45-F48 HydrophobicContact CZ3-CD1 3.97Å; W45-F48 HydrophobicContact CZ3-CE1 4.08Å; W45-F48 PolarHBondContact O-N 2.96Å; W45-Y49 HydrophobicContact CB-CD2 4.31Å; W45-Y49 HydrophobicContact CB-CE2 4.15Å; W45-Y49 HydrophobicContact CE3-CE2 4.02Å; W45-Y49 WeakPolarHBondContact O-CB 3.19Å; W45-Y49 WeakPolarHBondContact O-CD2 3.32Å; W45-Y49 PolarHBondContact O-N 3.44Å
46	Y	73.6	Confident	72.9	Confident	154 Å²	154	86.9 Å²	86.9	60%	0.604	43%	0.427	S	S	*	.	H	α-helix	trans	-59.3	-49.4	176.9	-174.1	-94	0	0	0	111.6	R42 N43 F44 F48 Y49 C50	R42-Y46 WeakPolarHBondContact O-CB 3.47Å; R42-Y46 PolarHBondContact O-N 3.41Å; N43-Y46 PolarHBondContact O-N 3.38Å; F44-Y46 VanDerWaalsContact C-N 3.33Å; F44-Y46 PolarHBondContact O-N 3.43Å; Y46-F48 VanDerWaalsContact C-N 3.34Å; Y46-F48 PolarHBondContact O-N 3.5Å; Y46-Y49 PolarHBondContact O-N 2.9Å; Y46-C50 PolarHBondContact O-N 3.36Å; Y46-C50 PolarHBondContact O-SG 3.36Å; Y46-C50 VanDerWaalsContact O-SG 3.41Å
47	N	73.1	Confident	73.6	Confident	74 Å²	74	88 Å²	88	40%	0.396	43%	0.433	S	S	.	.	H	α-helix	trans	-62.7	-40.6	176.9	-74.6	-31.5	0	0	0	112	L19 N43 F44 C50 A51	L19-N47 HydrophobicContact CD2-CB 4.18Å; N43-N47 WeakPolarHBondContact O-CB 3.33Å; N43-N47 PolarHBondContact O-N 2.99Å; N43-N47 PolarHBondContact O-ND2 3.49Å; F44-N47 PolarHBondContact O-N 3.17Å; N47-C50 PolarHBondContact O-N 3.37Å; N47-A51 WeakPolarHBondContact O-CB 3.48Å; N47-A51 PolarHBondContact O-N 3.28Å
48	F	75.6	Confident	74.1	Confident	76 Å²	76	88.4 Å²	88.4	33%	0.333	43%	0.43	S	S	.	.	H	α-helix	trans	-61.4	-46.8	175.8	-178.2	-104.6	0	0	0	112.1	F44 W45 Y46 C50 A51 I52	F44-F48 WeakPolarHBondContact O-CB 3.31Å; F44-F48 PolarHBondContact O-N 3.03Å; W45-F48 AromaticContact CE3-CD1 3.98Å; W45-F48 HydrophobicContact CE3-CD1 3.98Å; W45-F48 AromaticContact CZ3-CD1 3.97Å; W45-F48 HydrophobicContact CZ3-CD1 3.97Å; W45-F48 HydrophobicContact CZ3-CE1 4.08Å; W45-F48 PolarHBondContact O-N 2.96Å; Y46-F48 VanDerWaalsContact C-N 3.34Å; Y46-F48 PolarHBondContact O-N 3.5Å; F48-C50 PolarHBondContact O-N 3.01Å; F48-A51 PolarHBondContact O-N 3.33Å; F48-I52 HydrophobicContact CD1-CD1 3.75Å; F48-I52 HydrophobicContact CE1-CD1 3.23Å; F48-I52 HydrophobicContact CE1-CG1 4.39Å; F48-I52 HydrophobicContact CE2-CD1 4.15Å; F48-I52 HydrophobicContact CG-CD1 4.41Å; F48-I52 HydrophobicContact CZ-CD1 3.47Å; F48-I52 VanDerWaalsContact CZ-CD1 3.47Å; F48-I52 HydrophobicContact CZ-CG1 4.4Å; F48-I52 WeakPolarHBondContact O-CG1 3.34Å; F48-I52 PolarHBondContact O-N 3.3Å
49	Y	74.8	Confident	74.4	Confident	145 Å²	145	88 Å²	88	57%	0.569	43%	0.427	S	S	*	.	H	α-helix	trans	-62.6	-42.3	175.7	-76.8	-59.6	0	0	0	112.1	W45 Y46 A51 I52 L53	W45-Y49 HydrophobicContact CB-CD2 4.31Å; W45-Y49 HydrophobicContact CB-CE2 4.15Å; W45-Y49 HydrophobicContact CE3-CE2 4.02Å; W45-Y49 WeakPolarHBondContact O-CB 3.19Å; W45-Y49 WeakPolarHBondContact O-CD2 3.32Å; W45-Y49 PolarHBondContact O-N 3.44Å; Y46-Y49 PolarHBondContact O-N 2.9Å; Y49-A51 VanDerWaalsContact C-N 3.34Å; Y49-A51 PolarHBondContact O-N 2.93Å; Y49-I52 PolarHBondContact O-N 2.93Å; Y49-L53 WeakPolarHBondContact O-CB 3.44Å; Y49-L53 PolarHBondContact O-N 2.85Å
50	C	76	Confident	74.5	Confident	58 Å²	58	87.7 Å²	87.7	39%	0.392	43%	0.433	S	S	.	.	H	α-helix	trans	-60.8	-41.6	175.3	-75.5	0	0	0	0	112.1	Y46 N47 F48 L53 G54	Y46-C50 PolarHBondContact O-N 3.36Å; Y46-C50 PolarHBondContact O-SG 3.36Å; Y46-C50 VanDerWaalsContact O-SG 3.41Å; N47-C50 PolarHBondContact O-N 3.37Å; F48-C50 PolarHBondContact O-N 3.01Å; C50-L53 PolarHBondContact O-N 3.06Å; C50-G54 PolarHBondContact O-N 3.46Å
51	A	72.5	Confident	74.6	Confident	31 Å²	31	85.4 Å²	85.4	26%	0.256	43%	0.434	S	S	.	.	H	α-helix	trans	-64.1	-45	177	0	0	0	0	0	111.9	N47 F48 Y49 G54 M55	N47-A51 WeakPolarHBondContact O-CB 3.48Å; N47-A51 PolarHBondContact O-N 3.28Å; F48-A51 PolarHBondContact O-N 3.33Å; Y49-A51 VanDerWaalsContact C-N 3.34Å; Y49-A51 PolarHBondContact O-N 2.93Å; A51-G54 PolarHBondContact O-N 3.07Å; A51-M55 WeakPolarHBondContact O-CG 3.48Å; A51-M55 PolarHBondContact O-N 2.8Å
52	I	77.2	Confident	74.4	Confident	85 Å²	85	83 Å²	83	44%	0.436	42%	0.424	S	S	.	.	H	α-helix	trans	-62.2	-45.7	175.8	-69.2	174.6	0	0	0	111	F48 Y49 G54 M55 A56	F48-I52 HydrophobicContact CD1-CD1 3.75Å; F48-I52 HydrophobicContact CE1-CD1 3.23Å; F48-I52 HydrophobicContact CE1-CG1 4.39Å; F48-I52 HydrophobicContact CE2-CD1 4.15Å; F48-I52 HydrophobicContact CG-CD1 4.41Å; F48-I52 HydrophobicContact CZ-CD1 3.47Å; F48-I52 VanDerWaalsContact CZ-CD1 3.47Å; F48-I52 HydrophobicContact CZ-CG1 4.4Å; F48-I52 WeakPolarHBondContact O-CG1 3.34Å; F48-I52 PolarHBondContact O-N 3.3Å; Y49-I52 PolarHBondContact O-N 2.93Å; I52-G54 VanDerWaalsContact C-N 3.32Å; I52-G54 PolarHBondContact O-N 3.25Å; I52-M55 WeakPolarHBondContact O-CB 3.35Å; I52-M55 PolarHBondContact O-N 3.11Å; I52-A56 WeakPolarHBondContact O-CB 3.45Å; I52-A56 PolarHBondContact O-N 3.32Å
53	L	77.5	Confident	74	Confident	125 Å²	125	81.9 Å²	81.9	65%	0.654	42%	0.424	S	S	*	.	H	α-helix	trans	-62.8	-40.9	179.2	-170.7	70.6	0	0	0	111.2	Y49 C50 M55 A56 L57	Y49-L53 WeakPolarHBondContact O-CB 3.44Å; Y49-L53 PolarHBondContact O-N 2.85Å; C50-L53 PolarHBondContact O-N 3.06Å; L53-M55 VanDerWaalsContact C-N 3.34Å; L53-M55 PolarHBondContact O-N 2.71Å; L53-A56 PolarHBondContact O-N 3.27Å; L53-L57 WeakPolarHBondContact O-CB 3.48Å; L53-L57 PolarHBondContact O-N 2.86Å
54	G	77.1	Confident	73.5	Confident	40 Å²	40	80.7 Å²	80.7	41%	0.412	43%	0.425	S	S	.	.	H	α-helix	trans	-60.7	-41.7	173.9	0	0	0	0	0	112.5	C50 A51 I52 L57 H58	C50-G54 PolarHBondContact O-N 3.46Å; A51-G54 PolarHBondContact O-N 3.07Å; I52-G54 VanDerWaalsContact C-N 3.32Å; I52-G54 PolarHBondContact O-N 3.25Å; G54-L57 PolarHBondContact O-N 3.31Å; G54-H58 WeakPolarHBondContact O-CB 3.25Å; G54-H58 PolarHBondContact O-N 3.24Å
55	M	69.4	Low	73	Confident	57 Å²	57	82 Å²	82	28%	0.281	44%	0.444	S	S	.	.	H	α-helix	trans	-65.7	-43.4	174.3	-73.8	-58.7	-165.4	0	0	112.7	A8 L12 A51 I52 L53 L57 H58 L59	A8-M55 HydrophobicContact CB-CE 4.21Å; A8-M55 HydrophobicContact CB-SD 4.38Å; A8-M55 VanDerWaalsContact O-CE 3.27Å; A8-M55 WeakPolarHBondContact O-CE 3.49Å; L12-M55 HydrophobicContact CB-CE 3.62Å; L12-M55 HydrophobicContact CD1-CE 3.57Å; L12-M55 HydrophobicContact CD1-CG 4.15Å; L12-M55 HydrophobicContact CG-CE 4.11Å; A51-M55 WeakPolarHBondContact O-CG 3.48Å; A51-M55 PolarHBondContact O-N 2.8Å; I52-M55 WeakPolarHBondContact O-CB 3.35Å; I52-M55 PolarHBondContact O-N 3.11Å; L53-M55 VanDerWaalsContact C-N 3.34Å; L53-M55 PolarHBondContact O-N 2.71Å; M55-L57 VanDerWaalsContact C-N 3.35Å; M55-H58 PolarHBondContact O-N 3.3Å; M55-L59 WeakPolarHBondContact O-CG 3.48Å; M55-L59 PolarHBondContact O-N 3.48Å
56	A	75.3	Confident	72.3	Confident	51 Å²	51	84.7 Å²	84.7	42%	0.421	46%	0.462	S	S	.	.	H	α-helix	trans	-61.9	-43.6	176.6	0	0	0	0	0	111.3	I52 L53 L59 A60	I52-A56 WeakPolarHBondContact O-CB 3.45Å; I52-A56 PolarHBondContact O-N 3.32Å; L53-A56 PolarHBondContact O-N 3.27Å; A56-L59 PolarHBondContact O-N 3.25Å; A56-A60 VanDerWaalsContact O-CB 3.31Å; A56-A60 WeakPolarHBondContact O-CB 3.38Å; A56-A60 PolarHBondContact O-N 3.49Å
57	L	78.7	Confident	71.6	Confident	125 Å²	125	83.4 Å²	83.4	65%	0.654	47%	0.465	S	S	*	.	H	α-helix	trans	-66.3	-39.1	176.4	-171	67.7	0	0	0	111.7	L53 G54 M55 A60 S61	L53-L57 WeakPolarHBondContact O-CB 3.48Å; L53-L57 PolarHBondContact O-N 2.86Å; G54-L57 PolarHBondContact O-N 3.31Å; M55-L57 VanDerWaalsContact C-N 3.35Å; L57-A60 PolarHBondContact O-N 2.91Å; L57-S61 WeakPolarHBondContact O-CB 3.38Å; L57-S61 PolarHBondContact O-N 2.9Å
58	H	74.5	Confident	70.8	Confident	76 Å²	76	84.2 Å²	84.2	35%	0.352	47%	0.472	S	S	.	.	H	α-helix	trans	-61.6	-48	174.9	-173.8	75.4	0	0	0	111.2	G54 M55 A60 S61 R62	G54-H58 WeakPolarHBondContact O-CB 3.25Å; G54-H58 PolarHBondContact O-N 3.24Å; M55-H58 PolarHBondContact O-N 3.3Å; H58-A60 PolarHBondContact O-N 3.36Å; H58-S61 PolarHBondContact O-N 3.02Å; H58-S61 PolarHBondContact O-OG 3.41Å; H58-R62 WeakPolarHBondContact O-CG 3.34Å; H58-R62 PolarHBondContact O-N 3.1Å
59	L	74.1	Confident	69.7	Low	93 Å²	93	85.8 Å²	85.8	49%	0.487	49%	0.49	S	S	.	.	H	α-helix	trans	-58.4	-48.2	174	-75.3	162.1	0	0	0	111.2	M55 A56 S61 R62 F63	M55-L59 WeakPolarHBondContact O-CG 3.48Å; M55-L59 PolarHBondContact O-N 3.48Å; A56-L59 PolarHBondContact O-N 3.25Å; L59-S61 VanDerWaalsContact C-N 3.31Å; L59-S61 PolarHBondContact O-N 3.36Å; L59-R62 PolarHBondContact O-N 2.85Å; L59-R62 VanDerWaalsContact O-N 3.11Å; L59-F63 WeakPolarHBondContact O-CD2 3.48Å; L59-F63 PolarHBondContact O-N 2.96Å
60	A	75.2	Confident	68.7	Low	50 Å²	50	84.7 Å²	84.7	41%	0.413	49%	0.494	S	S	.	.	H	α-helix	trans	-58.3	-41.4	178.2	0	0	0	0	0	112.2	A56 L57 H58 R62 F63 A64	A56-A60 VanDerWaalsContact O-CB 3.31Å; A56-A60 WeakPolarHBondContact O-CB 3.38Å; A56-A60 PolarHBondContact O-N 3.49Å; L57-A60 PolarHBondContact O-N 2.91Å; H58-A60 PolarHBondContact O-N 3.36Å; A60-R62 VanDerWaalsContact C-N 3.3Å; A60-R62 PolarHBondContact O-N 3.4Å; A60-F63 PolarHBondContact O-N 2.93Å; A60-A64 WeakPolarHBondContact O-CB 3.24Å; A60-A64 PolarHBondContact O-N 3.33Å
61	S	72.4	Confident	67.5	Low	62 Å²	62	85.1 Å²	85.1	43%	0.434	51%	0.508	S	S	.	.	H	α-helix	trans	-63.6	-35.3	177.1	75	0	0	0	0	112.6	L57 H58 L59 A64 A65	L57-S61 WeakPolarHBondContact O-CB 3.38Å; L57-S61 PolarHBondContact O-N 2.9Å; H58-S61 PolarHBondContact O-N 3.02Å; H58-S61 PolarHBondContact O-OG 3.41Å; L59-S61 VanDerWaalsContact C-N 3.31Å; L59-S61 PolarHBondContact O-N 3.36Å; S61-A64 PolarHBondContact O-N 2.81Å; S61-A65 WeakPolarHBondContact O-CB 3.35Å; S61-A65 PolarHBondContact O-N 3.3Å
62	R	67.7	Low	66.7	Low	76 Å²	76	88.1 Å²	88.1	29%	0.287	52%	0.523	S	S	.	.	H	α-helix	trans	-71.3	-39.1	176.2	-67	-170.6	68.9	173.8	0	111.9	M1 H58 L59 A60 M66	M1-R62 PolarHBondContact O-NH2 3.14Å; H58-R62 WeakPolarHBondContact O-CG 3.34Å; H58-R62 PolarHBondContact O-N 3.1Å; L59-R62 PolarHBondContact O-N 2.85Å; L59-R62 VanDerWaalsContact O-N 3.11Å; A60-R62 VanDerWaalsContact C-N 3.3Å; A60-R62 PolarHBondContact O-N 3.4Å; R62-M66 WeakPolarHBondContact O-CB 2.98Å; R62-M66 PolarHBondContact O-N 3.14Å
63	F	67.5	Low	65.4	Low	127 Å²	127	93.1 Å²	93.1	56%	0.557	54%	0.538	S	S	*	.	H	α-helix	trans	-65.9	-43	172.1	-76.5	-71.4	0	0	0	111.4	L59 A60 A65 M66 I67	L59-F63 WeakPolarHBondContact O-CD2 3.48Å; L59-F63 PolarHBondContact O-N 2.96Å; A60-F63 PolarHBondContact O-N 2.93Å; F63-A65 VanDerWaalsContact C-N 3.35Å; F63-A65 PolarHBondContact O-N 3.32Å; F63-M66 CarbonylContact O-C 3.58Å; F63-M66 WeakPolarHBondContact O-CB 3.19Å; F63-M66 PolarHBondContact O-N 3.42Å; F63-M66 VanDerWaalsContact O-N 3.1Å; F63-I67 HydrophobicContact CB-CD1 4.47Å; F63-I67 WeakPolarHBondContact O-CB 3.07Å; F63-I67 WeakPolarHBondContact O-CD1 3.3Å; F63-I67 WeakPolarHBondContact O-CG1 3.28Å; F63-I67 PolarHBondContact O-N 2.81Å
64	A	63.4	Low	63.9	Low	54 Å²	54	97.3 Å²	97.3	45%	0.446	55%	0.547	S	S	.	.	H	α-helix	trans	-61.7	-41.8	176.3	0	0	0	0	0	112.2	A60 S61 M66 I67 T68	A60-A64 WeakPolarHBondContact O-CB 3.24Å; A60-A64 PolarHBondContact O-N 3.33Å; S61-A64 PolarHBondContact O-N 2.81Å; A64-M66 VanDerWaalsContact C-N 3.29Å; A64-M66 PolarHBondContact O-N 3.35Å; A64-I67 PolarHBondContact O-N 3.33Å; A64-T68 PolarHBondContact O-N 2.81Å; A64-T68 PolarHBondContact O-OG1 2.63Å
65	A	61	Low	62.7	Low	72 Å²	72	101 Å²	101	60%	0.595	56%	0.557	S	S	*	*	H	α-helix	trans	-63.8	-34.1	173.7	0	0	0	0	0	112.4	S61 F63	S61-A65 WeakPolarHBondContact O-CB 3.35Å; S61-A65 PolarHBondContact O-N 3.3Å; F63-A65 VanDerWaalsContact C-N 3.35Å; F63-A65 PolarHBondContact O-N 3.32Å
66	M	61.1	Low	61.8	Low	148 Å²	148	101.9 Å²	101.9	73%	0.729	57%	0.569	S	S	*	*	H	α-helix	trans	-75.6	-29	176	-173.7	170.4	-176.8	0	0	113.1	R62 F63 A64	R62-M66 WeakPolarHBondContact O-CB 2.98Å; R62-M66 PolarHBondContact O-N 3.14Å; F63-M66 CarbonylContact O-C 3.58Å; F63-M66 WeakPolarHBondContact O-CB 3.19Å; F63-M66 PolarHBondContact O-N 3.42Å; F63-M66 VanDerWaalsContact O-N 3.1Å; A64-M66 VanDerWaalsContact C-N 3.29Å; A64-M66 PolarHBondContact O-N 3.35Å
67	I	59.8	Low	60.7	Low	127 Å²	127	105.4 Å²	105.4	65%	0.651	58%	0.579	S	S	*	*	H	α-helix	trans	-84.8	-16.9	-179.8	-65.3	161.4	0	0	0	111.6	F63 A64 P69	F63-I67 HydrophobicContact CB-CD1 4.47Å; F63-I67 WeakPolarHBondContact O-CB 3.07Å; F63-I67 WeakPolarHBondContact O-CD1 3.3Å; F63-I67 WeakPolarHBondContact O-CG1 3.28Å; F63-I67 PolarHBondContact O-N 2.81Å; A64-I67 PolarHBondContact O-N 3.33Å; I67-P69 WeakPolarHBondContact O-CD 3.45Å
68	T	56	Low	59.5	Low	90 Å²	90	103.1 Å²	103.1	55%	0.552	57%	0.571	S	S	*	*	S	Bend	trans	-61.9	108.4	172.9	-53.1	0	0	0	0	107.3	A64 D70	A64-T68 PolarHBondContact O-N 2.81Å; A64-T68 PolarHBondContact O-OG1 2.63Å; T68-D70 PolarHBondContact O-N 2.71Å
69	P	53.5	Low	58.4	Low	109 Å²	109	105 Å²	105	71%	0.708	58%	0.583	S	S	*	*			trans	-71.5	105.7	176.8	28.4	-23.7	0	0	0	104.7	I67 G71	I67-P69 WeakPolarHBondContact O-CD 3.45Å; P69-G71 PolarHBondContact O-N 3.03Å
70	D	52.7	Low	57.6	Low	123 Å²	123	105.2 Å²	105.2	66%	0.658	59%	0.588	S	S	*	*			trans	-46	118	158.2	-75.7	-35.7	0	0	0	105.4	T68 T72	T68-D70 PolarHBondContact O-N 2.71Å; D70-T72 HydrophobicContact CB-CG2 4.47Å; D70-T72 PolarHBondContact O-N 3.33Å; D70-T72 PolarHBondContact O-OG1 2.82Å
71	G	51.4	Low	56.7	Low	67 Å²	67	107.4 Å²	107.4	69%	0.691	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.4	23	-176	0	0	0	0	0	113.9	P69	P69-G71 PolarHBondContact O-N 3.03Å
72	T	55.8	Low	55.9	Low	93 Å²	93	111.7 Å²	111.7	57%	0.571	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86	-24.2	178.6	54.2	0	0	0	0	112.5	D70 Y74 N75	D70-T72 HydrophobicContact CB-CG2 4.47Å; D70-T72 PolarHBondContact O-N 3.33Å; D70-T72 PolarHBondContact O-OG1 2.82Å; T72-Y74 VanDerWaalsContact C-N 3.29Å; T72-Y74 PolarHBondContact O-N 3.34Å; T72-N75 PolarHBondContact O-N 2.73Å
73	Y	48.9	Very low	55	Low	191 Å²	191	116.6 Å²	116.6	75%	0.749	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.9	-18.5	178.9	-87	-84.3	0	0	0	114.4
74	Y	45.9	Very low	54.6	Low	212 Å²	212	117.1 Å²	117.1	83%	0.831	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.6	-6.3	175.1	-98.9	-82.6	0	0	0	114.1	T72 T78	T72-Y74 VanDerWaalsContact C-N 3.29Å; T72-Y74 PolarHBondContact O-N 3.34Å; Y74-T78 PolarHBondContact O-OG1 3.35Å
75	N	51.9	Low	54.7	Low	119 Å²	119	129.5 Å²	129.5	64%	0.636	68%	0.679	S	S	*	*	S	Bend	trans	-105	-1.2	-174.9	-139.1	-3.3	0	0	0	114	T72	T72-N75 PolarHBondContact O-N 2.73Å
76	S	49.9	Very low	54.4	Low	75 Å²	75	132.4 Å²	132.4	52%	0.524	68%	0.683	S	S	.	*	S	Bend	trans	-105.4	-9.4	176.1	70.3	0	0	0	0	114.4
77	I	53.6	Low	54	Low	125 Å²	125	131.6 Å²	131.6	64%	0.641	68%	0.68	S	S	*	*	S	Bend	trans	-100.7	-27.6	178.4	-62.3	172.7	0	0	0	111.3	T80	I77-T80 PolarHBondContact O-OG1 3.38Å
78	T	54	Low	53.7	Low	77 Å²	77	131.8 Å²	131.8	47%	0.472	68%	0.682	S	S	.	*	G	3₁₀ helix	trans	-78	-21.7	173.3	25.6	0	0	0	0	113.7	Y74 T81	Y74-T78 PolarHBondContact O-OG1 3.35Å; T78-T81 PolarHBondContact O-OG1 2.93Å; T78-T81 VanDerWaalsContact O-OG1 3.14Å
79	N	51.4	Low	53.5	Low	116 Å²	116	134.3 Å²	134.3	62%	0.62	69%	0.69	S	S	*	*	G	3₁₀ helix	trans	-90	6.5	-178.6	-152.2	-2.3	0	0	0	114.2
80	T	57	Low	53.5	Low	96 Å²	96	135.9 Å²	135.9	59%	0.589	69%	0.688	S	S	*	*	G	3₁₀ helix	trans	-108.2	-7.6	173.3	51.3	0	0	0	0	113.5	I77	I77-T80 PolarHBondContact O-OG1 3.38Å
81	T	56	Low	53.6	Low	97 Å²	97	136.7 Å²	136.7	60%	0.595	69%	0.69	S	S	*	*	S	Bend	trans	-92.8	-5.2	178.9	31.5	0	0	0	0	114.1	T78	T78-T81 PolarHBondContact O-OG1 2.93Å; T78-T81 VanDerWaalsContact O-OG1 3.14Å
82	E	55.9	Low	53.8	Low	151 Å²	151	141.7 Å²	141.7	71%	0.706	69%	0.69	S	S	*	*	S	Bend	trans	-93.2	6.8	178.7	-58.5	-168.7	179.1	0	0	113.8
83	H	48.2	Very low	53.6	Low	180 Å²	180	145.5 Å²	145.5	83%	0.833	70%	0.7	S	S	*	*	S	Bend	trans	-122.6	31.3	-177.3	-130	-82.3	0	0	0	113.7
84	I	59	Low	54	Low	138 Å²	138	141.7 Å²	141.7	71%	0.708	70%	0.696	S	S	*	*			trans	-128.9	75.5	173.2	-47.4	174.5	0	0	0	108.7
85	W	65.2	Low	54.7	Low	314 Å²	314	135.3 Å²	135.3	100%	1.189	68%	0.683	S	S	*	*			trans	-137.3	0	157.9	-57	89.2	0	0	0	107.5

Retrieved 85 of 85 residues in 42.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).