A0A5K4F6Q2_SCHMA Loading...

Glyco_hydro_92 domain-containing protein

AlphaFold DB , UniProt , Accession A0A5K4F6Q2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 51 aa.

						>A0A5K4F6Q2_SCHMA|A0A5K4F6Q2
MPLSVHYPNGHSIHMNPNNLTTEMKGNTLSIYLQTDLRNEPVLVEMEIVRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.4	Very low	70.1	Confident	195 Å²	195	95.3 Å²	95.3	96%	0.961	52%	0.523	S	S	*	.				0	127	0	-65.9	170.3	91.8	0	0	107	L3	M1-L3 PolarHBondContact O-N 2.57Å
2	P	48.1	Very low	71.5	Confident	72 Å²	72	90.6 Å²	90.6	47%	0.468	50%	0.502	S	S	.	.			trans	-62.3	122.3	169.3	-9.1	22.8	0	0	0	107.6	S4 N27	P2-S4 PolarHBondContact O-N 3.34Å; P2-S4 VanDerWaalsContact O-N 3.11Å; P2-N27 VanDerWaalsContact CB-ND2 3.31Å; P2-N27 WeakPolarHBondContact CB-ND2 3.2Å; P2-N27 WeakPolarHBondContact CB-OD1 3.37Å; P2-N27 WeakPolarHBondContact CD-OD1 3.35Å; P2-N27 VanDerWaalsContact CG-CG 3.44Å; P2-N27 WeakPolarHBondContact CG-ND2 3.43Å; P2-N27 WeakPolarHBondContact CG-OD1 3.32Å; P2-N27 PolarHBondContact O-OD1 2.8Å
3	L	55.7	Low	72.6	Confident	136 Å²	136	87.2 Å²	87.2	71%	0.712	48%	0.482	S	S	*	.			trans	-64.5	112.8	174.8	-75.9	156	0	0	0	107.2	M1 V5 P8	M1-L3 PolarHBondContact O-N 2.57Å; L3-V5 PolarHBondContact O-N 3.15Å; L3-P8 WeakPolarHBondContact CD2-O 3.25Å
4	S	65.1	Low	73.6	Confident	36 Å²	36	88.5 Å²	88.5	25%	0.252	48%	0.483	S	S	.	.			trans	-61	128.9	171.4	176.1	0	0	0	0	108.2	P2 H6 Y7	P2-S4 PolarHBondContact O-N 3.34Å; P2-S4 VanDerWaalsContact O-N 3.11Å; S4-H6 PolarHBondContact O-N 3.38Å; S4-H6 VanDerWaalsContact O-N 3.08Å; S4-H6 PolarHBondContact OG-N 2.95Å; S4-Y7 CarbonylContact O-C 3.21Å; S4-Y7 PolarHBondContact O-N 3.47Å; S4-Y7 WeakPolarHBondContact OG-CD2 3.31Å
5	V	73	Confident	74.5	Confident	135 Å²	135	84.5 Å²	84.5	82%	0.818	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.4	-26.6	178.1	-165.1	0	0	0	0	111	L3	L3-V5 PolarHBondContact O-N 3.15Å
6	H	74.8	Confident	75.3	Confident	129 Å²	129	84.6 Å²	84.6	60%	0.597	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.9	-16	177.9	-60.4	-62	0	0	0	114.2	S4 P8 R50	S4-H6 PolarHBondContact O-N 3.38Å; S4-H6 VanDerWaalsContact O-N 3.08Å; S4-H6 PolarHBondContact OG-N 2.95Å; H6-P8 VanDerWaalsContact C-CD 3.5Å; H6-R50 PolarHBondContact O-NE 3.18Å
7	Y	79.5	Confident	75.7	Confident	50 Å²	50	82.4 Å²	82.4	20%	0.196	45%	0.45	C	S	.	.			trans	-135.1	61.3	-176.2	-52.6	-80	0	0	0	110.4	S4 N9 G10 H11 I48 R50	S4-Y7 CarbonylContact O-C 3.21Å; S4-Y7 PolarHBondContact O-N 3.47Å; S4-Y7 WeakPolarHBondContact OG-CD2 3.31Å; Y7-N9 PolarHBondContact O-N 3.07Å; Y7-G10 WeakPolarHBondContact O-CA 3.38Å; Y7-G10 PolarHBondContact O-N 3.47Å; Y7-H11 HydrophobicContact CD1-CB 3.66Å; Y7-H11 HydrophobicContact CE1-CB 4.34Å; Y7-H11 HydrophobicContact CG-CB 3.85Å; Y7-H11 AromaticContact CG-ND1 3.92Å; Y7-I48 HydrophobicContact CD1-CG2 4.4Å; Y7-I48 HydrophobicContact CE1-CG2 3.69Å; Y7-I48 HydrophobicContact CE2-CG2 4.29Å; Y7-R50 HydrophobicContact CD1-CB 4.46Å; Y7-R50 HydrophobicContact CD1-CG 3.37Å; Y7-R50 HydrophobicContact CE1-CG 3.47Å; Y7-R50 VanDerWaalsContact CE1-CG 3.47Å
8	P	77.3	Confident	75.8	Confident	84 Å²	84	85.7 Å²	85.7	55%	0.545	47%	0.468	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.4	-27.6	-173.6	25.7	-34.3	0	0	0	113.1	L3 H6 G10	L3-P8 WeakPolarHBondContact CD2-O 3.25Å; H6-P8 VanDerWaalsContact C-CD 3.5Å; P8-G10 VanDerWaalsContact C-N 3.29Å
9	N	84.9	Confident	76	Confident	123 Å²	123	84.4 Å²	84.4	66%	0.658	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.5	7.6	175.5	-59.3	-24.3	0	0	0	112.7	Y7 K51	Y7-N9 PolarHBondContact O-N 3.07Å; N9-K51 HydrophobicContact CB-CB 4.45Å; N9-K51 VanDerWaalsContact CB-O 3.31Å; N9-K51 WeakPolarHBondContact CB-O 3.31Å; N9-K51 PolarHBondContact ND2-O 3.2Å
10	G	82.4	Confident	76.4	Confident	25 Å²	25	81.1 Å²	81.1	26%	0.258	44%	0.442	S	S	.	.			trans	86	-179.8	-169.2	0	0	0	0	0	113.2	Y7 P8 K51	Y7-G10 WeakPolarHBondContact O-CA 3.38Å; Y7-G10 PolarHBondContact O-N 3.47Å; P8-G10 VanDerWaalsContact C-N 3.29Å; G10-K51 PolarHBondContact O-N 3.3Å
11	H	85.3	Confident	76.9	Confident	63 Å²	63	80.7 Å²	80.7	29%	0.292	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.4	160.9	-179	55.6	-76.9	0	0	0	109.4	Y7 I48 V49	Y7-H11 HydrophobicContact CD1-CB 3.66Å; Y7-H11 HydrophobicContact CE1-CB 4.34Å; Y7-H11 HydrophobicContact CG-CB 3.85Å; Y7-H11 AromaticContact CG-ND1 3.92Å; H11-I48 HydrophobicContact CB-CG2 3.99Å; H11-V49 CarbonylContact C-O 3.54Å; H11-V49 WeakPolarHBondContact CA-O 3.09Å; H11-V49 WeakPolarHBondContact CB-O 3.39Å
12	S	86.7	Confident	78.9	Confident	39 Å²	39	74.4 Å²	74.4	27%	0.273	42%	0.415	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	148	163.2	50.3	0	0	0	0	109.7	I48 V49	S12-I48 WeakPolarHBondContact O-CA 3.09Å; S12-V49 PolarHBondContact N-O 3.1Å; S12-V49 PolarHBondContact O-N 3.11Å
13	I	85.9	Confident	80.9	Confident	46 Å²	46	75.9 Å²	75.9	24%	0.236	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	123.2	177.2	-53.5	-179.2	0	0	0	107	M15 M24 L29 M46 E47 I48	I13-M15 HydrophobicContact CG2-CE 4.02Å; I13-M15 HydrophobicContact CG2-CG 4.1Å; I13-M15 HydrophobicContact CG2-SD 4.41Å; I13-M24 HydrophobicContact CD1-SD 4.33Å; I13-L29 HydrophobicContact CD1-CD2 3.95Å; I13-L29 HydrophobicContact CG2-CD2 4.09Å; I13-M46 HydrophobicContact CG2-CG 3.76Å; I13-M46 HydrophobicContact CG2-SD 4.15Å; I13-E47 WeakPolarHBondContact CA-O 3.36Å; I13-I48 HydrophobicContact CG1-CG1 4.49Å
14	H	87	Confident	82.3	Confident	106 Å²	106	73.6 Å²	73.6	49%	0.491	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.9	136.7	167.3	-56.9	133.3	0	0	0	108.7	M46 E47	H14-M46 WeakPolarHBondContact O-CA 3.31Å; H14-E47 HydrophobicContact CB-CB 4.37Å; H14-E47 PolarHBondContact N-O 3.33Å; H14-E47 IonicContact ND1-OE2 3.31Å; H14-E47 PolarHBondContact ND1-OE2 3.16Å; H14-E47 PolarHBondContact O-N 3.26Å
15	M	86.2	Confident	83.4	Confident	29 Å²	29	79.5 Å²	79.5	14%	0.143	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.6	136.6	179.1	-76.4	171.6	-77	0	0	110.1	I13 T22 L29 I31 E45 M46	I13-M15 HydrophobicContact CG2-CE 4.02Å; I13-M15 HydrophobicContact CG2-CG 4.1Å; I13-M15 HydrophobicContact CG2-SD 4.41Å; M15-T22 HydrophobicContact CE-CG2 3.2Å; M15-T22 HydrophobicContact SD-CG2 3.41Å; M15-T22 WeakPolarHBondContact SD-CG2 3.43Å; M15-L29 HydrophobicContact CE-CD1 4.01Å; M15-L29 HydrophobicContact CE-CD2 4.13Å; M15-L29 HydrophobicContact SD-CD1 4.4Å; M15-L29 HydrophobicContact SD-CD2 3.84Å; M15-L29 HydrophobicContact SD-CG 4.5Å; M15-I31 HydrophobicContact SD-CD1 3.86Å; M15-I31 HydrophobicContact SD-CG1 4.05Å; M15-E45 WeakPolarHBondContact CA-O 3.13Å; M15-M46 HydrophobicContact CG-CB 4.41Å; M15-M46 HydrophobicContact CG-CE 4.39Å; M15-M46 HydrophobicContact CG-CG 4.22Å; M15-M46 HydrophobicContact SD-CE 4.16Å
16	N	86.9	Confident	83.8	Confident	85 Å²	85	75 Å²	75	46%	0.455	40%	0.404	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.7	145.7	169.2	-80.8	-39.5	0	0	0	109.6	N18 V44 E45	N16-N18 PolarHBondContact OD1-OD1 3.31Å; N16-V44 WeakPolarHBondContact O-CA 3.43Å; N16-E45 PolarHBondContact N-O 2.97Å; N16-E45 PolarHBondContact O-N 2.94Å
17	P	83.5	Confident	84.1	Confident	47 Å²	47	73.9 Å²	73.9	31%	0.305	40%	0.403	S	S	.	.	S	Bend	cis	-74.4	156.6	-2.5	28.5	-35.7	0	0	0	114.4	N19 L20 V42 L43	P17-N19 VanDerWaalsContact CB-OD1 3.25Å; P17-N19 WeakPolarHBondContact CB-OD1 3.42Å; P17-N19 WeakPolarHBondContact CG-OD1 3.41Å; P17-N19 PolarHBondContact O-N 2.89Å; P17-L20 HydrophobicContact CG-CG 4.44Å; P17-L20 VanDerWaalsContact O-CG 3.31Å; P17-L20 WeakPolarHBondContact O-CG 3.34Å; P17-L20 PolarHBondContact O-N 2.95Å; P17-V42 HydrophobicContact CG-CG1 3.99Å; P17-L43 VanDerWaalsContact CD-O 3.31Å; P17-L43 WeakPolarHBondContact CD-O 3.38Å
18	N	77.2	Confident	84.4	Confident	142 Å²	142	75.6 Å²	75.6	76%	0.759	42%	0.419	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.9	-7.6	-177.9	-68	-21.7	0	0	0	114.9	N16 L20	N16-N18 PolarHBondContact OD1-OD1 3.31Å; N18-L20 PolarHBondContact O-N 2.9Å
19	N	79.2	Confident	84.8	Confident	62 Å²	62	73.6 Å²	73.6	33%	0.332	40%	0.403	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.9	10.2	178.7	66	-17.2	0	0	0	113	P17 Q34	P17-N19 VanDerWaalsContact CB-OD1 3.25Å; P17-N19 WeakPolarHBondContact CB-OD1 3.42Å; P17-N19 WeakPolarHBondContact CG-OD1 3.41Å; P17-N19 PolarHBondContact O-N 2.89Å; N19-Q34 WeakPolarHBondContact O-CG 3.48Å
20	L	83.9	Confident	85.1	Confident	18 Å²	18	69.5 Å²	69.5	9%	0.094	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.1	135.5	170.6	-59.8	171.3	0	0	0	109.8	P17 N18 T22 I31 L33 V44	P17-L20 HydrophobicContact CG-CG 4.44Å; P17-L20 VanDerWaalsContact O-CG 3.31Å; P17-L20 WeakPolarHBondContact O-CG 3.34Å; P17-L20 PolarHBondContact O-N 2.95Å; N18-L20 PolarHBondContact O-N 2.9Å; L20-T22 HydrophobicContact CB-CG2 4.31Å; L20-I31 HydrophobicContact CB-CG2 4.06Å; L20-I31 HydrophobicContact CD1-CG2 3.94Å; L20-I31 HydrophobicContact CD2-CG2 4.12Å; L20-I31 HydrophobicContact CG-CG2 4.26Å; L20-L33 HydrophobicContact CD2-CD2 3.5Å; L20-L33 HydrophobicContact CD2-CG 4.34Å; L20-V44 HydrophobicContact CD1-CB 4.26Å; L20-V44 HydrophobicContact CD1-CG1 3.62Å; L20-V44 HydrophobicContact CD1-CG2 3.74Å; L20-V44 HydrophobicContact CD2-CG2 4.43Å
21	T	87.5	Confident	85.4	Confident	72 Å²	72	71.4 Å²	71.4	44%	0.442	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.4	130	166.2	-58.1	0	0	0	0	108	Y32	T21-Y32 HydrophobicContact CG2-CD2 4.37Å; T21-Y32 PolarHBondContact N-O 3.43Å; T21-Y32 WeakPolarHBondContact O-CD2 3.38Å; T21-Y32 PolarHBondContact O-N 3.29Å
22	T	87.6	Confident	85.4	Confident	63 Å²	63	73.8 Å²	73.8	39%	0.387	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	131	-175.9	62.6	0	0	0	0	110.4	M15 L20 S30 I31	M15-T22 HydrophobicContact CE-CG2 3.2Å; M15-T22 HydrophobicContact SD-CG2 3.41Å; M15-T22 WeakPolarHBondContact SD-CG2 3.43Å; L20-T22 HydrophobicContact CB-CG2 4.31Å; T22-S30 CarbonylContact C-O 3.59Å; T22-S30 VanDerWaalsContact CA-O 3.32Å; T22-S30 WeakPolarHBondContact CA-O 3.47Å; T22-I31 HydrophobicContact CG2-CG2 4.42Å
23	E	89.3	Confident	85.1	Confident	103 Å²	103	76.6 Å²	76.6	48%	0.481	41%	0.407	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	130	179.6	-171.8	-175.1	173.9	0	0	110	S30 Y32	E23-S30 PolarHBondContact N-O 2.85Å; E23-S30 PolarHBondContact O-N 2.92Å; E23-Y32 HydrophobicContact CB-CE2 4.14Å
24	M	86.2	Confident	84.6	Confident	88 Å²	88	79.8 Å²	79.8	43%	0.433	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	116.9	173.3	-82	-63.3	-61.9	0	0	110.4	I13 L29	I13-M24 HydrophobicContact CD1-SD 4.33Å; M24-L29 HydrophobicContact CG-CD1 4Å; M24-L29 HydrophobicContact SD-CB 3.52Å; M24-L29 VanDerWaalsContact SD-CB 3.52Å; M24-L29 HydrophobicContact SD-CD1 3.63Å; M24-L29 HydrophobicContact SD-CG 4.1Å
25	K	86.7	Confident	83.7	Confident	160 Å²	160	81.8 Å²	81.8	70%	0.696	44%	0.44	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-122.5	99.5	173.6	-168.2	177.5	-177.5	176.6	0	110.4	N27 T28	K25-N27 PolarHBondContact O-N 2.96Å; K25-T28 PolarHBondContact N-O 2.9Å; K25-T28 PolarHBondContact O-N 2.92Å; K25-T28 VanDerWaalsContact O-N 3.1Å
26	G	82.7	Confident	82.8	Confident	41 Å²	41	87.7 Å²	87.7	42%	0.423	47%	0.473	S	S	.	.	T	Hydrogen-bonded Turn	trans	66.7	-112.9	-175	0	0	0	0	0	111.1
27	N	81	Confident	81.7	Confident	105 Å²	105	86.7 Å²	86.7	56%	0.561	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.3	-1.4	176.1	-72	-7.3	0	0	0	113.5	P2 K25	P2-N27 VanDerWaalsContact CB-ND2 3.31Å; P2-N27 WeakPolarHBondContact CB-ND2 3.2Å; P2-N27 WeakPolarHBondContact CB-OD1 3.37Å; P2-N27 WeakPolarHBondContact CD-OD1 3.35Å; P2-N27 VanDerWaalsContact CG-CG 3.44Å; P2-N27 WeakPolarHBondContact CG-ND2 3.43Å; P2-N27 WeakPolarHBondContact CG-OD1 3.32Å; P2-N27 PolarHBondContact O-OD1 2.8Å; K25-N27 PolarHBondContact O-N 2.96Å
28	T	84.3	Confident	80.9	Confident	87 Å²	87	94.1 Å²	94.1	53%	0.534	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.8	123.2	-176.4	-54.6	0	0	0	0	109.3	K25	K25-T28 PolarHBondContact N-O 2.9Å; K25-T28 PolarHBondContact O-N 2.92Å; K25-T28 VanDerWaalsContact O-N 3.1Å
29	L	87.1	Confident	80.7	Confident	42 Å²	42	96 Å²	96	22%	0.22	50%	0.499	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	118.2	167.1	177.3	59.3	0	0	0	108.9	I13 M15 M24 I31 M46	I13-L29 HydrophobicContact CD1-CD2 3.95Å; I13-L29 HydrophobicContact CG2-CD2 4.09Å; M15-L29 HydrophobicContact CE-CD1 4.01Å; M15-L29 HydrophobicContact CE-CD2 4.13Å; M15-L29 HydrophobicContact SD-CD1 4.4Å; M15-L29 HydrophobicContact SD-CD2 3.84Å; M15-L29 HydrophobicContact SD-CG 4.5Å; M24-L29 HydrophobicContact CG-CD1 4Å; M24-L29 HydrophobicContact SD-CB 3.52Å; M24-L29 VanDerWaalsContact SD-CB 3.52Å; M24-L29 HydrophobicContact SD-CD1 3.63Å; M24-L29 HydrophobicContact SD-CG 4.1Å; L29-I31 HydrophobicContact CG-CG1 4.21Å; L29-M46 HydrophobicContact CD2-CE 3.37Å; L29-M46 HydrophobicContact CD2-SD 4.05Å
30	S	90.3	Very high	80.6	Confident	36 Å²	36	99.4 Å²	99.4	25%	0.252	51%	0.513	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	136.2	171.4	-61.1	0	0	0	0	109.6	T22 E23 Y32	T22-S30 CarbonylContact C-O 3.59Å; T22-S30 VanDerWaalsContact CA-O 3.32Å; T22-S30 WeakPolarHBondContact CA-O 3.47Å; E23-S30 PolarHBondContact N-O 2.85Å; E23-S30 PolarHBondContact O-N 2.92Å; S30-Y32 VanDerWaalsContact CB-CE2 3.5Å; S30-Y32 WeakPolarHBondContact CB-OH 3.31Å
31	I	88.7	Confident	80.4	Confident	66 Å²	66	104.9 Å²	104.9	34%	0.338	55%	0.549	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	128.2	179.1	-51.6	176.5	0	0	0	107.5	M15 L20 T22 L29 V44 M46	M15-I31 HydrophobicContact SD-CD1 3.86Å; M15-I31 HydrophobicContact SD-CG1 4.05Å; L20-I31 HydrophobicContact CB-CG2 4.06Å; L20-I31 HydrophobicContact CD1-CG2 3.94Å; L20-I31 HydrophobicContact CD2-CG2 4.12Å; L20-I31 HydrophobicContact CG-CG2 4.26Å; T22-I31 HydrophobicContact CG2-CG2 4.42Å; L29-I31 HydrophobicContact CG-CG1 4.21Å; I31-V44 HydrophobicContact CD1-CG1 4.32Å; I31-M46 HydrophobicContact CD1-CE 3.73Å
32	Y	86.1	Confident	80	Confident	112 Å²	112	103.7 Å²	103.7	44%	0.439	54%	0.542	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	129.7	-178.8	-51.2	-91.3	0	0	0	109.8	T21 E23 S30	T21-Y32 HydrophobicContact CG2-CD2 4.37Å; T21-Y32 PolarHBondContact N-O 3.43Å; T21-Y32 WeakPolarHBondContact O-CD2 3.38Å; T21-Y32 PolarHBondContact O-N 3.29Å; E23-Y32 HydrophobicContact CB-CE2 4.14Å; S30-Y32 VanDerWaalsContact CB-CE2 3.5Å; S30-Y32 WeakPolarHBondContact CB-OH 3.31Å
33	L	80.1	Confident	79.9	Confident	99 Å²	99	107.2 Å²	107.2	52%	0.518	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-76.8	132.7	170	-69	163.7	0	0	0	108.6	L20 L37 V42	L20-L33 HydrophobicContact CD2-CD2 3.5Å; L20-L33 HydrophobicContact CD2-CG 4.34Å; L33-L37 HydrophobicContact CB-CD1 4.02Å; L33-L37 HydrophobicContact CD2-CD1 3.55Å; L33-L37 HydrophobicContact CG-CD1 4.35Å; L33-V42 HydrophobicContact CD2-CB 3.79Å; L33-V42 HydrophobicContact CD2-CG1 3.99Å; L33-V42 HydrophobicContact CD2-CG2 3.77Å
34	Q	75.4	Confident	79.8	Confident	112 Å²	112	105 Å²	105	52%	0.523	55%	0.551	S	S	.	*			trans	-66.6	143.7	171.5	-72.9	-169.9	-19.4	0	0	110.2	N19 D36 L37	N19-Q34 WeakPolarHBondContact O-CG 3.48Å; Q34-D36 PolarHBondContact O-N 3.31Å; Q34-L37 PolarHBondContact O-N 2.91Å
35	T	68.9	Low	79.9	Confident	148 Å²	148	106.7 Å²	106.7	91%	0.908	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64	-7.6	-167.5	43.8	0	0	0	0	115.4
36	D	66.4	Low	80.1	Confident	154 Å²	154	103 Å²	103	82%	0.824	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.1	4.2	-177.7	-93.6	-11.6	0	0	0	114.8	Q34 R38	Q34-D36 PolarHBondContact O-N 3.31Å; D36-R38 PolarHBondContact O-N 2.9Å; D36-R38 VanDerWaalsContact O-N 3.15Å
37	L	63.5	Low	80.3	Confident	64 Å²	64	106.5 Å²	106.5	34%	0.335	55%	0.55	S	S	.	.			trans	-76.2	110.9	173.2	-65.3	163.7	0	0	0	107.8	L33 Q34 V42	L33-L37 HydrophobicContact CB-CD1 4.02Å; L33-L37 HydrophobicContact CD2-CD1 3.55Å; L33-L37 HydrophobicContact CG-CD1 4.35Å; Q34-L37 PolarHBondContact O-N 2.91Å; L37-V42 HydrophobicContact CD1-CG2 3.9Å; L37-V42 HydrophobicContact CD2-CG2 4.47Å
38	R	66.3	Low	80.7	Confident	203 Å²	203	105 Å²	105	77%	0.766	54%	0.54	S	S	*	.			trans	-40.4	150	159.9	-62.3	178.3	179.6	-163.8	-1.7	108.2	D36 E40	D36-R38 PolarHBondContact O-N 2.9Å; D36-R38 VanDerWaalsContact O-N 3.15Å; R38-E40 HydrophobicContact CB-CG 4.25Å; R38-E40 PolarHBondContact O-N 3.08Å
39	N	73.1	Confident	80.7	Confident	182 Å²	182	103.4 Å²	103.4	97%	0.973	53%	0.531	S	S	*	.	S	Bend	trans	-59.3	45	-176.5	-77.3	-23.1	0	0	0	114.9
40	E	77.9	Confident	80.6	Confident	133 Å²	133	109 Å²	109	62%	0.621	55%	0.549	S	S	*	.			trans	-104.3	142.1	-177.3	-65.8	-176.9	-166.5	0	0	107.6	R38 V42	R38-E40 HydrophobicContact CB-CG 4.25Å; R38-E40 PolarHBondContact O-N 3.08Å; E40-V42 PolarHBondContact O-N 3.41Å
41	P	78.8	Confident	80.1	Confident	132 Å²	132	116.2 Å²	116.2	86%	0.857	58%	0.576	S	S	*	*			trans	-64.4	136	175.7	26.9	-32.9	0	0	0	110.1
42	V	80.2	Confident	79.7	Confident	48 Å²	48	118.8 Å²	118.8	29%	0.291	59%	0.588	S	S	.	*			trans	-105.7	121.4	171.5	178.4	0	0	0	0	109	P17 L33 L37 E40 V44	P17-V42 HydrophobicContact CG-CG1 3.99Å; L33-V42 HydrophobicContact CD2-CB 3.79Å; L33-V42 HydrophobicContact CD2-CG1 3.99Å; L33-V42 HydrophobicContact CD2-CG2 3.77Å; L37-V42 HydrophobicContact CD1-CG2 3.9Å; L37-V42 HydrophobicContact CD2-CG2 4.47Å; E40-V42 PolarHBondContact O-N 3.41Å; V42-V44 HydrophobicContact CG1-CG2 4.28Å
43	L	85.6	Confident	79.3	Confident	136 Å²	136	119.1 Å²	119.1	71%	0.712	60%	0.595	S	S	*	*			trans	-76.7	123.8	168.3	-177.9	65.9	0	0	0	108.6	P17	P17-L43 VanDerWaalsContact CD-O 3.31Å; P17-L43 WeakPolarHBondContact CD-O 3.38Å
44	V	86.3	Confident	79.3	Confident	57 Å²	57	120.2 Å²	120.2	35%	0.345	60%	0.6	S	S	.	*			trans	-108.3	117.1	174.7	-177.2	0	0	0	0	108.4	N16 L20 I31 V42	N16-V44 WeakPolarHBondContact O-CA 3.43Å; L20-V44 HydrophobicContact CD1-CB 4.26Å; L20-V44 HydrophobicContact CD1-CG1 3.62Å; L20-V44 HydrophobicContact CD1-CG2 3.74Å; L20-V44 HydrophobicContact CD2-CG2 4.43Å; I31-V44 HydrophobicContact CD1-CG1 4.32Å; V42-V44 HydrophobicContact CG1-CG2 4.28Å
45	E	89.2	Confident	79.5	Confident	124 Å²	124	120.7 Å²	120.7	58%	0.579	60%	0.604	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96.6	128.1	170.2	-72.3	-175.5	157.2	0	0	109.1	M15 N16	M15-E45 WeakPolarHBondContact CA-O 3.13Å; N16-E45 PolarHBondContact N-O 2.97Å; N16-E45 PolarHBondContact O-N 2.94Å
46	M	89.8	Confident	80.2	Confident	83 Å²	83	119 Å²	119	41%	0.409	59%	0.585	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-122.1	122.7	178.1	-177.7	-174.6	-61.4	0	0	109.4	I13 H14 M15 L29 I31 I48	I13-M46 HydrophobicContact CG2-CG 3.76Å; I13-M46 HydrophobicContact CG2-SD 4.15Å; H14-M46 WeakPolarHBondContact O-CA 3.31Å; M15-M46 HydrophobicContact CG-CB 4.41Å; M15-M46 HydrophobicContact CG-CE 4.39Å; M15-M46 HydrophobicContact CG-CG 4.22Å; M15-M46 HydrophobicContact SD-CE 4.16Å; L29-M46 HydrophobicContact CD2-CE 3.37Å; L29-M46 HydrophobicContact CD2-SD 4.05Å; I31-M46 HydrophobicContact CD1-CE 3.73Å; M46-I48 HydrophobicContact CG-CG1 4.21Å; M46-I48 HydrophobicContact SD-CD1 4.14Å; M46-I48 HydrophobicContact SD-CG1 4.18Å
47	E	88.3	Confident	81.1	Confident	114 Å²	114	116.7 Å²	116.7	53%	0.533	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-108.1	126.5	171.1	-172.3	-171.7	-152.6	0	0	109.2	I13 H14 V49	I13-E47 WeakPolarHBondContact CA-O 3.36Å; H14-E47 HydrophobicContact CB-CB 4.37Å; H14-E47 PolarHBondContact N-O 3.33Å; H14-E47 IonicContact ND1-OE2 3.31Å; H14-E47 PolarHBondContact ND1-OE2 3.16Å; H14-E47 PolarHBondContact O-N 3.26Å; E47-V49 HydrophobicContact CG-CG2 3.86Å
48	I	87.6	Confident	82.4	Confident	72 Å²	72	120.4 Å²	120.4	37%	0.369	59%	0.586	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.7	112.4	174	-53.6	175.6	0	0	0	108.1	Y7 H11 S12 I13 M46	Y7-I48 HydrophobicContact CD1-CG2 4.4Å; Y7-I48 HydrophobicContact CE1-CG2 3.69Å; Y7-I48 HydrophobicContact CE2-CG2 4.29Å; H11-I48 HydrophobicContact CB-CG2 3.99Å; S12-I48 WeakPolarHBondContact O-CA 3.09Å; I13-I48 HydrophobicContact CG1-CG1 4.49Å; M46-I48 HydrophobicContact CG-CG1 4.21Å; M46-I48 HydrophobicContact SD-CD1 4.14Å; M46-I48 HydrophobicContact SD-CG1 4.18Å
49	V	85.1	Confident	83.6	Confident	54 Å²	54	114.1 Å²	114.1	33%	0.327	57%	0.572	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-103.2	126.4	-179	-174.3	0	0	0	0	109.3	H11 S12 E47	H11-V49 CarbonylContact C-O 3.54Å; H11-V49 WeakPolarHBondContact CA-O 3.09Å; H11-V49 WeakPolarHBondContact CB-O 3.39Å; S12-V49 PolarHBondContact N-O 3.1Å; S12-V49 PolarHBondContact O-N 3.11Å; E47-V49 HydrophobicContact CG-CG2 3.86Å
50	R	84.3	Confident	84.5	Confident	160 Å²	160	108.4 Å²	108.4	60%	0.604	54%	0.539	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.2	138.3	173.2	-77.9	173.1	-177.6	-172.1	6.2	110.1	H6 Y7	H6-R50 PolarHBondContact O-NE 3.18Å; Y7-R50 HydrophobicContact CD1-CB 4.46Å; Y7-R50 HydrophobicContact CD1-CG 3.37Å; Y7-R50 HydrophobicContact CE1-CG 3.47Å; Y7-R50 VanDerWaalsContact CE1-CG 3.47Å
51	K	80.4	Confident	85.1	Confident	188 Å²	188	106.2 Å²	106.2	82%	0.817	53%	0.531	S	S	*	.			trans	-87.5	0	167.7	-79.4	-172.8	174.9	-178.3	0	112.1	N9 G10	N9-K51 HydrophobicContact CB-CB 4.45Å; N9-K51 VanDerWaalsContact CB-O 3.31Å; N9-K51 WeakPolarHBondContact CB-O 3.31Å; N9-K51 PolarHBondContact ND2-O 3.2Å; G10-K51 PolarHBondContact O-N 3.3Å

Retrieved 51 of 51 residues in 28.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).