A0A5K4F6Q3_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F6Q3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 60 aa.

						>A0A5K4F6Q3_SCHMA|A0A5K4F6Q3
MKFDYSEKSCHQLIPYNMKVVQEISQIIRWKYYDIAELNIELFKHKFLSEVLKVIIDNEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.5	Very low	55	Low	222 Å²	222	142.1 Å²	142.1	100%	1.094	70%	0.701	S	S	*	*				0	109.2	0	-131.9	166.9	177.6	0	0	107.2	F3	M1-F3 PolarHBondContact O-N 3.48Å
2	K	56.8	Low	55.1	Low	211 Å²	211	144.2 Å²	144.2	92%	0.917	71%	0.707	S	S	*	*			trans	-75.1	112.6	169.6	-88	-178	175.2	179.4	0	106	D4	K2-D4 PolarHBondContact O-N 3.37Å
3	F	57.9	Low	55.8	Low	151 Å²	151	144.2 Å²	144.2	66%	0.662	71%	0.711	S	S	*	*			trans	-65.5	120.8	169.5	-80.6	-86.4	0	0	0	107.5	M1 Y5	M1-F3 PolarHBondContact O-N 3.48Å; F3-Y5 HydrophobicContact CB-CD2 4.26Å; F3-Y5 HydrophobicContact CB-CE2 3.89Å; F3-Y5 WeakPolarHBondContact O-CD2 3.33Å; F3-Y5 PolarHBondContact O-N 2.89Å; F3-Y5 VanDerWaalsContact O-N 3.1Å
4	D	61.1	Low	56.3	Low	118 Å²	118	144 Å²	144	63%	0.631	71%	0.712	S	S	*	*			trans	-70.9	99.6	166.7	-167.3	-12.6	0	0	0	107	K2 S6	K2-D4 PolarHBondContact O-N 3.37Å; D4-S6 PolarHBondContact O-N 3.36Å; D4-S6 WeakPolarHBondContact OD1-CB 3.28Å; D4-S6 PolarHBondContact OD1-N 3.13Å; D4-S6 VanDerWaalsContact OD1-N 3.13Å; D4-S6 PolarHBondContact OD1-OG 3.15Å; D4-S6 PolarHBondContact OD2-OG 3.11Å
5	Y	58.1	Low	57.1	Low	155 Å²	155	142.9 Å²	142.9	61%	0.608	72%	0.72	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.1	-6.7	179.9	-73.5	-90.4	0	0	0	112.2	F3 E7 K8 S9	F3-Y5 HydrophobicContact CB-CD2 4.26Å; F3-Y5 HydrophobicContact CB-CE2 3.89Å; F3-Y5 WeakPolarHBondContact O-CD2 3.33Å; F3-Y5 PolarHBondContact O-N 2.89Å; F3-Y5 VanDerWaalsContact O-N 3.1Å; Y5-E7 VanDerWaalsContact C-N 3.29Å; Y5-E7 PolarHBondContact O-N 3.31Å; Y5-K8 PolarHBondContact O-N 3.39Å; Y5-K8 VanDerWaalsContact O-N 3.13Å; Y5-S9 PolarHBondContact O-N 3.04Å; Y5-S9 PolarHBondContact O-OG 3.49Å
6	S	61.3	Low	57.9	Low	64 Å²	64	142.9 Å²	142.9	45%	0.448	71%	0.71	S	S	.	*	H	α-helix	trans	-61.9	-36.5	-179.8	67.9	0	0	0	0	112.4	D4 S9 C10	D4-S6 PolarHBondContact O-N 3.36Å; D4-S6 WeakPolarHBondContact OD1-CB 3.28Å; D4-S6 PolarHBondContact OD1-N 3.13Å; D4-S6 VanDerWaalsContact OD1-N 3.13Å; D4-S6 PolarHBondContact OD1-OG 3.15Å; D4-S6 PolarHBondContact OD2-OG 3.11Å; S6-S9 PolarHBondContact O-N 3.44Å; S6-C10 PolarHBondContact O-N 3.45Å; S6-C10 VanDerWaalsContact O-N 3.09Å
7	E	54.8	Low	59.1	Low	143 Å²	143	140.4 Å²	140.4	67%	0.668	70%	0.699	S	S	*	*	H	α-helix	trans	-67.5	-36.4	174.6	-95.3	-172.7	161.7	0	0	112.6	Y5 S9 H11	Y5-E7 VanDerWaalsContact C-N 3.29Å; Y5-E7 PolarHBondContact O-N 3.31Å; E7-S9 VanDerWaalsContact C-N 3.35Å; E7-H11 PolarHBondContact O-CE1 3.01Å; E7-H11 PolarHBondContact O-ND1 3.27Å
8	K	53.2	Low	60.4	Low	157 Å²	157	138.8 Å²	138.8	68%	0.683	69%	0.692	S	S	*	*	H	α-helix	trans	-70.6	-32.6	176.2	-92.2	-176.2	175.8	178.8	0	112.4	Y5	Y5-K8 PolarHBondContact O-N 3.39Å; Y5-K8 VanDerWaalsContact O-N 3.13Å
9	S	54.2	Low	61.6	Low	86 Å²	86	138.3 Å²	138.3	60%	0.601	69%	0.685	S	S	*	*	H	α-helix	trans	-72.8	-33.6	177.3	-59.1	0	0	0	0	112.7	Y5 S6 E7 H11	Y5-S9 PolarHBondContact O-N 3.04Å; Y5-S9 PolarHBondContact O-OG 3.49Å; S6-S9 PolarHBondContact O-N 3.44Å; E7-S9 VanDerWaalsContact C-N 3.35Å; S9-H11 VanDerWaalsContact C-N 3.32Å; S9-H11 PolarHBondContact O-N 2.94Å
10	C	52.5	Low	62.6	Low	98 Å²	98	134.8 Å²	134.8	66%	0.662	67%	0.671	S	S	*	*	H	α-helix	trans	-68.8	-25	178.6	-95.6	0	0	0	0	114.4	S6 Q12	S6-C10 PolarHBondContact O-N 3.45Å; S6-C10 VanDerWaalsContact O-N 3.09Å; C10-Q12 VanDerWaalsContact C-N 3.32Å; C10-Q12 PolarHBondContact O-N 2.76Å
11	H	48.2	Very low	63.6	Low	158 Å²	158	130.9 Å²	130.9	73%	0.731	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.8	-2.5	-177	-69.5	108.3	0	0	0	114.6	E7 S9 L13	E7-H11 PolarHBondContact O-CE1 3.01Å; E7-H11 PolarHBondContact O-ND1 3.27Å; S9-H11 VanDerWaalsContact C-N 3.32Å; S9-H11 PolarHBondContact O-N 2.94Å; H11-L13 VanDerWaalsContact C-N 3.32Å; H11-L13 PolarHBondContact O-N 2.91Å
12	Q	55.1	Low	65.4	Low	167 Å²	167	125.8 Å²	125.8	78%	0.78	63%	0.628	S	S	*	*			trans	-95.3	61.8	169	-68.7	-175.7	-14.8	0	0	109.9	C10 I14	C10-Q12 VanDerWaalsContact C-N 3.32Å; C10-Q12 PolarHBondContact O-N 2.76Å; Q12-I14 PolarHBondContact O-N 3.3Å
13	L	64.6	Low	66.9	Low	145 Å²	145	119.8 Å²	119.8	76%	0.759	60%	0.603	S	S	*	*			trans	-59.4	115.1	162.2	-71.8	171.6	0	0	0	106.9	H11 P15	H11-L13 VanDerWaalsContact C-N 3.32Å; H11-L13 PolarHBondContact O-N 2.91Å; L13-P15 WeakPolarHBondContact O-CD 3.47Å; L13-P15 VanDerWaalsContact O-N 3.14Å
14	I	63.6	Low	68.2	Low	141 Å²	141	116.9 Å²	116.9	72%	0.723	59%	0.593	S	S	*	*			trans	-54	121.9	173.3	-64.5	169.7	0	0	0	106.2	Q12 Y16	Q12-I14 PolarHBondContact O-N 3.3Å; I14-Y16 PolarHBondContact O-N 3.42Å
15	P	68	Low	69.3	Low	128 Å²	128	114.4 Å²	114.4	83%	0.831	59%	0.585	S	S	*	*			trans	-58.6	111.4	176.4	21.7	-30.1	0	0	0	107.8	L13	L13-P15 WeakPolarHBondContact O-CD 3.47Å; L13-P15 VanDerWaalsContact O-N 3.14Å
16	Y	68.8	Low	70.6	Confident	142 Å²	142	112.6 Å²	112.6	56%	0.557	58%	0.583	S	S	*	*			trans	-98.1	144.1	178	56.9	-97.2	0	0	0	109.3	I14 M18 V21	I14-Y16 PolarHBondContact O-N 3.42Å; Y16-M18 HydrophobicContact CD2-SD 4.42Å; Y16-M18 HydrophobicContact CE2-SD 3.64Å; Y16-M18 PolarHBondContact O-N 2.9Å; Y16-M18 VanDerWaalsContact O-N 3.16Å; Y16-V21 HydrophobicContact CD2-CB 4.25Å; Y16-V21 HydrophobicContact CD2-CG2 3.24Å; Y16-V21 HydrophobicContact CE2-CB 4.28Å; Y16-V21 HydrophobicContact CE2-CG2 3.57Å; Y16-V21 HydrophobicContact CG-CG2 4.02Å
17	N	79.1	Confident	71.9	Confident	100 Å²	100	114.7 Å²	114.7	54%	0.535	59%	0.587	S	S	.	*			trans	-69.3	114	174	-176	-14.4	0	0	0	108.7	K19 V20 V21	N17-K19 PolarHBondContact O-N 2.96Å; N17-K19 VanDerWaalsContact O-N 3.09Å; N17-K19 WeakPolarHBondContact OD1-CB 3.49Å; N17-K19 PolarHBondContact OD1-N 3.35Å; N17-V20 HydrophobicContact CB-CB 4.3Å; N17-V20 HydrophobicContact CB-CG2 3.86Å; N17-V20 WeakPolarHBondContact O-CB 3.39Å; N17-V20 PolarHBondContact O-N 3.03Å; N17-V21 PolarHBondContact O-N 3.49Å
18	M	82.1	Confident	73.5	Confident	113 Å²	113	113.1 Å²	113.1	56%	0.557	58%	0.582	S	S	*	*	H	α-helix	trans	-52.9	-32.2	178.3	-75.8	-71.1	-70	0	0	112.6	Y16 V21 Q22	Y16-M18 HydrophobicContact CD2-SD 4.42Å; Y16-M18 HydrophobicContact CE2-SD 3.64Å; Y16-M18 PolarHBondContact O-N 2.9Å; Y16-M18 VanDerWaalsContact O-N 3.16Å; M18-V21 PolarHBondContact O-N 3.01Å; M18-Q22 WeakPolarHBondContact O-CG 3.44Å; M18-Q22 PolarHBondContact O-N 3.48Å
19	K	83.7	Confident	75	Confident	129 Å²	129	112.9 Å²	112.9	56%	0.561	58%	0.577	S	S	*	*	H	α-helix	trans	-61.5	-44.3	175.4	-170.3	-176.6	177.9	-169.7	0	111.8	N17 V21 Q22 E23	N17-K19 PolarHBondContact O-N 2.96Å; N17-K19 VanDerWaalsContact O-N 3.09Å; N17-K19 WeakPolarHBondContact OD1-CB 3.49Å; N17-K19 PolarHBondContact OD1-N 3.35Å; K19-V21 VanDerWaalsContact C-N 3.34Å; K19-V21 PolarHBondContact O-N 3.27Å; K19-Q22 PolarHBondContact O-N 3.38Å; K19-E23 WeakPolarHBondContact CE-OE1 3.48Å; K19-E23 WeakPolarHBondContact O-CG 3.5Å; K19-E23 PolarHBondContact O-N 2.91Å
20	V	80.6	Confident	76.5	Confident	67 Å²	67	117.4 Å²	117.4	41%	0.406	58%	0.581	S	S	.	*	H	α-helix	trans	-64.3	-40.6	178.5	175.9	0	0	0	0	110.7	N17 Q22 E23 I24	N17-V20 HydrophobicContact CB-CB 4.3Å; N17-V20 HydrophobicContact CB-CG2 3.86Å; N17-V20 WeakPolarHBondContact O-CB 3.39Å; N17-V20 PolarHBondContact O-N 3.03Å; V20-Q22 PolarHBondContact O-N 3.27Å; V20-E23 PolarHBondContact O-N 2.93Å; V20-I24 HydrophobicContact CG1-CD1 3.9Å; V20-I24 HydrophobicContact CG1-CG1 4.47Å; V20-I24 WeakPolarHBondContact O-CG1 3.41Å; V20-I24 PolarHBondContact O-N 3.46Å
21	V	83.8	Confident	78	Confident	54 Å²	54	118.9 Å²	118.9	33%	0.327	58%	0.577	S	S	.	*	H	α-helix	trans	-64.6	-40	176.5	171.4	0	0	0	0	112	Y16 N17 M18 K19 S25	Y16-V21 HydrophobicContact CD2-CB 4.25Å; Y16-V21 HydrophobicContact CD2-CG2 3.24Å; Y16-V21 HydrophobicContact CE2-CB 4.28Å; Y16-V21 HydrophobicContact CE2-CG2 3.57Å; Y16-V21 HydrophobicContact CG-CG2 4.02Å; N17-V21 PolarHBondContact O-N 3.49Å; M18-V21 PolarHBondContact O-N 3.01Å; K19-V21 VanDerWaalsContact C-N 3.34Å; K19-V21 PolarHBondContact O-N 3.27Å; V21-S25 WeakPolarHBondContact O-CB 3.42Å; V21-S25 PolarHBondContact O-N 3.3Å; V21-S25 PolarHBondContact O-OG 3.3Å
22	Q	85.1	Confident	79.5	Confident	114 Å²	114	119.3 Å²	119.3	53%	0.533	57%	0.573	S	S	.	*	H	α-helix	trans	-64.5	-43.4	175.1	-73.1	175.1	-19.4	0	0	111.9	M18 K19 V20 S25 Q26	M18-Q22 WeakPolarHBondContact O-CG 3.44Å; M18-Q22 PolarHBondContact O-N 3.48Å; K19-Q22 PolarHBondContact O-N 3.38Å; V20-Q22 PolarHBondContact O-N 3.27Å; Q22-S25 PolarHBondContact O-N 3.34Å; Q22-Q26 WeakPolarHBondContact O-CG 3.34Å; Q22-Q26 PolarHBondContact O-N 3.45Å
23	E	88.2	Confident	80.8	Confident	86 Å²	86	117.1 Å²	117.1	40%	0.402	56%	0.558	S	S	.	*	H	α-helix	trans	-61	-48	176.5	-73.5	169.4	-176.9	0	0	111.4	K19 V20 S25 Q26 I27	K19-E23 WeakPolarHBondContact CE-OE1 3.48Å; K19-E23 WeakPolarHBondContact O-CG 3.5Å; K19-E23 PolarHBondContact O-N 2.91Å; V20-E23 PolarHBondContact O-N 2.93Å; E23-S25 VanDerWaalsContact C-N 3.33Å; E23-S25 PolarHBondContact O-N 2.86Å; E23-Q26 PolarHBondContact O-N 2.92Å; E23-I27 WeakPolarHBondContact O-CG1 3.39Å; E23-I27 PolarHBondContact O-N 2.7Å
24	I	85.6	Confident	81.6	Confident	89 Å²	89	114.1 Å²	114.1	46%	0.456	54%	0.543	S	S	.	.	H	α-helix	trans	-59.8	-43.9	175.6	-68.8	169.4	0	0	0	110.9	V20 Q26 I27 I28	V20-I24 HydrophobicContact CG1-CD1 3.9Å; V20-I24 HydrophobicContact CG1-CG1 4.47Å; V20-I24 WeakPolarHBondContact O-CG1 3.41Å; V20-I24 PolarHBondContact O-N 3.46Å; I24-Q26 VanDerWaalsContact C-N 3.3Å; I24-Q26 PolarHBondContact O-N 3.43Å; I24-I27 PolarHBondContact O-N 2.92Å; I24-I28 HydrophobicContact CG2-CD1 3.85Å; I24-I28 HydrophobicContact CG2-CG1 4.43Å; I24-I28 WeakPolarHBondContact O-CG1 3.36Å; I24-I28 PolarHBondContact O-N 3.36Å
25	S	84.9	Confident	82.6	Confident	66 Å²	66	112 Å²	112	46%	0.462	53%	0.532	S	S	.	.	H	α-helix	trans	-62.7	-38	178.9	-58.6	0	0	0	0	112	V21 Q22 E23 R29	V21-S25 WeakPolarHBondContact O-CB 3.42Å; V21-S25 PolarHBondContact O-N 3.3Å; V21-S25 PolarHBondContact O-OG 3.3Å; Q22-S25 PolarHBondContact O-N 3.34Å; E23-S25 VanDerWaalsContact C-N 3.33Å; E23-S25 PolarHBondContact O-N 2.86Å; S25-R29 WeakPolarHBondContact O-CB 3.48Å; S25-R29 PolarHBondContact O-N 3.47Å
26	Q	85.8	Confident	83.4	Confident	118 Å²	118	107.5 Å²	107.5	55%	0.551	51%	0.506	S	S	*	.	H	α-helix	trans	-65.2	-45.9	174.3	-73.4	175.2	-0.5	0	0	111.3	Q22 E23 I24 I28 R29 W30	Q22-Q26 WeakPolarHBondContact O-CG 3.34Å; Q22-Q26 PolarHBondContact O-N 3.45Å; E23-Q26 PolarHBondContact O-N 2.92Å; I24-Q26 VanDerWaalsContact C-N 3.3Å; I24-Q26 PolarHBondContact O-N 3.43Å; Q26-I28 VanDerWaalsContact C-N 3.35Å; Q26-I28 PolarHBondContact O-N 2.89Å; Q26-R29 PolarHBondContact O-N 3.23Å; Q26-R29 VanDerWaalsContact O-N 3.15Å; Q26-W30 PolarHBondContact O-N 2.91Å
27	I	88.9	Confident	84.1	Confident	107 Å²	107	106.7 Å²	106.7	55%	0.549	51%	0.507	S	S	.	.	H	α-helix	trans	-58.5	-46.1	177.6	-67.6	165.3	0	0	0	111.1	E23 I24 R29 W30 K31	E23-I27 WeakPolarHBondContact O-CG1 3.39Å; E23-I27 PolarHBondContact O-N 2.7Å; I24-I27 PolarHBondContact O-N 2.92Å; I27-R29 VanDerWaalsContact C-N 3.32Å; I27-R29 PolarHBondContact O-N 2.91Å; I27-W30 PolarHBondContact O-N 2.95Å; I27-K31 WeakPolarHBondContact O-CG 3.44Å; I27-K31 PolarHBondContact O-N 3.39Å
28	I	87.6	Confident	84.4	Confident	110 Å²	110	106.9 Å²	106.9	56%	0.564	51%	0.508	S	S	*	.	H	α-helix	trans	-59.7	-45.2	176.9	-69	168.7	0	0	0	110.4	I24 Q26 W30 K31 Y32	I24-I28 HydrophobicContact CG2-CD1 3.85Å; I24-I28 HydrophobicContact CG2-CG1 4.43Å; I24-I28 WeakPolarHBondContact O-CG1 3.36Å; I24-I28 PolarHBondContact O-N 3.36Å; Q26-I28 VanDerWaalsContact C-N 3.35Å; Q26-I28 PolarHBondContact O-N 2.89Å; I28-W30 PolarHBondContact O-N 3.37Å; I28-K31 PolarHBondContact O-N 3.45Å; I28-Y32 WeakPolarHBondContact O-CB 3.38Å; I28-Y32 PolarHBondContact O-N 3.48Å
29	R	84.7	Confident	84.6	Confident	152 Å²	152	106 Å²	106	57%	0.574	51%	0.505	S	S	*	.	H	α-helix	trans	-63.2	-41.1	179.6	-173.7	175.7	-179.8	-164.1	-5.3	112.1	S25 Q26 I27 Y32 Y33	S25-R29 WeakPolarHBondContact O-CB 3.48Å; S25-R29 PolarHBondContact O-N 3.47Å; Q26-R29 PolarHBondContact O-N 3.23Å; Q26-R29 VanDerWaalsContact O-N 3.15Å; I27-R29 VanDerWaalsContact C-N 3.32Å; I27-R29 PolarHBondContact O-N 2.91Å; R29-Y32 PolarHBondContact O-N 3.29Å; R29-Y33 HydrophobicContact CG-CD2 3.96Å; R29-Y33 HydrophobicContact CG-CE2 3.5Å; R29-Y33 PolarHBondContact NE-OH 2.88Å; R29-Y33 PolarHBondContact NH2-OH 3.47Å; R29-Y33 WeakPolarHBondContact O-CD2 3.34Å; R29-Y33 PolarHBondContact O-N 3.07Å; R29-Y33 VanDerWaalsContact O-N 3.09Å
30	W	84.9	Confident	84.8	Confident	182 Å²	182	104.3 Å²	104.3	69%	0.689	50%	0.501	S	S	*	.	H	α-helix	trans	-64.4	-47.6	176.9	-75.2	39.7	0	0	0	110.9	Q26 I27 I28 Y32 Y33 D34	Q26-W30 PolarHBondContact O-N 2.91Å; I27-W30 PolarHBondContact O-N 2.95Å; I28-W30 PolarHBondContact O-N 3.37Å; W30-Y32 VanDerWaalsContact C-N 3.27Å; W30-Y32 PolarHBondContact O-N 2.94Å; W30-Y33 PolarHBondContact O-N 3.11Å; W30-D34 PolarHBondContact O-N 3.02Å
31	K	84.3	Confident	85.2	Confident	129 Å²	129	105.5 Å²	105.5	56%	0.561	50%	0.502	S	S	*	.	H	α-helix	trans	-58.6	-37.9	175	-74.7	-66.7	-176.7	-168.7	0	113	I27 I28 D34 I35	I27-K31 WeakPolarHBondContact O-CG 3.44Å; I27-K31 PolarHBondContact O-N 3.39Å; I28-K31 PolarHBondContact O-N 3.45Å; K31-D34 PolarHBondContact O-N 3.21Å; K31-I35 WeakPolarHBondContact O-CB 3.48Å; K31-I35 WeakPolarHBondContact O-CD1 3.32Å; K31-I35 VanDerWaalsContact O-CG1 3.24Å; K31-I35 WeakPolarHBondContact O-CG1 3.44Å; K31-I35 PolarHBondContact O-N 3.02Å
32	Y	80.6	Confident	85.4	Confident	166 Å²	166	107.8 Å²	107.8	65%	0.651	51%	0.512	S	S	*	.	H	α-helix	trans	-63.7	-42.7	175.3	-176	-91.1	0	0	0	111.9	I28 R29 W30 I35 A36	I28-Y32 WeakPolarHBondContact O-CB 3.38Å; I28-Y32 PolarHBondContact O-N 3.48Å; R29-Y32 PolarHBondContact O-N 3.29Å; W30-Y32 VanDerWaalsContact C-N 3.27Å; W30-Y32 PolarHBondContact O-N 2.94Å; Y32-I35 PolarHBondContact O-N 2.83Å; Y32-A36 WeakPolarHBondContact O-CB 3.28Å; Y32-A36 PolarHBondContact O-N 3.46Å
33	Y	82.5	Confident	85.5	Confident	122 Å²	122	109.2 Å²	109.2	48%	0.478	52%	0.517	S	S	.	.	H	α-helix	trans	-67.4	-41.4	175.5	-71.7	-56.7	0	0	0	112.5	R29 W30 I35 A36 E37	R29-Y33 HydrophobicContact CG-CD2 3.96Å; R29-Y33 HydrophobicContact CG-CE2 3.5Å; R29-Y33 PolarHBondContact NE-OH 2.88Å; R29-Y33 PolarHBondContact NH2-OH 3.47Å; R29-Y33 WeakPolarHBondContact O-CD2 3.34Å; R29-Y33 PolarHBondContact O-N 3.07Å; R29-Y33 VanDerWaalsContact O-N 3.09Å; W30-Y33 PolarHBondContact O-N 3.11Å; Y33-I35 VanDerWaalsContact C-N 3.29Å; Y33-I35 PolarHBondContact O-N 3.12Å; Y33-A36 WeakPolarHBondContact O-CB 3.4Å; Y33-A36 PolarHBondContact O-N 2.96Å; Y33-A36 VanDerWaalsContact O-N 3.12Å; Y33-E37 WeakPolarHBondContact O-CB 3.4Å; Y33-E37 PolarHBondContact O-N 3.42Å
34	D	81	Confident	85.6	Confident	82 Å²	82	109.9 Å²	109.9	44%	0.439	52%	0.518	S	S	.	.	H	α-helix	trans	-57.4	-43.9	174.6	-65.4	-14.6	0	0	0	111	W30 K31 E37 L38	W30-D34 PolarHBondContact O-N 3.02Å; K31-D34 PolarHBondContact O-N 3.21Å; D34-E37 PolarHBondContact O-N 3.31Å; D34-L38 VanDerWaalsContact O-CB 3.32Å; D34-L38 WeakPolarHBondContact O-CB 3.37Å; D34-L38 PolarHBondContact O-N 3.44Å
35	I	84.3	Confident	85.9	Confident	96 Å²	96	112 Å²	112	49%	0.492	53%	0.526	S	S	.	.	H	α-helix	trans	-66.1	-41.5	176.9	-69.6	166.7	0	0	0	110.8	K31 Y32 Y33 L38 N39	K31-I35 WeakPolarHBondContact O-CB 3.48Å; K31-I35 WeakPolarHBondContact O-CD1 3.32Å; K31-I35 VanDerWaalsContact O-CG1 3.24Å; K31-I35 WeakPolarHBondContact O-CG1 3.44Å; K31-I35 PolarHBondContact O-N 3.02Å; Y32-I35 PolarHBondContact O-N 2.83Å; Y33-I35 VanDerWaalsContact C-N 3.29Å; Y33-I35 PolarHBondContact O-N 3.12Å; I35-L38 PolarHBondContact O-N 2.94Å; I35-N39 WeakPolarHBondContact O-CB 3.36Å; I35-N39 PolarHBondContact O-N 3.37Å; I35-N39 PolarHBondContact O-ND2 3.37Å
36	A	84	Confident	86.2	Confident	33 Å²	33	115.5 Å²	115.5	27%	0.273	53%	0.533	S	S	.	.	H	α-helix	trans	-63.6	-42.6	177.6	0	0	0	0	0	111.6	Y32 Y33 N39 I40	Y32-A36 WeakPolarHBondContact O-CB 3.28Å; Y32-A36 PolarHBondContact O-N 3.46Å; Y33-A36 WeakPolarHBondContact O-CB 3.4Å; Y33-A36 PolarHBondContact O-N 2.96Å; Y33-A36 VanDerWaalsContact O-N 3.12Å; A36-N39 PolarHBondContact O-N 3.38Å; A36-I40 VanDerWaalsContact O-CG1 3.28Å; A36-I40 WeakPolarHBondContact O-CG1 3.28Å; A36-I40 PolarHBondContact O-N 2.98Å
37	E	84.9	Confident	86.4	Confident	126 Å²	126	115.8 Å²	115.8	59%	0.589	53%	0.532	S	S	*	.	H	α-helix	trans	-63.9	-46.8	175.5	-173.9	171.5	-159.4	0	0	111.3	Y33 D34 N39 I40 E41	Y33-E37 WeakPolarHBondContact O-CB 3.4Å; Y33-E37 PolarHBondContact O-N 3.42Å; D34-E37 PolarHBondContact O-N 3.31Å; E37-N39 VanDerWaalsContact C-N 3.31Å; E37-N39 PolarHBondContact O-N 3.48Å; E37-I40 WeakPolarHBondContact O-CB 3.46Å; E37-I40 PolarHBondContact O-N 2.89Å; E37-I40 VanDerWaalsContact O-N 3.11Å; E37-E41 PolarHBondContact O-N 3.15Å
38	L	84.9	Confident	86.6	Confident	104 Å²	104	115.6 Å²	115.6	55%	0.545	53%	0.532	S	S	.	.	H	α-helix	trans	-58.2	-42.9	175.2	-175.9	67.6	0	0	0	111.8	D34 I35 I40 E41 L42	D34-L38 VanDerWaalsContact O-CB 3.32Å; D34-L38 WeakPolarHBondContact O-CB 3.37Å; D34-L38 PolarHBondContact O-N 3.44Å; I35-L38 PolarHBondContact O-N 2.94Å; L38-I40 VanDerWaalsContact C-N 3.33Å; L38-I40 PolarHBondContact O-N 2.97Å; L38-E41 PolarHBondContact O-N 2.93Å; L38-L42 HydrophobicContact CG-CD1 4.15Å; L38-L42 WeakPolarHBondContact O-CB 3.49Å; L38-L42 VanDerWaalsContact O-CG 3.28Å; L38-L42 WeakPolarHBondContact O-CG 3.48Å; L38-L42 PolarHBondContact O-N 3.23Å
39	N	87.3	Confident	86.8	Confident	93 Å²	93	113.3 Å²	113.3	50%	0.497	53%	0.526	S	S	.	.	H	α-helix	trans	-63.6	-38.1	176.9	-74.8	-25.3	0	0	0	112.1	I35 A36 E37 F43	I35-N39 WeakPolarHBondContact O-CB 3.36Å; I35-N39 PolarHBondContact O-N 3.37Å; I35-N39 PolarHBondContact O-ND2 3.37Å; A36-N39 PolarHBondContact O-N 3.38Å; E37-N39 VanDerWaalsContact C-N 3.31Å; E37-N39 PolarHBondContact O-N 3.48Å; N39-F43 WeakPolarHBondContact O-CB 3.46Å; N39-F43 PolarHBondContact O-N 3.09Å
40	I	87.2	Confident	87.2	Confident	94 Å²	94	110.7 Å²	110.7	48%	0.482	52%	0.52	S	S	.	.	H	α-helix	trans	-66.2	-45.6	176.1	-71.4	164.9	0	0	0	110.6	A36 E37 L38 F43 K44	A36-I40 VanDerWaalsContact O-CG1 3.28Å; A36-I40 WeakPolarHBondContact O-CG1 3.28Å; A36-I40 PolarHBondContact O-N 2.98Å; E37-I40 WeakPolarHBondContact O-CB 3.46Å; E37-I40 PolarHBondContact O-N 2.89Å; E37-I40 VanDerWaalsContact O-N 3.11Å; L38-I40 VanDerWaalsContact C-N 3.33Å; L38-I40 PolarHBondContact O-N 2.97Å; I40-F43 WeakPolarHBondContact O-CB 3.24Å; I40-F43 PolarHBondContact O-N 3.41Å; I40-K44 HydrophobicContact CG2-CD 4.46Å; I40-K44 WeakPolarHBondContact O-CG 3.49Å; I40-K44 PolarHBondContact O-N 3.3Å
41	E	87.9	Confident	87.5	Confident	93 Å²	93	104.7 Å²	104.7	44%	0.435	50%	0.504	S	S	.	.	H	α-helix	trans	-65.2	-40.9	178.3	-70.7	-54.2	129.4	0	0	112	E37 L38 F43 K44 H45	E37-E41 PolarHBondContact O-N 3.15Å; L38-E41 PolarHBondContact O-N 2.93Å; E41-F43 VanDerWaalsContact C-N 3.32Å; E41-F43 PolarHBondContact O-N 3.05Å; E41-K44 PolarHBondContact O-N 3.32Å; E41-K44 IonicContact OE1-NZ 2.7Å; E41-K44 PolarHBondContact OE1-NZ 3.4Å; E41-H45 WeakPolarHBondContact O-CB 3.5Å; E41-H45 PolarHBondContact O-N 3.03Å
42	L	88	Confident	87.9	Confident	101 Å²	101	103.3 Å²	103.3	53%	0.529	50%	0.502	S	S	.	.	H	α-helix	trans	-60.9	-40.6	172.3	-74.6	171.6	0	0	0	112	L38 H45 K46	L38-L42 HydrophobicContact CG-CD1 4.15Å; L38-L42 WeakPolarHBondContact O-CB 3.49Å; L38-L42 VanDerWaalsContact O-CG 3.28Å; L38-L42 WeakPolarHBondContact O-CG 3.48Å; L38-L42 PolarHBondContact O-N 3.23Å; L42-H45 PolarHBondContact O-N 3.21Å; L42-K46 WeakPolarHBondContact O-CB 3.42Å; L42-K46 PolarHBondContact O-N 2.93Å
43	F	88.5	Confident	88.4	Confident	144 Å²	144	100.9 Å²	100.9	63%	0.632	50%	0.495	S	S	*	.	H	α-helix	trans	-63.2	-46.6	175.3	177.2	-94.7	0	0	0	111.9	N39 I40 E41 H45 K46 F47	N39-F43 WeakPolarHBondContact O-CB 3.46Å; N39-F43 PolarHBondContact O-N 3.09Å; I40-F43 WeakPolarHBondContact O-CB 3.24Å; I40-F43 PolarHBondContact O-N 3.41Å; E41-F43 VanDerWaalsContact C-N 3.32Å; E41-F43 PolarHBondContact O-N 3.05Å; F43-H45 VanDerWaalsContact C-N 3.34Å; F43-H45 PolarHBondContact O-N 2.94Å; F43-K46 PolarHBondContact O-N 2.95Å; F43-F47 WeakPolarHBondContact O-CB 3.34Å; F43-F47 PolarHBondContact O-N 3.24Å
44	K	90.3	Very high	88.8	Confident	101 Å²	101	99 Å²	99	44%	0.439	50%	0.495	S	S	.	.	H	α-helix	trans	-58.4	-46	175.8	-72.3	175.1	-174.6	168.3	0	111.4	I40 E41 F47 L48	I40-K44 HydrophobicContact CG2-CD 4.46Å; I40-K44 WeakPolarHBondContact O-CG 3.49Å; I40-K44 PolarHBondContact O-N 3.3Å; E41-K44 PolarHBondContact O-N 3.32Å; E41-K44 IonicContact OE1-NZ 2.7Å; E41-K44 PolarHBondContact OE1-NZ 3.4Å; K44-F47 PolarHBondContact O-N 3.47Å; K44-L48 WeakPolarHBondContact O-CB 3.48Å; K44-L48 WeakPolarHBondContact O-CG 3.35Å; K44-L48 PolarHBondContact O-N 3.34Å
45	H	91.1	Very high	89.3	Confident	134 Å²	134	99 Å²	99	62%	0.62	49%	0.494	S	S	*	.	H	α-helix	trans	-62	-46	178.2	-176.7	-83.5	0	0	0	111.6	E41 L42 F43 F47 L48 S49	E41-H45 WeakPolarHBondContact O-CB 3.5Å; E41-H45 PolarHBondContact O-N 3.03Å; L42-H45 PolarHBondContact O-N 3.21Å; F43-H45 VanDerWaalsContact C-N 3.34Å; F43-H45 PolarHBondContact O-N 2.94Å; H45-F47 VanDerWaalsContact C-N 3.35Å; H45-F47 PolarHBondContact O-N 2.95Å; H45-L48 PolarHBondContact O-N 3.34Å; H45-S49 WeakPolarHBondContact O-CB 3.14Å; H45-S49 PolarHBondContact O-N 3.49Å
46	K	91.5	Very high	89.7	Confident	139 Å²	139	98.5 Å²	98.5	60%	0.604	49%	0.492	S	S	*	.	H	α-helix	trans	-60.9	-44.9	176.5	-173.6	177.2	-179.8	-179.9	0	111.5	L42 F43 S49 E50	L42-K46 WeakPolarHBondContact O-CB 3.42Å; L42-K46 PolarHBondContact O-N 2.93Å; F43-K46 PolarHBondContact O-N 2.95Å; K46-S49 PolarHBondContact O-N 2.93Å; K46-E50 WeakPolarHBondContact O-CG 3.48Å; K46-E50 PolarHBondContact O-N 2.75Å
47	F	90.2	Very high	90	Very high	123 Å²	123	101.1 Å²	101.1	54%	0.539	50%	0.502	S	S	.	.	H	α-helix	trans	-60.1	-48.2	177.6	-178.2	-100.3	0	0	0	111.7	F43 K44 H45 S49 E50 V51	F43-F47 WeakPolarHBondContact O-CB 3.34Å; F43-F47 PolarHBondContact O-N 3.24Å; K44-F47 PolarHBondContact O-N 3.47Å; H45-F47 VanDerWaalsContact C-N 3.35Å; H45-F47 PolarHBondContact O-N 2.95Å; F47-S49 VanDerWaalsContact C-N 3.33Å; F47-S49 PolarHBondContact O-N 3.09Å; F47-E50 PolarHBondContact O-N 3.26Å; F47-V51 HydrophobicContact CD1-CG2 4.23Å; F47-V51 HydrophobicContact CE1-CG2 3.86Å; F47-V51 HydrophobicContact CE2-CG2 4.38Å; F47-V51 HydrophobicContact CZ-CG2 3.94Å; F47-V51 WeakPolarHBondContact O-CG2 3.36Å; F47-V51 PolarHBondContact O-N 3.16Å
48	L	92.7	Very high	90	Very high	104 Å²	104	101.2 Å²	101.2	55%	0.545	51%	0.506	S	S	.	.	H	α-helix	trans	-60.1	-42	176	-74	170.9	0	0	0	112.2	K44 H45 E50 V51 L52	K44-L48 WeakPolarHBondContact O-CB 3.48Å; K44-L48 WeakPolarHBondContact O-CG 3.35Å; K44-L48 PolarHBondContact O-N 3.34Å; H45-L48 PolarHBondContact O-N 3.34Å; L48-E50 PolarHBondContact O-N 3Å; L48-V51 PolarHBondContact O-N 3.04Å; L48-L52 WeakPolarHBondContact O-CB 3.39Å; L48-L52 WeakPolarHBondContact O-CG 3.22Å; L48-L52 PolarHBondContact O-N 2.9Å
49	S	92.8	Very high	89.9	Confident	62 Å²	62	103.8 Å²	103.8	43%	0.434	52%	0.515	S	S	.	.	H	α-helix	trans	-61.8	-41.9	177.3	-172.6	0	0	0	0	112.4	H45 K46 F47 K53	H45-S49 WeakPolarHBondContact O-CB 3.14Å; H45-S49 PolarHBondContact O-N 3.49Å; K46-S49 PolarHBondContact O-N 2.93Å; F47-S49 VanDerWaalsContact C-N 3.33Å; F47-S49 PolarHBondContact O-N 3.09Å; S49-K53 WeakPolarHBondContact O-CB 3.37Å; S49-K53 PolarHBondContact O-N 3.36Å
50	E	92.1	Very high	88.8	Confident	96 Å²	96	109.7 Å²	109.7	45%	0.449	54%	0.536	S	S	.	.	H	α-helix	trans	-68.2	-41.5	176.6	-68.9	-62.7	152	0	0	111.5	K46 F47 L48 K53 V54	K46-E50 WeakPolarHBondContact O-CG 3.48Å; K46-E50 PolarHBondContact O-N 2.75Å; F47-E50 PolarHBondContact O-N 3.26Å; L48-E50 PolarHBondContact O-N 3Å; E50-K53 WeakPolarHBondContact O-CB 3.41Å; E50-K53 PolarHBondContact O-N 3.1Å; E50-V54 WeakPolarHBondContact O-CG2 3.34Å; E50-V54 PolarHBondContact O-N 2.99Å
51	V	90.9	Very high	88.9	Confident	57 Å²	57	110.5 Å²	110.5	35%	0.345	54%	0.539	S	S	.	.	H	α-helix	trans	-60.2	-47.2	175.2	170.3	0	0	0	0	111.1	F47 L48 K53 V54 I55	F47-V51 HydrophobicContact CD1-CG2 4.23Å; F47-V51 HydrophobicContact CE1-CG2 3.86Å; F47-V51 HydrophobicContact CE2-CG2 4.38Å; F47-V51 HydrophobicContact CZ-CG2 3.94Å; F47-V51 WeakPolarHBondContact O-CG2 3.36Å; F47-V51 PolarHBondContact O-N 3.16Å; L48-V51 PolarHBondContact O-N 3.04Å; V51-K53 VanDerWaalsContact C-N 3.32Å; V51-K53 PolarHBondContact O-N 3.13Å; V51-V54 PolarHBondContact O-N 3.37Å; V51-I55 HydrophobicContact CG1-CD1 3.93Å; V51-I55 WeakPolarHBondContact O-CG1 3.37Å; V51-I55 PolarHBondContact O-N 3.37Å
52	L	92.5	Very high	88.9	Confident	100 Å²	100	111.4 Å²	111.4	52%	0.524	55%	0.545	S	S	.	.	H	α-helix	trans	-61.5	-41.1	177.9	-76	172.1	0	0	0	112	L48 V54 I55 I56	L48-L52 WeakPolarHBondContact O-CB 3.39Å; L48-L52 WeakPolarHBondContact O-CG 3.22Å; L48-L52 PolarHBondContact O-N 2.9Å; L52-V54 PolarHBondContact O-N 3.16Å; L52-I55 PolarHBondContact O-N 3.46Å; L52-I56 WeakPolarHBondContact O-CB 3.21Å; L52-I56 WeakPolarHBondContact O-CD1 3.44Å; L52-I56 VanDerWaalsContact O-CG1 3.28Å; L52-I56 WeakPolarHBondContact O-CG1 3.37Å; L52-I56 PolarHBondContact O-N 3.41Å
53	K	92.9	Very high	89	Confident	115 Å²	115	111.9 Å²	111.9	50%	0.5	55%	0.546	S	S	.	.	H	α-helix	trans	-59.5	-46.7	176.2	-175.5	-178.1	176.5	-171.2	0	111.4	S49 E50 V51 I55 I56 D57	S49-K53 WeakPolarHBondContact O-CB 3.37Å; S49-K53 PolarHBondContact O-N 3.36Å; E50-K53 WeakPolarHBondContact O-CB 3.41Å; E50-K53 PolarHBondContact O-N 3.1Å; V51-K53 VanDerWaalsContact C-N 3.32Å; V51-K53 PolarHBondContact O-N 3.13Å; K53-I55 VanDerWaalsContact C-N 3.34Å; K53-I55 PolarHBondContact O-N 2.61Å; K53-I56 PolarHBondContact O-N 3.34Å; K53-D57 WeakPolarHBondContact O-CB 3.18Å; K53-D57 VanDerWaalsContact O-CG 3.25Å; K53-D57 PolarHBondContact O-N 3.13Å
54	V	91	Very high	89	Confident	81 Å²	81	110.1 Å²	110.1	49%	0.491	54%	0.541	S	S	.	.	H	α-helix	trans	-61.4	-41.6	176.8	172.9	0	0	0	0	111.5	E50 V51 L52 N58	E50-V54 WeakPolarHBondContact O-CG2 3.34Å; E50-V54 PolarHBondContact O-N 2.99Å; V51-V54 PolarHBondContact O-N 3.37Å; L52-V54 PolarHBondContact O-N 3.16Å; V54-N58 WeakPolarHBondContact CG1-ND2 3.11Å; V54-N58 WeakPolarHBondContact O-CB 3.35Å; V54-N58 PolarHBondContact O-N 2.73Å; V54-N58 VanDerWaalsContact O-N 3.11Å; V54-N58 PolarHBondContact O-ND2 3.07Å
55	I	91.4	Very high	88.9	Confident	82 Å²	82	110.6 Å²	110.6	42%	0.421	55%	0.547	S	S	.	.	H	α-helix	trans	-62.3	-50.6	177.4	-67.4	166.6	0	0	0	110.4	V51 L52 K53 D57 N58 E59	V51-I55 HydrophobicContact CG1-CD1 3.93Å; V51-I55 WeakPolarHBondContact O-CG1 3.37Å; V51-I55 PolarHBondContact O-N 3.37Å; L52-I55 PolarHBondContact O-N 3.46Å; K53-I55 VanDerWaalsContact C-N 3.34Å; K53-I55 PolarHBondContact O-N 2.61Å; I55-D57 VanDerWaalsContact C-N 3.32Å; I55-D57 PolarHBondContact O-N 3.49Å; I55-N58 PolarHBondContact O-N 3.28Å; I55-N58 VanDerWaalsContact O-N 3.15Å; I55-E59 PolarHBondContact O-N 3.35Å; I55-E59 VanDerWaalsContact O-N 3.13Å
56	I	91.4	Very high	88.8	Confident	86 Å²	86	109.1 Å²	109.1	44%	0.441	54%	0.542	S	S	.	.	H	α-helix	trans	-61.7	-39.8	-179.5	-68.4	163.2	0	0	0	111.8	L52 K53 N58 E59	L52-I56 WeakPolarHBondContact O-CB 3.21Å; L52-I56 WeakPolarHBondContact O-CD1 3.44Å; L52-I56 VanDerWaalsContact O-CG1 3.28Å; L52-I56 WeakPolarHBondContact O-CG1 3.37Å; L52-I56 PolarHBondContact O-N 3.41Å; K53-I56 PolarHBondContact O-N 3.34Å; I56-N58 VanDerWaalsContact C-N 3.29Å; I56-N58 PolarHBondContact O-N 3.09Å; I56-E59 PolarHBondContact O-N 3.29Å
57	D	90.7	Very high	88.6	Confident	89 Å²	89	106.9 Å²	106.9	48%	0.476	54%	0.537	S	S	.	.	H	α-helix	trans	-71.3	-24.1	179.5	-72.1	-18	0	0	0	112.3	K53 I55	K53-D57 WeakPolarHBondContact O-CB 3.18Å; K53-D57 VanDerWaalsContact O-CG 3.25Å; K53-D57 PolarHBondContact O-N 3.13Å; I55-D57 VanDerWaalsContact C-N 3.32Å; I55-D57 PolarHBondContact O-N 3.49Å
58	N	85.7	Confident	88.5	Confident	127 Å²	127	105.7 Å²	105.7	68%	0.679	54%	0.537	S	S	*	.	H	α-helix	trans	-88	-13.4	174.6	-76.7	-64.2	0	0	0	113.9	V54 I55 I56	V54-N58 WeakPolarHBondContact CG1-ND2 3.11Å; V54-N58 WeakPolarHBondContact O-CB 3.35Å; V54-N58 PolarHBondContact O-N 2.73Å; V54-N58 VanDerWaalsContact O-N 3.11Å; V54-N58 PolarHBondContact O-ND2 3.07Å; I55-N58 PolarHBondContact O-N 3.28Å; I55-N58 VanDerWaalsContact O-N 3.15Å; I56-N58 VanDerWaalsContact C-N 3.29Å; I56-N58 PolarHBondContact O-N 3.09Å
59	E	81.1	Confident	88.1	Confident	159 Å²	159	105.8 Å²	105.8	74%	0.743	54%	0.537	S	S	*	.			trans	-87.3	-8.1	175.5	-74.6	-176.4	171	0	0	113.4	I55 I56	I55-E59 PolarHBondContact O-N 3.35Å; I55-E59 VanDerWaalsContact O-N 3.13Å; I56-E59 PolarHBondContact O-N 3.29Å
60	K	65.2	Low	87.7	Confident	216 Å²	216	109.8 Å²	109.8	94%	0.939	55%	0.546	S	S	*	.			trans	-96.8	0	176.1	-71.2	179.5	-179	170.8	0	112.1

Retrieved 60 of 60 residues in 48.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).