A0A5K4F6Y1_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession A0A5K4F6Y1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 96 aa.

						>A0A5K4F6Y1_SCHMA|A0A5K4F6Y1
MKMNFIYTSLLLFLSITSLSIISVVIAEFSNLYIPIEFNENNQMYLQVKQLKFVLDKEDQLTVKDGDCVTTVDLAAPNAKEIKANRTYRQIMYIMV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.3	Low	82.1	Confident	213 Å²	213	125.1 Å²	125.1	100%	1.049	62%	0.617	S	S	*	*				0	-46.1	0	-155.3	163.9	168.3	0	0	113.4	M3 N4 F5	M1-M3 PolarHBondContact O-N 3.15Å; M1-N4 PolarHBondContact O-N 2.9Å; M1-F5 PolarHBondContact O-N 3.06Å
2	K	72.5	Confident	82.7	Confident	180 Å²	180	123.4 Å²	123.4	78%	0.783	61%	0.611	S	S	*	*	H	α-helix	trans	-56.3	-42.4	176.8	-74.7	-176.5	177.1	179.9	0	114.6	F5 I6	K2-F5 PolarHBondContact O-N 2.98Å; K2-I6 WeakPolarHBondContact O-CG1 3.31Å; K2-I6 PolarHBondContact O-N 3.15Å
3	M	75.6	Confident	83.3	Confident	126 Å²	126	124.2 Å²	124.2	62%	0.621	61%	0.609	S	S	*	*	H	α-helix	trans	-63.9	-44	-178.7	-166.7	168.1	78.1	0	0	112.4	M1 F5 I6 Y7	M1-M3 PolarHBondContact O-N 3.15Å; M3-F5 VanDerWaalsContact C-N 3.3Å; M3-F5 PolarHBondContact O-N 3.35Å; M3-I6 PolarHBondContact O-N 2.99Å; M3-Y7 HydrophobicContact CE-CE2 4.5Å; M3-Y7 HydrophobicContact CG-CD2 3.86Å; M3-Y7 HydrophobicContact CG-CE2 3.55Å; M3-Y7 WeakPolarHBondContact O-CD2 3.31Å; M3-Y7 PolarHBondContact O-N 3.44Å; M3-Y7 HydrophobicContact SD-CE2 4.2Å
4	N	81.2	Confident	83.6	Confident	110 Å²	110	122.4 Å²	122.4	59%	0.588	60%	0.603	S	S	*	*	H	α-helix	trans	-61.6	-38.6	175.2	-69.7	3.4	0	0	0	112	M1 Y7 T8	M1-N4 PolarHBondContact O-N 2.9Å; N4-Y7 PolarHBondContact O-N 3.04Å; N4-T8 WeakPolarHBondContact O-CG2 3.46Å; N4-T8 PolarHBondContact O-N 3.13Å; N4-T8 PolarHBondContact O-OG1 3.39Å
5	F	83.1	Confident	83.8	Confident	150 Å²	150	118.4 Å²	118.4	66%	0.658	59%	0.592	S	S	*	*	H	α-helix	trans	-64.6	-40.8	177.3	-173.5	-98.8	0	0	0	112.5	M1 K2 M3 T8 S9	M1-F5 PolarHBondContact O-N 3.06Å; K2-F5 PolarHBondContact O-N 2.98Å; M3-F5 VanDerWaalsContact C-N 3.3Å; M3-F5 PolarHBondContact O-N 3.35Å; F5-T8 WeakPolarHBondContact CA-OG1 3.46Å; F5-T8 PolarHBondContact O-N 2.79Å; F5-T8 PolarHBondContact O-OG1 3.18Å; F5-S9 VanDerWaalsContact O-CB 3.27Å; F5-S9 WeakPolarHBondContact O-CB 3.42Å; F5-S9 PolarHBondContact O-N 3.18Å
6	I	86.3	Confident	83.9	Confident	113 Å²	113	117.2 Å²	117.2	58%	0.579	59%	0.586	S	S	*	*	H	α-helix	trans	-63.7	-45.2	175.4	-64.5	165.4	0	0	0	110.2	K2 M3 S9 L10	K2-I6 WeakPolarHBondContact O-CG1 3.31Å; K2-I6 PolarHBondContact O-N 3.15Å; M3-I6 PolarHBondContact O-N 2.99Å; I6-S9 PolarHBondContact O-N 3.4Å; I6-L10 WeakPolarHBondContact O-CB 3.37Å; I6-L10 PolarHBondContact O-N 3.11Å
7	Y	87.2	Confident	83.8	Confident	139 Å²	139	114.1 Å²	114.1	55%	0.545	58%	0.575	S	S	.	*	H	α-helix	trans	-62.6	-44.8	177.3	-82	-68.7	0	0	0	112.7	M3 N4 S9 L10 L11	M3-Y7 HydrophobicContact CE-CE2 4.5Å; M3-Y7 HydrophobicContact CG-CD2 3.86Å; M3-Y7 HydrophobicContact CG-CE2 3.55Å; M3-Y7 WeakPolarHBondContact O-CD2 3.31Å; M3-Y7 PolarHBondContact O-N 3.44Å; M3-Y7 HydrophobicContact SD-CE2 4.2Å; N4-Y7 PolarHBondContact O-N 3.04Å; Y7-S9 VanDerWaalsContact C-N 3.34Å; Y7-S9 PolarHBondContact O-N 2.91Å; Y7-L10 PolarHBondContact O-N 3.44Å; Y7-L11 WeakPolarHBondContact O-CB 3.35Å; Y7-L11 PolarHBondContact O-N 3.46Å
8	T	87.5	Confident	83.6	Confident	82 Å²	82	110.7 Å²	110.7	50%	0.503	56%	0.564	S	S	.	*	H	α-helix	trans	-64.8	-39.7	177.2	49.2	0	0	0	0	111.9	N4 F5 L12	N4-T8 WeakPolarHBondContact O-CG2 3.46Å; N4-T8 PolarHBondContact O-N 3.13Å; N4-T8 PolarHBondContact O-OG1 3.39Å; F5-T8 WeakPolarHBondContact CA-OG1 3.46Å; F5-T8 PolarHBondContact O-N 2.79Å; F5-T8 PolarHBondContact O-OG1 3.18Å; T8-L12 VanDerWaalsContact O-CB 3.29Å; T8-L12 WeakPolarHBondContact O-CB 3.15Å; T8-L12 PolarHBondContact O-N 2.55Å
9	S	88	Confident	83.4	Confident	46 Å²	46	110.9 Å²	110.9	32%	0.322	57%	0.566	S	S	.	*	H	α-helix	trans	-64.1	-45.7	176.3	-174.3	0	0	0	0	110.9	F5 I6 Y7 L12 F13	F5-S9 VanDerWaalsContact O-CB 3.27Å; F5-S9 WeakPolarHBondContact O-CB 3.42Å; F5-S9 PolarHBondContact O-N 3.18Å; I6-S9 PolarHBondContact O-N 3.4Å; Y7-S9 VanDerWaalsContact C-N 3.34Å; Y7-S9 PolarHBondContact O-N 2.91Å; S9-L12 PolarHBondContact O-N 3.16Å; S9-F13 WeakPolarHBondContact O-CD2 3.46Å; S9-F13 PolarHBondContact O-N 3.39Å
10	L	90.5	Very high	83	Confident	98 Å²	98	108.5 Å²	108.5	51%	0.513	56%	0.559	S	S	.	*	H	α-helix	trans	-62.3	-45	178	-174.5	68.7	0	0	0	112.3	I6 Y7 L12 F13 L14	I6-L10 WeakPolarHBondContact O-CB 3.37Å; I6-L10 PolarHBondContact O-N 3.11Å; Y7-L10 PolarHBondContact O-N 3.44Å; L10-L12 VanDerWaalsContact C-N 3.29Å; L10-L12 PolarHBondContact O-N 2.67Å; L10-F13 PolarHBondContact O-N 3.44Å; L10-L14 HydrophobicContact CG-CD1 4.23Å; L10-L14 WeakPolarHBondContact O-CG 3.11Å; L10-L14 PolarHBondContact O-N 3.22Å
11	L	89.3	Confident	82.7	Confident	119 Å²	119	108.4 Å²	108.4	62%	0.623	56%	0.559	S	S	*	*	H	α-helix	trans	-59.6	-40.9	175.3	-90.2	158.8	0	0	0	111.9	Y7 L14 S15	Y7-L11 WeakPolarHBondContact O-CB 3.35Å; Y7-L11 PolarHBondContact O-N 3.46Å; L11-L14 PolarHBondContact O-N 2.95Å; L11-S15 PolarHBondContact O-N 2.99Å; L11-S15 PolarHBondContact O-OG 2.78Å
12	L	89.3	Confident	83	Confident	105 Å²	105	102.7 Å²	102.7	55%	0.55	53%	0.532	S	S	.	.	H	α-helix	trans	-71.3	-35.3	179.6	-159.6	138.8	0	0	0	111.7	T8 S9 L10 S15 I16	T8-L12 VanDerWaalsContact O-CB 3.29Å; T8-L12 WeakPolarHBondContact O-CB 3.15Å; T8-L12 PolarHBondContact O-N 2.55Å; S9-L12 PolarHBondContact O-N 3.16Å; L10-L12 VanDerWaalsContact C-N 3.29Å; L10-L12 PolarHBondContact O-N 2.67Å; L12-S15 WeakPolarHBondContact CA-OG 3.34Å; L12-S15 PolarHBondContact O-OG 3.41Å; L12-I16 HydrophobicContact CD2-CD1 3.59Å; L12-I16 HydrophobicContact CD2-CG1 4.48Å; L12-I16 WeakPolarHBondContact O-CD1 3.39Å; L12-I16 VanDerWaalsContact O-CG1 3.22Å; L12-I16 WeakPolarHBondContact O-CG1 3.22Å; L12-I16 PolarHBondContact O-N 3.18Å; L12-I16 VanDerWaalsContact O-N 3.09Å
13	F	89.7	Confident	82.8	Confident	133 Å²	133	97.2 Å²	97.2	58%	0.583	52%	0.516	S	S	*	.	H	α-helix	trans	-64.4	-45	170.7	-96	-80.4	0	0	0	112.1	S9 L10 S15 I16 T17	S9-F13 WeakPolarHBondContact O-CD2 3.46Å; S9-F13 PolarHBondContact O-N 3.39Å; L10-F13 PolarHBondContact O-N 3.44Å; F13-S15 VanDerWaalsContact C-N 3.34Å; F13-S15 PolarHBondContact O-N 3.36Å; F13-I16 PolarHBondContact O-N 3.02Å; F13-T17 WeakPolarHBondContact O-CG2 3.47Å; F13-T17 PolarHBondContact O-N 3.09Å; F13-T17 PolarHBondContact O-OG1 2.92Å
14	L	88.4	Confident	82.6	Confident	100 Å²	100	95 Å²	95	52%	0.524	51%	0.51	S	S	.	.	H	α-helix	trans	-64.6	-35.5	178.1	-72.9	167.7	0	0	0	112.7	L10 L11 T17 S18	L10-L14 HydrophobicContact CG-CD1 4.23Å; L10-L14 WeakPolarHBondContact O-CG 3.11Å; L10-L14 PolarHBondContact O-N 3.22Å; L11-L14 PolarHBondContact O-N 2.95Å; L14-T17 WeakPolarHBondContact CA-OG1 3.29Å; L14-T17 PolarHBondContact O-OG1 3.37Å; L14-S18 WeakPolarHBondContact O-CB 3.31Å; L14-S18 PolarHBondContact O-N 2.97Å; L14-S18 PolarHBondContact O-OG 3.01Å
15	S	86.5	Confident	81.7	Confident	62 Å²	62	92.8 Å²	92.8	43%	0.434	50%	0.5	S	S	.	.	H	α-helix	trans	-70.5	-38.7	175.8	66	0	0	0	0	111.9	L11 L12 F13 S18 L19	L11-S15 PolarHBondContact O-N 2.99Å; L11-S15 PolarHBondContact O-OG 2.78Å; L12-S15 WeakPolarHBondContact CA-OG 3.34Å; L12-S15 PolarHBondContact O-OG 3.41Å; F13-S15 VanDerWaalsContact C-N 3.34Å; F13-S15 PolarHBondContact O-N 3.36Å; S15-S18 WeakPolarHBondContact CA-OG 3.35Å; S15-S18 PolarHBondContact O-OG 3.47Å; S15-L19 WeakPolarHBondContact O-CB 3.41Å; S15-L19 PolarHBondContact O-N 2.99Å
16	I	84.9	Confident	80.7	Confident	99 Å²	99	91.1 Å²	91.1	51%	0.508	50%	0.496	S	S	.	.	H	α-helix	trans	-66.3	-44.7	175.7	-68.5	168.5	0	0	0	111	L12 F13 L19 S20	L12-I16 HydrophobicContact CD2-CD1 3.59Å; L12-I16 HydrophobicContact CD2-CG1 4.48Å; L12-I16 WeakPolarHBondContact O-CD1 3.39Å; L12-I16 VanDerWaalsContact O-CG1 3.22Å; L12-I16 WeakPolarHBondContact O-CG1 3.22Å; L12-I16 PolarHBondContact O-N 3.18Å; L12-I16 VanDerWaalsContact O-N 3.09Å; F13-I16 PolarHBondContact O-N 3.02Å; I16-L19 PolarHBondContact O-N 3.38Å; I16-S20 PolarHBondContact O-N 2.86Å; I16-S20 PolarHBondContact O-OG 2.83Å
17	T	82.8	Confident	79.5	Confident	64 Å²	64	88.6 Å²	88.6	39%	0.393	49%	0.493	S	S	.	.	H	α-helix	trans	-68.3	-37.6	179.9	55.3	0	0	0	0	112.3	F13 L14 S20 I21	F13-T17 WeakPolarHBondContact O-CG2 3.47Å; F13-T17 PolarHBondContact O-N 3.09Å; F13-T17 PolarHBondContact O-OG1 2.92Å; L14-T17 WeakPolarHBondContact CA-OG1 3.29Å; L14-T17 PolarHBondContact O-OG1 3.37Å; T17-S20 PolarHBondContact O-N 2.86Å; T17-S20 PolarHBondContact O-OG 3.26Å; T17-I21 WeakPolarHBondContact O-CD1 3.48Å; T17-I21 WeakPolarHBondContact O-CG1 3.38Å; T17-I21 PolarHBondContact O-N 3.33Å
18	S	79.1	Confident	78.1	Confident	53 Å²	53	89.2 Å²	89.2	37%	0.371	50%	0.5	S	S	.	.	H	α-helix	trans	-65.8	-41.5	174.2	52.6	0	0	0	0	112.1	L14 S15 S20 I21 I22	L14-S18 WeakPolarHBondContact O-CB 3.31Å; L14-S18 PolarHBondContact O-N 2.97Å; L14-S18 PolarHBondContact O-OG 3.01Å; S15-S18 WeakPolarHBondContact CA-OG 3.35Å; S15-S18 PolarHBondContact O-OG 3.47Å; S18-S20 PolarHBondContact O-N 3.42Å; S18-I21 PolarHBondContact O-N 3.31Å; S18-I22 WeakPolarHBondContact O-CD1 3.47Å; S18-I22 VanDerWaalsContact O-CG1 3.24Å; S18-I22 WeakPolarHBondContact O-CG1 3.24Å; S18-I22 PolarHBondContact O-N 2.88Å
19	L	80.9	Confident	76.7	Confident	115 Å²	115	92.4 Å²	92.4	60%	0.602	51%	0.507	S	S	*	.	H	α-helix	trans	-64	-39	176.7	-173.2	64.3	0	0	0	112.3	S15 I16 S23	S15-L19 WeakPolarHBondContact O-CB 3.41Å; S15-L19 PolarHBondContact O-N 2.99Å; I16-L19 PolarHBondContact O-N 3.38Å; L19-S23 WeakPolarHBondContact O-CB 3.34Å; L19-S23 PolarHBondContact O-N 2.95Å; L19-S23 PolarHBondContact O-OG 3.33Å
20	S	75.6	Confident	75.2	Confident	63 Å²	63	94.1 Å²	94.1	44%	0.441	52%	0.52	S	S	.	.	H	α-helix	trans	-69	-41.3	177.2	66	0	0	0	0	112.2	I16 T17 S18 S23 V24	I16-S20 PolarHBondContact O-N 2.86Å; I16-S20 PolarHBondContact O-OG 2.83Å; T17-S20 PolarHBondContact O-N 2.86Å; T17-S20 PolarHBondContact O-OG 3.26Å; S18-S20 PolarHBondContact O-N 3.42Å; S20-S23 PolarHBondContact O-N 3.38Å; S20-V24 WeakPolarHBondContact O-CG2 3.48Å; S20-V24 PolarHBondContact O-N 3.17Å
21	I	75.3	Confident	73.6	Confident	106 Å²	106	94.4 Å²	94.4	54%	0.544	52%	0.522	S	S	.	.	H	α-helix	trans	-61.5	-46.4	174.9	-66.5	163.4	0	0	0	110.4	T17 S18 S23 V24 V25	T17-I21 WeakPolarHBondContact O-CD1 3.48Å; T17-I21 WeakPolarHBondContact O-CG1 3.38Å; T17-I21 PolarHBondContact O-N 3.33Å; S18-I21 PolarHBondContact O-N 3.31Å; I21-S23 VanDerWaalsContact C-N 3.28Å; I21-S23 PolarHBondContact O-N 2.83Å; I21-V24 PolarHBondContact O-N 3.29Å; I21-V25 HydrophobicContact CG2-CG2 4.31Å; I21-V25 WeakPolarHBondContact O-CB 3.49Å; I21-V25 VanDerWaalsContact O-CG2 3.22Å; I21-V25 WeakPolarHBondContact O-CG2 3.34Å; I21-V25 PolarHBondContact O-N 3.05Å
22	I	70	Confident	72.2	Confident	94 Å²	94	95.3 Å²	95.3	48%	0.482	53%	0.526	S	S	.	.	H	α-helix	trans	-58.3	-42.7	176.8	-69.8	164.7	0	0	0	110.8	S18 V25 I26	S18-I22 WeakPolarHBondContact O-CD1 3.47Å; S18-I22 VanDerWaalsContact O-CG1 3.24Å; S18-I22 WeakPolarHBondContact O-CG1 3.24Å; S18-I22 PolarHBondContact O-N 2.88Å; I22-V25 PolarHBondContact O-N 3.26Å; I22-I26 HydrophobicContact CG2-CD1 3.59Å; I22-I26 HydrophobicContact CG2-CG1 4.32Å; I22-I26 VanDerWaalsContact O-CG1 3.26Å; I22-I26 WeakPolarHBondContact O-CG1 3.21Å; I22-I26 PolarHBondContact O-N 2.9Å
23	S	68.4	Low	71	Confident	65 Å²	65	99.5 Å²	99.5	46%	0.455	54%	0.536	S	S	.	.	H	α-helix	trans	-65	-42.6	-179.4	-57.9	0	0	0	0	112.5	L19 S20 I21 A27	L19-S23 WeakPolarHBondContact O-CB 3.34Å; L19-S23 PolarHBondContact O-N 2.95Å; L19-S23 PolarHBondContact O-OG 3.33Å; S20-S23 PolarHBondContact O-N 3.38Å; I21-S23 VanDerWaalsContact C-N 3.28Å; I21-S23 PolarHBondContact O-N 2.83Å; S23-A27 WeakPolarHBondContact O-CB 3.38Å; S23-A27 PolarHBondContact O-N 3.48Å
24	V	69.9	Low	69.9	Low	80 Å²	80	97.3 Å²	97.3	49%	0.485	53%	0.53	S	S	.	.	H	α-helix	trans	-63.6	-45.3	176.1	172.9	0	0	0	0	110.6	S20 I21 I26 A27 E28	S20-V24 WeakPolarHBondContact O-CG2 3.48Å; S20-V24 PolarHBondContact O-N 3.17Å; I21-V24 PolarHBondContact O-N 3.29Å; V24-I26 PolarHBondContact O-N 3.37Å; V24-A27 PolarHBondContact O-N 3.39Å; V24-E28 PolarHBondContact O-N 2.97Å
25	V	64.1	Low	69.2	Low	63 Å²	63	97 Å²	97	38%	0.382	53%	0.533	S	S	.	.	H	α-helix	trans	-61.3	-46.4	179	173.7	0	0	0	0	111.1	I21 I22 A27 E28 F29	I21-V25 HydrophobicContact CG2-CG2 4.31Å; I21-V25 WeakPolarHBondContact O-CB 3.49Å; I21-V25 VanDerWaalsContact O-CG2 3.22Å; I21-V25 WeakPolarHBondContact O-CG2 3.34Å; I21-V25 PolarHBondContact O-N 3.05Å; I22-V25 PolarHBondContact O-N 3.26Å; V25-A27 VanDerWaalsContact C-N 3.33Å; V25-A27 PolarHBondContact O-N 3.35Å; V25-E28 PolarHBondContact O-N 3.4Å; V25-F29 HydrophobicContact CG1-CD2 3.81Å; V25-F29 HydrophobicContact CG1-CE2 3.44Å; V25-F29 VanDerWaalsContact CG1-CE2 3.44Å; V25-F29 WeakPolarHBondContact O-CD2 3.4Å; V25-F29 PolarHBondContact O-N 3.47Å
26	I	61.5	Low	68.9	Low	114 Å²	114	99 Å²	99	59%	0.585	54%	0.538	S	S	*	.	H	α-helix	trans	-62.7	-40.2	176.9	-66.7	167.7	0	0	0	111.2	I22 V24 F29 S30	I22-I26 HydrophobicContact CG2-CD1 3.59Å; I22-I26 HydrophobicContact CG2-CG1 4.32Å; I22-I26 VanDerWaalsContact O-CG1 3.26Å; I22-I26 WeakPolarHBondContact O-CG1 3.21Å; I22-I26 PolarHBondContact O-N 2.9Å; V24-I26 PolarHBondContact O-N 3.37Å; I26-F29 PolarHBondContact O-N 2.94Å; I26-S30 PolarHBondContact O-N 3.03Å
27	A	61.1	Low	68.9	Low	61 Å²	61	98.7 Å²	98.7	50%	0.504	54%	0.535	S	S	.	.	H	α-helix	trans	-64.5	-41.6	179	0	0	0	0	0	112.1	S23 V24 V25 F29 S30	S23-A27 WeakPolarHBondContact O-CB 3.38Å; S23-A27 PolarHBondContact O-N 3.48Å; V24-A27 PolarHBondContact O-N 3.39Å; V25-A27 VanDerWaalsContact C-N 3.33Å; V25-A27 PolarHBondContact O-N 3.35Å; A27-F29 VanDerWaalsContact C-N 3.3Å; A27-F29 PolarHBondContact O-N 3.25Å; A27-S30 WeakPolarHBondContact O-CB 3.45Å; A27-S30 PolarHBondContact O-N 3.39Å; A27-S30 PolarHBondContact O-OG 2.82Å
28	E	56.5	Low	69	Low	151 Å²	151	101.8 Å²	101.8	71%	0.706	54%	0.543	S	S	*	.	H	α-helix	trans	-65.3	-32.5	177.5	-73.8	-177.2	177.3	0	0	112.6	V24 V25 S30	V24-E28 PolarHBondContact O-N 2.97Å; V25-E28 PolarHBondContact O-N 3.4Å; E28-S30 VanDerWaalsContact C-N 3.29Å; E28-S30 PolarHBondContact O-N 2.99Å
29	F	58.4	Low	69.3	Low	149 Å²	149	101.2 Å²	101.2	65%	0.654	54%	0.536	S	S	*	.	G	3₁₀ helix	trans	-77.1	-8.4	175.7	-73	-62.6	0	0	0	114.7	V25 I26 A27 N31	V25-F29 HydrophobicContact CG1-CD2 3.81Å; V25-F29 HydrophobicContact CG1-CE2 3.44Å; V25-F29 VanDerWaalsContact CG1-CE2 3.44Å; V25-F29 WeakPolarHBondContact O-CD2 3.4Å; V25-F29 PolarHBondContact O-N 3.47Å; I26-F29 PolarHBondContact O-N 2.94Å; A27-F29 VanDerWaalsContact C-N 3.3Å; A27-F29 PolarHBondContact O-N 3.25Å; F29-N31 PolarHBondContact O-N 3.32Å; F29-N31 VanDerWaalsContact O-N 3.16Å
30	S	57.1	Low	69.6	Low	83 Å²	83	105 Å²	105	58%	0.58	55%	0.551	S	S	*	*	G	3₁₀ helix	trans	-65.9	-20.1	-173.5	64.2	0	0	0	0	114.2	I26 A27 E28	I26-S30 PolarHBondContact O-N 3.03Å; A27-S30 WeakPolarHBondContact O-CB 3.45Å; A27-S30 PolarHBondContact O-N 3.39Å; A27-S30 PolarHBondContact O-OG 2.82Å; E28-S30 VanDerWaalsContact C-N 3.29Å; E28-S30 PolarHBondContact O-N 2.99Å
31	N	56.6	Low	70.2	Confident	104 Å²	104	107.9 Å²	107.9	56%	0.556	56%	0.561	S	S	*	*	G	3₁₀ helix	trans	-127.2	70.5	177.1	-57.8	-63.5	0	0	0	111.1	F29 Y33	F29-N31 PolarHBondContact O-N 3.32Å; F29-N31 VanDerWaalsContact O-N 3.16Å; N31-Y33 VanDerWaalsContact C-N 3.33Å; N31-Y33 HydrophobicContact CB-CD2 4.05Å; N31-Y33 HydrophobicContact CB-CE2 3.47Å; N31-Y33 VanDerWaalsContact CB-CE2 3.47Å; N31-Y33 VanDerWaalsContact O-CD2 3.31Å; N31-Y33 WeakPolarHBondContact O-CD2 3.02Å; N31-Y33 PolarHBondContact O-N 2.97Å
32	L	59.2	Low	70.5	Confident	137 Å²	137	109.2 Å²	109.2	72%	0.717	57%	0.569	S	S	*	*			trans	-70.5	93.3	165.8	-174.6	71.9	0	0	0	108.9	I34	L32-I34 HydrophobicContact CD2-CD1 4.24Å; L32-I34 HydrophobicContact CD2-CG1 4.12Å; L32-I34 HydrophobicContact CG-CG1 4.08Å; L32-I34 PolarHBondContact O-N 3.41Å
33	Y	64.9	Low	71.2	Confident	194 Å²	194	107 Å²	107	76%	0.761	56%	0.557	S	S	*	*			trans	-76.7	113	168.3	-66	-82.6	0	0	0	108.7	N31	N31-Y33 VanDerWaalsContact C-N 3.33Å; N31-Y33 HydrophobicContact CB-CD2 4.05Å; N31-Y33 HydrophobicContact CB-CE2 3.47Å; N31-Y33 VanDerWaalsContact CB-CE2 3.47Å; N31-Y33 VanDerWaalsContact O-CD2 3.31Å; N31-Y33 WeakPolarHBondContact O-CD2 3.02Å; N31-Y33 PolarHBondContact O-N 2.97Å
34	I	65.8	Low	71.9	Confident	87 Å²	87	107.7 Å²	107.7	45%	0.446	55%	0.553	S	S	.	*	P	Polyproline II helix	trans	-92.9	128.8	173.1	-50.9	179.7	0	0	0	107.1	L32 I36 L46	L32-I34 HydrophobicContact CD2-CD1 4.24Å; L32-I34 HydrophobicContact CD2-CG1 4.12Å; L32-I34 HydrophobicContact CG-CG1 4.08Å; L32-I34 PolarHBondContact O-N 3.41Å; I34-I36 PolarHBondContact O-N 3.46Å; I34-L46 HydrophobicContact CB-CD1 4.49Å; I34-L46 HydrophobicContact CG2-CD1 3.23Å; I34-L46 HydrophobicContact CG2-CD2 4.09Å; I34-L46 HydrophobicContact CG2-CG 4.3Å
35	P	74.6	Confident	72.6	Confident	92 Å²	92	106.2 Å²	106.2	60%	0.597	54%	0.54	S	S	*	.	P	Polyproline II helix	trans	-61.2	125.5	178	25.2	-33.2	0	0	0	110	L46	P35-L46 WeakPolarHBondContact O-CD1 3.49Å
36	I	79.3	Confident	73.5	Confident	104 Å²	104	105.1 Å²	105.1	53%	0.533	53%	0.532	S	S	.	.	P	Polyproline II helix	trans	-102.9	126.8	168.9	-59.9	175.6	0	0	0	106.5	I34 M44	I34-I36 PolarHBondContact O-N 3.46Å; I36-M44 HydrophobicContact CG2-CB 3.98Å; I36-M44 HydrophobicContact CG2-CG 4.01Å; I36-M44 HydrophobicContact CG2-SD 4.27Å
37	E	85.7	Confident	74.3	Confident	93 Å²	93	104.1 Å²	104.1	44%	0.435	52%	0.524	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	159.6	178.4	-67.8	174.4	-139.7	0	0	110	M44 Y45	E37-M44 CarbonylContact O-C 3.52Å; E37-M44 WeakPolarHBondContact O-CA 3.43Å; E37-Y45 HydrophobicContact CB-CD1 4.03Å; E37-Y45 HydrophobicContact CB-CD2 4.12Å; E37-Y45 HydrophobicContact CB-CE1 3.51Å; E37-Y45 HydrophobicContact CB-CE2 3.56Å; E37-Y45 HydrophobicContact CB-CG 4.33Å; E37-Y45 WeakPolarHBondContact CB-OH 3.42Å; E37-Y45 HydrophobicContact CG-CE2 4.25Å; E37-Y45 PolarHBondContact N-O 3.02Å; E37-Y45 WeakPolarHBondContact O-CD1 3.26Å; E37-Y45 PolarHBondContact O-N 2.91Å; E37-Y45 WeakPolarHBondContact OE2-CE2 3.35Å; E37-Y45 PolarHBondContact OE2-OH 3.5Å
38	F	85.1	Confident	75.1	Confident	130 Å²	130	104.2 Å²	104.2	57%	0.57	52%	0.519	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-117.8	133.4	177.4	-67.9	-98	0	0	0	109	Q43 M44	F38-Q43 WeakPolarHBondContact CA-O 3.49Å; F38-M44 HydrophobicContact CD1-CG 3.99Å; F38-M44 HydrophobicContact CE1-CG 3.38Å; F38-M44 HydrophobicContact CE1-SD 4.33Å; F38-M44 HydrophobicContact CZ-CG 3.74Å; F38-M44 HydrophobicContact CZ-SD 4.31Å
39	N	84.6	Confident	76.2	Confident	40 Å²	40	106.4 Å²	106.4	21%	0.214	53%	0.526	C	S	.	.			trans	-86.3	179	174.8	73.7	9	0	0	0	111.7	N41 N42 Q43 Y45	N39-N41 PolarHBondContact O-N 3.41Å; N39-N41 WeakPolarHBondContact OD1-CA 3.47Å; N39-N41 WeakPolarHBondContact OD1-CB 3.24Å; N39-N41 PolarHBondContact OD1-N 3.03Å; N39-N42 WeakPolarHBondContact O-CA 3.4Å; N39-N42 PolarHBondContact O-N 2.94Å; N39-N42 PolarHBondContact OD1-N 3.43Å; N39-Q43 PolarHBondContact N-O 3.36Å; N39-Q43 PolarHBondContact ND2-OE1 2.93Å; N39-Q43 WeakPolarHBondContact OD1-CB 3.38Å; N39-Q43 PolarHBondContact OD1-N 3.5Å; N39-Y45 HydrophobicContact CB-CD1 4.03Å; N39-Y45 HydrophobicContact CB-CE1 4.04Å
40	E	88.5	Confident	77.2	Confident	196 Å²	196	106.8 Å²	106.8	92%	0.916	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59	-20.9	-179.8	-60.7	178.3	-179.6	0	0	113.8
41	N	88.4	Confident	78.4	Confident	122 Å²	122	105.8 Å²	105.8	65%	0.652	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.4	9.7	176.5	-62.1	-36.8	0	0	0	113.1	N39 Q43	N39-N41 PolarHBondContact O-N 3.41Å; N39-N41 WeakPolarHBondContact OD1-CA 3.47Å; N39-N41 WeakPolarHBondContact OD1-CB 3.24Å; N39-N41 PolarHBondContact OD1-N 3.03Å; N41-Q43 HydrophobicContact CB-CG 4.08Å; N41-Q43 PolarHBondContact O-N 3.24Å
42	N	82	Confident	79.8	Confident	134 Å²	134	104.4 Å²	104.4	72%	0.717	51%	0.506	S	S	*	.			trans	59.1	23.2	-171.6	-57.6	-51.9	0	0	0	114.5	N39	N39-N42 WeakPolarHBondContact O-CA 3.4Å; N39-N42 PolarHBondContact O-N 2.94Å; N39-N42 PolarHBondContact OD1-N 3.43Å
43	Q	83.3	Confident	81.1	Confident	49 Å²	49	100.8 Å²	100.8	23%	0.229	49%	0.485	C	S	.	.			trans	-80.4	135.9	173.3	-57	169.8	-56.1	0	0	109.1	F38 N39 N41 V54 D56	F38-Q43 WeakPolarHBondContact CA-O 3.49Å; N39-Q43 PolarHBondContact N-O 3.36Å; N39-Q43 PolarHBondContact ND2-OE1 2.93Å; N39-Q43 WeakPolarHBondContact OD1-CB 3.38Å; N39-Q43 PolarHBondContact OD1-N 3.5Å; N41-Q43 HydrophobicContact CB-CG 4.08Å; N41-Q43 PolarHBondContact O-N 3.24Å; Q43-V54 HydrophobicContact CB-CG1 3.87Å; Q43-D56 HydrophobicContact CG-CB 4.01Å
44	M	83	Confident	82.2	Confident	78 Å²	78	92.5 Å²	92.5	38%	0.384	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.4	131.8	173	-72.7	-176.7	-73.5	0	0	108.7	I36 E37 F38 V54 L55	I36-M44 HydrophobicContact CG2-CB 3.98Å; I36-M44 HydrophobicContact CG2-CG 4.01Å; I36-M44 HydrophobicContact CG2-SD 4.27Å; E37-M44 CarbonylContact O-C 3.52Å; E37-M44 WeakPolarHBondContact O-CA 3.43Å; F38-M44 HydrophobicContact CD1-CG 3.99Å; F38-M44 HydrophobicContact CE1-CG 3.38Å; F38-M44 HydrophobicContact CE1-SD 4.33Å; F38-M44 HydrophobicContact CZ-CG 3.74Å; F38-M44 HydrophobicContact CZ-SD 4.31Å; M44-V54 CarbonylContact O-C 3.52Å; M44-V54 WeakPolarHBondContact O-CA 3.18Å; M44-L55 HydrophobicContact CE-CD2 4.01Å; M44-L55 PolarHBondContact N-O 3.24Å; M44-L55 VanDerWaalsContact N-O 3.17Å; M44-L55 PolarHBondContact O-N 3.06Å
45	Y	85.3	Confident	83.4	Confident	49 Å²	49	90.9 Å²	90.9	19%	0.192	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	152.1	170.1	73.8	-89.8	0	0	0	112.4	E37 N39 F53	E37-Y45 HydrophobicContact CB-CD1 4.03Å; E37-Y45 HydrophobicContact CB-CD2 4.12Å; E37-Y45 HydrophobicContact CB-CE1 3.51Å; E37-Y45 HydrophobicContact CB-CE2 3.56Å; E37-Y45 HydrophobicContact CB-CG 4.33Å; E37-Y45 WeakPolarHBondContact CB-OH 3.42Å; E37-Y45 HydrophobicContact CG-CE2 4.25Å; E37-Y45 PolarHBondContact N-O 3.02Å; E37-Y45 WeakPolarHBondContact O-CD1 3.26Å; E37-Y45 PolarHBondContact O-N 2.91Å; E37-Y45 WeakPolarHBondContact OE2-CE2 3.35Å; E37-Y45 PolarHBondContact OE2-OH 3.5Å; N39-Y45 HydrophobicContact CB-CD1 4.03Å; N39-Y45 HydrophobicContact CB-CE1 4.04Å; Y45-F53 CarbonylContact C-O 3.55Å; Y45-F53 WeakPolarHBondContact CA-O 3.49Å; Y45-F53 VanDerWaalsContact CB-O 3.27Å; Y45-F53 WeakPolarHBondContact CB-O 3.37Å
46	L	82.9	Confident	84	Confident	41 Å²	41	87.9 Å²	87.9	22%	0.215	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	127.7	175.1	170	62.2	0	0	0	108.4	I34 P35 V48 F53	I34-L46 HydrophobicContact CB-CD1 4.49Å; I34-L46 HydrophobicContact CG2-CD1 3.23Å; I34-L46 HydrophobicContact CG2-CD2 4.09Å; I34-L46 HydrophobicContact CG2-CG 4.3Å; P35-L46 WeakPolarHBondContact O-CD1 3.49Å; L46-V48 HydrophobicContact CD1-CG2 4.04Å; L46-V48 HydrophobicContact CD2-CG2 3.86Å; L46-V48 HydrophobicContact CG-CG2 3.8Å; L46-F53 HydrophobicContact CB-CB 4.38Å; L46-F53 HydrophobicContact CG-CD2 4.5Å; L46-F53 PolarHBondContact N-O 3.38Å; L46-F53 PolarHBondContact O-N 3.4Å
47	Q	78.5	Confident	84.4	Confident	93 Å²	93	92 Å²	92	44%	0.435	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	116.5	172.3	-170.9	72.1	37.7	0	0	109.4	K49 L51 K52	Q47-K49 PolarHBondContact NE2-O 3.39Å; Q47-L51 PolarHBondContact NE2-O 3.25Å; Q47-K52 VanDerWaalsContact OE1-CB 3.23Å
48	V	77.1	Confident	84.6	Confident	63 Å²	63	93 Å²	93	38%	0.382	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	104.5	172.2	-175.2	0	0	0	0	108.6	L46 Q50 L51 F53	L46-V48 HydrophobicContact CD1-CG2 4.04Å; L46-V48 HydrophobicContact CD2-CG2 3.86Å; L46-V48 HydrophobicContact CG-CG2 3.8Å; V48-Q50 PolarHBondContact O-N 2.92Å; V48-Q50 VanDerWaalsContact O-N 3.16Å; V48-L51 PolarHBondContact N-O 3.24Å; V48-L51 WeakPolarHBondContact O-CB 3.47Å; V48-L51 PolarHBondContact O-N 3.38Å; V48-F53 HydrophobicContact CB-CE2 4.5Å; V48-F53 HydrophobicContact CG2-CE2 4.47Å
49	K	79.8	Confident	84.7	Confident	197 Å²	197	90.6 Å²	90.6	86%	0.857	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.3	-119	-175	-56.5	177.9	177.6	178.6	0	110.4	Q47	Q47-K49 PolarHBondContact NE2-O 3.39Å
50	Q	80.6	Confident	85	Confident	156 Å²	156	91.7 Å²	91.7	73%	0.729	44%	0.441	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.9	-8.7	-179.8	-65.4	175.2	-5.3	0	0	113.2	V48	V48-Q50 PolarHBondContact O-N 2.92Å; V48-Q50 VanDerWaalsContact O-N 3.16Å
51	L	81.1	Confident	85.1	Confident	63 Å²	63	84.6 Å²	84.6	33%	0.33	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	127.2	-179.9	-58.3	177.1	0	0	0	110.4	Q47 V48 F53 K64 D65	Q47-L51 PolarHBondContact NE2-O 3.25Å; V48-L51 PolarHBondContact N-O 3.24Å; V48-L51 WeakPolarHBondContact O-CB 3.47Å; V48-L51 PolarHBondContact O-N 3.38Å; L51-F53 HydrophobicContact CB-CD2 4.45Å; L51-F53 HydrophobicContact CB-CE2 3.62Å; L51-F53 HydrophobicContact CB-CZ 3.98Å; L51-F53 HydrophobicContact CD1-CE2 4.32Å; L51-F53 HydrophobicContact CD1-CZ 4.01Å; L51-K64 WeakPolarHBondContact CA-O 3.44Å; L51-D65 HydrophobicContact CD2-CB 3.59Å
52	K	86.2	Confident	85.2	Confident	74 Å²	74	80.5 Å²	80.5	32%	0.322	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.2	123.3	169.4	-170.5	175.7	-180	173.6	0	109.7	Q47 V54 V63 K64	Q47-K52 VanDerWaalsContact OE1-CB 3.23Å; K52-V54 HydrophobicContact CD-CG2 4.28Å; K52-V54 HydrophobicContact CG-CG2 4.12Å; K52-V63 CarbonylContact O-C 3.59Å; K52-V63 VanDerWaalsContact O-CA 3.32Å; K52-V63 WeakPolarHBondContact O-CA 3.35Å; K52-K64 HydrophobicContact CB-CB 4.2Å; K52-K64 PolarHBondContact N-O 3.36Å; K52-K64 PolarHBondContact O-N 2.88Å
53	F	86.5	Confident	85.7	Confident	62 Å²	62	75.8 Å²	75.8	27%	0.272	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	128.9	173.2	-57	-93.2	0	0	0	108	Y45 L46 V48 L51 L61 T62 V63	Y45-F53 CarbonylContact C-O 3.55Å; Y45-F53 WeakPolarHBondContact CA-O 3.49Å; Y45-F53 VanDerWaalsContact CB-O 3.27Å; Y45-F53 WeakPolarHBondContact CB-O 3.37Å; L46-F53 HydrophobicContact CB-CB 4.38Å; L46-F53 HydrophobicContact CG-CD2 4.5Å; L46-F53 PolarHBondContact N-O 3.38Å; L46-F53 PolarHBondContact O-N 3.4Å; V48-F53 HydrophobicContact CB-CE2 4.5Å; V48-F53 HydrophobicContact CG2-CE2 4.47Å; L51-F53 HydrophobicContact CB-CD2 4.45Å; L51-F53 HydrophobicContact CB-CE2 3.62Å; L51-F53 HydrophobicContact CB-CZ 3.98Å; L51-F53 HydrophobicContact CD1-CE2 4.32Å; L51-F53 HydrophobicContact CD1-CZ 4.01Å; F53-L61 HydrophobicContact CB-CD1 4.26Å; F53-L61 HydrophobicContact CD1-CD1 4.48Å; F53-T62 CarbonylContact C-O 3.54Å; F53-T62 WeakPolarHBondContact CA-O 3.22Å; F53-V63 HydrophobicContact CD1-CG1 4.28Å; F53-V63 HydrophobicContact CD1-CG2 3.8Å; F53-V63 HydrophobicContact CE1-CG1 4Å; F53-V63 HydrophobicContact CE1-CG2 4.01Å
54	V	89.3	Confident	85.9	Confident	19 Å²	19	77.9 Å²	77.9	12%	0.115	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	121.3	175	-176	0	0	0	0	107.7	Q43 M44 K52 L61 T62	Q43-V54 HydrophobicContact CB-CG1 3.87Å; M44-V54 CarbonylContact O-C 3.52Å; M44-V54 WeakPolarHBondContact O-CA 3.18Å; K52-V54 HydrophobicContact CD-CG2 4.28Å; K52-V54 HydrophobicContact CG-CG2 4.12Å; V54-L61 CarbonylContact O-C 3.56Å; V54-L61 WeakPolarHBondContact O-CA 3.27Å; V54-T62 PolarHBondContact N-O 2.9Å; V54-T62 PolarHBondContact O-N 2.95Å
55	L	89.2	Confident	86.1	Confident	54 Å²	54	78.2 Å²	78.2	28%	0.283	38%	0.376	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	121.3	171.5	-178.2	63	0	0	0	108.3	M44 Q60	M44-L55 HydrophobicContact CE-CD2 4.01Å; M44-L55 PolarHBondContact N-O 3.24Å; M44-L55 VanDerWaalsContact N-O 3.17Å; M44-L55 PolarHBondContact O-N 3.06Å; L55-Q60 WeakPolarHBondContact CA-O 3.34Å
56	D	88.7	Confident	86.1	Confident	29 Å²	29	77.9 Å²	77.9	16%	0.155	39%	0.388	C	S	.	.			trans	-94.3	179.9	178.7	76.1	14.6	0	0	0	113.3	Q43 E58 D59 Q60	Q43-D56 HydrophobicContact CG-CB 4.01Å; D56-E58 PolarHBondContact O-N 2.98Å; D56-E58 WeakPolarHBondContact OD1-CA 3.46Å; D56-E58 WeakPolarHBondContact OD1-CB 3.4Å; D56-E58 PolarHBondContact OD1-N 3.22Å; D56-D59 PolarHBondContact O-N 3.03Å; D56-D59 PolarHBondContact OD1-N 3.02Å; D56-Q60 PolarHBondContact N-O 2.95Å; D56-Q60 VanDerWaalsContact N-O 3.13Å; D56-Q60 PolarHBondContact OD1-N 3.15Å
57	K	87.4	Confident	86.4	Confident	190 Å²	190	81.2 Å²	81.2	83%	0.826	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.3	-10.6	180	67.5	-179	-178.5	177.6	0	114.1
58	E	88.5	Confident	86.7	Confident	115 Å²	115	78.1 Å²	78.1	54%	0.537	39%	0.394	S	S	.	.	T	Hydrogen-bonded Turn	trans	-101.8	13.6	179.5	-60	-177	-176.6	0	0	111.3	D56 Q60	D56-E58 PolarHBondContact O-N 2.98Å; D56-E58 WeakPolarHBondContact OD1-CA 3.46Å; D56-E58 WeakPolarHBondContact OD1-CB 3.4Å; D56-E58 PolarHBondContact OD1-N 3.22Å; E58-Q60 HydrophobicContact CB-CG 4.27Å; E58-Q60 PolarHBondContact O-N 3.15Å; E58-Q60 PolarHBondContact OE2-NE2 3Å
59	D	87.9	Confident	87.3	Confident	78 Å²	78	76.3 Å²	76.3	42%	0.417	38%	0.383	S	S	.	.	S	Bend	trans	61.3	24.3	-174.3	-57.5	-44.5	0	0	0	113.5	D56 L74	D56-D59 PolarHBondContact O-N 3.03Å; D56-D59 PolarHBondContact OD1-N 3.02Å; D59-L74 WeakPolarHBondContact O-CA 3.41Å; D59-L74 WeakPolarHBondContact O-CB 3.27Å; D59-L74 PolarHBondContact O-N 2.87Å
60	Q	90.7	Very high	87.7	Confident	63 Å²	63	68.7 Å²	68.7	29%	0.294	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	123.6	173	-54.3	-173.5	23.9	0	0	110.4	L55 D56 E58 T71 V72	L55-Q60 WeakPolarHBondContact CA-O 3.34Å; D56-Q60 PolarHBondContact N-O 2.95Å; D56-Q60 VanDerWaalsContact N-O 3.13Å; D56-Q60 PolarHBondContact OD1-N 3.15Å; E58-Q60 HydrophobicContact CB-CG 4.27Å; E58-Q60 PolarHBondContact O-N 3.15Å; E58-Q60 PolarHBondContact OE2-NE2 3Å; Q60-T71 HydrophobicContact CB-CG2 4.06Å; Q60-V72 WeakPolarHBondContact CA-O 3.38Å
61	L	91.2	Very high	88.1	Confident	47 Å²	47	62 Å²	62	25%	0.246	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	115.1	170.7	179.5	65.3	0	0	0	109.4	F53 V54 V63 T71 V72 L74	F53-L61 HydrophobicContact CB-CD1 4.26Å; F53-L61 HydrophobicContact CD1-CD1 4.48Å; V54-L61 CarbonylContact O-C 3.56Å; V54-L61 WeakPolarHBondContact O-CA 3.27Å; L61-V63 HydrophobicContact CD2-CG2 4.28Å; L61-V63 HydrophobicContact CG-CG2 4.14Å; L61-T71 CarbonylContact O-C 3.51Å; L61-T71 WeakPolarHBondContact O-CA 3.39Å; L61-V72 PolarHBondContact N-O 3.05Å; L61-V72 PolarHBondContact O-N 2.88Å; L61-L74 HydrophobicContact CB-CD1 3.61Å; L61-L74 HydrophobicContact CB-CG 4.08Å; L61-L74 HydrophobicContact CD2-CD1 4.04Å; L61-L74 HydrophobicContact CG-CD1 4.42Å
62	T	91.4	Very high	88.4	Confident	36 Å²	36	60.5 Å²	60.5	22%	0.221	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	124	170.2	-61.9	0	0	0	0	110.1	F53 V54 V69 T70 T71	F53-T62 CarbonylContact C-O 3.54Å; F53-T62 WeakPolarHBondContact CA-O 3.22Å; V54-T62 PolarHBondContact N-O 2.9Å; V54-T62 PolarHBondContact O-N 2.95Å; T62-V69 HydrophobicContact CG2-CG1 3.52Å; T62-T70 CarbonylContact C-O 3.6Å; T62-T70 WeakPolarHBondContact CA-O 3.47Å; T62-T71 PolarHBondContact OG1-OG1 3.3Å; T62-T71 VanDerWaalsContact OG1-OG1 3.05Å
63	V	90.7	Very high	88.4	Confident	36 Å²	36	59.6 Å²	59.6	22%	0.218	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.7	122.8	174.7	-173.2	0	0	0	0	108.4	K52 F53 L61 V69 T70	K52-V63 CarbonylContact O-C 3.59Å; K52-V63 VanDerWaalsContact O-CA 3.32Å; K52-V63 WeakPolarHBondContact O-CA 3.35Å; F53-V63 HydrophobicContact CD1-CG1 4.28Å; F53-V63 HydrophobicContact CD1-CG2 3.8Å; F53-V63 HydrophobicContact CE1-CG1 4Å; F53-V63 HydrophobicContact CE1-CG2 4.01Å; L61-V63 HydrophobicContact CD2-CG2 4.28Å; L61-V63 HydrophobicContact CG-CG2 4.14Å; V63-V69 WeakPolarHBondContact O-CA 3.37Å; V63-T70 PolarHBondContact N-O 3.48Å; V63-T70 PolarHBondContact O-N 3.26Å
64	K	88	Confident	88.4	Confident	93 Å²	93	61.1 Å²	61.1	40%	0.404	33%	0.326	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	124.6	171.1	-176.5	175.1	-179.8	174.6	0	109.9	L51 K52 G66 C68 V69	L51-K64 WeakPolarHBondContact CA-O 3.44Å; K52-K64 HydrophobicContact CB-CB 4.2Å; K52-K64 PolarHBondContact N-O 3.36Å; K52-K64 PolarHBondContact O-N 2.88Å; K64-G66 WeakPolarHBondContact CE-O 3.41Å; K64-C68 CarbonylContact C-O 3.59Å; K64-C68 WeakPolarHBondContact CA-O 3.44Å; K64-V69 HydrophobicContact CB-CG2 4.38Å; K64-V69 HydrophobicContact CD-CG2 4.32Å; K64-V69 HydrophobicContact CG-CG2 4.08Å
65	D	86.8	Confident	88.3	Confident	84 Å²	84	61.7 Å²	61.7	45%	0.449	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	101.4	173.5	-175	15.2	0	0	0	109.2	L51 D67 C68	L51-D65 HydrophobicContact CD2-CB 3.59Å; D65-D67 PolarHBondContact O-N 2.88Å; D65-C68 PolarHBondContact N-O 3.07Å; D65-C68 WeakPolarHBondContact O-CB 3.4Å; D65-C68 PolarHBondContact O-N 3.03Å
66	G	86.4	Confident	88.2	Confident	43 Å²	43	63 Å²	63	44%	0.443	35%	0.351	S	S	.	.	T	Hydrogen-bonded Turn	trans	57.8	-119.8	-170.5	0	0	0	0	0	112	K64	K64-G66 WeakPolarHBondContact CE-O 3.41Å
67	D	88	Confident	88.2	Confident	111 Å²	111	65.2 Å²	65.2	59%	0.594	37%	0.367	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.9	-4.7	179.5	-67.9	-17	0	0	0	112.5	D65 M95 V96	D65-D67 PolarHBondContact O-N 2.88Å; D67-M95 CarbonylContact O-C 3.59Å; D67-V96 WeakPolarHBondContact CB-O 3.18Å; D67-V96 PolarHBondContact O-N 3.19Å
68	C	86.3	Confident	88.2	Confident	27 Å²	27	60.1 Å²	60.1	18%	0.182	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.9	128.7	176.9	173	0	0	0	0	110.6	K64 D65 Y93 M95	K64-C68 CarbonylContact C-O 3.59Å; K64-C68 WeakPolarHBondContact CA-O 3.44Å; D65-C68 PolarHBondContact N-O 3.07Å; D65-C68 WeakPolarHBondContact O-CB 3.4Å; D65-C68 PolarHBondContact O-N 3.03Å; C68-Y93 HydrophobicContact CB-CE2 4.3Å; C68-Y93 WeakPolarHBondContact SG-CE2 3.41Å; C68-M95 HydrophobicContact CB-SD 4.34Å
69	V	89.5	Confident	88.5	Confident	26 Å²	26	58.5 Å²	58.5	16%	0.158	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	123.2	167.3	-178.1	0	0	0	0	108.9	T62 V63 K64 I94 V96	T62-V69 HydrophobicContact CG2-CG1 3.52Å; V63-V69 WeakPolarHBondContact O-CA 3.37Å; K64-V69 HydrophobicContact CB-CG2 4.38Å; K64-V69 HydrophobicContact CD-CG2 4.32Å; K64-V69 HydrophobicContact CG-CG2 4.08Å; V69-I94 PolarHBondContact N-O 2.97Å; V69-I94 PolarHBondContact O-N 2.76Å; V69-V96 HydrophobicContact CG2-CG2 3.81Å
70	T	88.1	Confident	88.7	Confident	37 Å²	37	63.2 Å²	63.2	23%	0.227	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	127.9	174.4	-58.6	0	0	0	0	109.5	T62 V63 V72 I91 M92	T62-T70 CarbonylContact C-O 3.6Å; T62-T70 WeakPolarHBondContact CA-O 3.47Å; V63-T70 PolarHBondContact N-O 3.48Å; V63-T70 PolarHBondContact O-N 3.26Å; T70-V72 HydrophobicContact CG2-CG2 4.22Å; T70-I91 HydrophobicContact CG2-CG2 3.44Å; T70-I91 VanDerWaalsContact CG2-CG2 3.44Å; T70-M92 CarbonylContact C-O 3.57Å; T70-M92 WeakPolarHBondContact CA-O 2.95Å
71	T	89.1	Confident	88.8	Confident	14 Å²	14	61.6 Å²	61.6	9%	0.086	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	131.6	175.2	-56.6	0	0	0	0	109.9	Q60 L61 T62 M92	Q60-T71 HydrophobicContact CB-CG2 4.06Å; L61-T71 CarbonylContact O-C 3.51Å; L61-T71 WeakPolarHBondContact O-CA 3.39Å; T62-T71 PolarHBondContact OG1-OG1 3.3Å; T62-T71 VanDerWaalsContact OG1-OG1 3.05Å; T71-M92 PolarHBondContact N-O 2.92Å; T71-M92 PolarHBondContact O-N 2.9Å
72	V	87	Confident	88.6	Confident	33 Å²	33	64.6 Å²	64.6	20%	0.2	38%	0.38	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.9	131.8	179.5	-173.2	0	0	0	0	109.5	Q60 L61 T70 L74 R89 I91	Q60-V72 WeakPolarHBondContact CA-O 3.38Å; L61-V72 PolarHBondContact N-O 3.05Å; L61-V72 PolarHBondContact O-N 2.88Å; T70-V72 HydrophobicContact CG2-CG2 4.22Å; V72-L74 HydrophobicContact CG1-CD2 4.15Å; V72-R89 HydrophobicContact CG1-CB 4.2Å; V72-I91 HydrophobicContact CG2-CG1 4.09Å; V72-I91 HydrophobicContact CG2-CG2 4.22Å
73	D	85.9	Confident	88.6	Confident	55 Å²	55	72 Å²	72	29%	0.294	41%	0.408	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	120.2	171.1	169.3	32	0	0	0	110.8	A75 R89	D73-A75 WeakPolarHBondContact OD1-CB 3.11Å; D73-A75 PolarHBondContact OD1-N 3.13Å; D73-R89 WeakPolarHBondContact O-CB 3.21Å; D73-R89 WeakPolarHBondContact O-CD 3.34Å; D73-R89 VanDerWaalsContact O-CG 3.24Å; D73-R89 WeakPolarHBondContact O-CG 3.32Å; D73-R89 IonicContact OD2-CZ 3.8Å; D73-R89 IonicContact OD2-NH1 3.84Å; D73-R89 PolarHBondContact OD2-NH1 3.16Å
74	L	87	Confident	88.6	Confident	93 Å²	93	72.8 Å²	72.8	49%	0.487	42%	0.419	S	S	.	.			trans	-109.8	20.3	175.4	-54.8	-178.4	0	0	0	113.1	D59 L61 V72	D59-L74 WeakPolarHBondContact O-CA 3.41Å; D59-L74 WeakPolarHBondContact O-CB 3.27Å; D59-L74 PolarHBondContact O-N 2.87Å; L61-L74 HydrophobicContact CB-CD1 3.61Å; L61-L74 HydrophobicContact CB-CG 4.08Å; L61-L74 HydrophobicContact CD2-CD1 4.04Å; L61-L74 HydrophobicContact CG-CD1 4.42Å; V72-L74 HydrophobicContact CG1-CD2 4.15Å
75	A	87	Confident	88.6	Confident	32 Å²	32	75.7 Å²	75.7	26%	0.264	44%	0.439	S	S	.	.	P	Polyproline II helix	trans	-50.3	146.6	175.1	0	0	0	0	0	111.9	D73 R89	D73-A75 WeakPolarHBondContact OD1-CB 3.11Å; D73-A75 PolarHBondContact OD1-N 3.13Å; A75-R89 PolarHBondContact O-NH2 2.96Å
76	A	87.2	Confident	88.3	Confident	81 Å²	81	80 Å²	80	67%	0.669	45%	0.449	S	S	*	.	P	Polyproline II helix	trans	-48.3	141.4	-177.8	0	0	0	0	0	112.8	R89	A76-R89 PolarHBondContact O-NH2 2.88Å
77	P	87.9	Confident	88.2	Confident	76 Å²	76	80.8 Å²	80.8	49%	0.494	45%	0.446	S	S	.	.	P	Polyproline II helix	trans	-70.3	143	-177.3	28.9	-35.2	0	0	0	112	E81 I82	P77-E81 WeakPolarHBondContact CA-OE2 3.5Å; P77-E81 HydrophobicContact CB-CB 4.12Å; P77-I82 HydrophobicContact CB-CG1 4.07Å; P77-I82 HydrophobicContact CG-CD1 4.38Å; P77-I82 HydrophobicContact CG-CG1 4.02Å
78	N	88.6	Confident	87.9	Confident	82 Å²	82	84.7 Å²	84.7	44%	0.439	45%	0.453	S	S	.	.	P	Polyproline II helix	trans	-82.5	168.5	173.9	72.2	59.5	0	0	0	112	K80 E81 I82	N78-K80 VanDerWaalsContact C-N 3.25Å; N78-K80 PolarHBondContact O-N 2.97Å; N78-K80 VanDerWaalsContact O-N 3.15Å; N78-K80 WeakPolarHBondContact OD1-CA 3.49Å; N78-K80 VanDerWaalsContact OD1-CB 3.31Å; N78-K80 WeakPolarHBondContact OD1-CB 3.36Å; N78-K80 PolarHBondContact OD1-N 2.88Å; N78-E81 PolarHBondContact N-OE2 2.79Å; N78-E81 VanDerWaalsContact ND2-CD 3.33Å; N78-E81 PolarHBondContact ND2-OE2 2.78Å; N78-E81 WeakPolarHBondContact O-CB 3.32Å; N78-E81 PolarHBondContact O-N 2.85Å; N78-E81 PolarHBondContact OD1-N 2.8Å; N78-I82 WeakPolarHBondContact O-CG1 3.17Å; N78-I82 PolarHBondContact O-N 2.81Å
79	A	94.4	Very high	87.8	Confident	81 Å²	81	86.4 Å²	86.4	67%	0.669	46%	0.456	S	S	*	.	H	α-helix	trans	-58	-31.4	-176.7	0	0	0	0	0	114.6	K83	A79-K83 VanDerWaalsContact O-CB 3.31Å; A79-K83 WeakPolarHBondContact O-CB 3.32Å; A79-K83 PolarHBondContact O-N 3.33Å
80	K	92.8	Very high	87.3	Confident	177 Å²	177	93.2 Å²	93.2	77%	0.77	49%	0.486	S	S	*	.	H	α-helix	trans	-70.6	-40.7	177.1	-63.8	-179.2	179.8	175.9	0	111	N78 K83 A84	N78-K80 VanDerWaalsContact C-N 3.25Å; N78-K80 PolarHBondContact O-N 2.97Å; N78-K80 VanDerWaalsContact O-N 3.15Å; N78-K80 WeakPolarHBondContact OD1-CA 3.49Å; N78-K80 VanDerWaalsContact OD1-CB 3.31Å; N78-K80 WeakPolarHBondContact OD1-CB 3.36Å; N78-K80 PolarHBondContact OD1-N 2.88Å; K80-K83 PolarHBondContact O-N 2.86Å; K80-A84 WeakPolarHBondContact O-CB 3.49Å; K80-A84 PolarHBondContact O-N 2.76Å
81	E	90.7	Very high	86.8	Confident	30 Å²	30	96.6 Å²	96.6	14%	0.14	50%	0.502	C	S	.	.	H	α-helix	trans	-66.6	-44.9	177.7	-63.9	172.3	145.7	0	0	111.3	P77 N78 K83 A84 N85 R86 T87 R89	P77-E81 WeakPolarHBondContact CA-OE2 3.5Å; P77-E81 HydrophobicContact CB-CB 4.12Å; N78-E81 PolarHBondContact N-OE2 2.79Å; N78-E81 VanDerWaalsContact ND2-CD 3.33Å; N78-E81 PolarHBondContact ND2-OE2 2.78Å; N78-E81 WeakPolarHBondContact O-CB 3.32Å; N78-E81 PolarHBondContact O-N 2.85Å; N78-E81 PolarHBondContact OD1-N 2.8Å; E81-K83 VanDerWaalsContact C-N 3.33Å; E81-K83 PolarHBondContact O-N 2.95Å; E81-A84 CarbonylContact O-C 3.59Å; E81-A84 PolarHBondContact O-N 2.84Å; E81-A84 VanDerWaalsContact O-N 3.15Å; E81-N85 PolarHBondContact O-N 2.86Å; E81-R86 PolarHBondContact O-N 2.99Å; E81-T87 VanDerWaalsContact CD-OG1 3.26Å; E81-T87 WeakPolarHBondContact OE1-CB 3.34Å; E81-T87 PolarHBondContact OE1-OG1 2.96Å; E81-R89 IonicContact OE1-CZ 2.86Å; E81-R89 IonicContact OE1-NE 3.92Å; E81-R89 IonicContact OE1-NH2 3.55Å; E81-R89 IonicContact OE2-NH2 3.11Å; E81-R89 PolarHBondContact OE2-NH2 2.86Å; E81-R89 VanDerWaalsContact OE2-NH2 3.11Å
82	I	88.2	Confident	86.5	Confident	110 Å²	110	100.5 Å²	100.5	56%	0.564	52%	0.52	S	S	*	.	H	α-helix	trans	-58.3	-47.3	174.9	-65.3	169.2	0	0	0	110	P77 N78 A84 N85	P77-I82 HydrophobicContact CB-CG1 4.07Å; P77-I82 HydrophobicContact CG-CD1 4.38Å; P77-I82 HydrophobicContact CG-CG1 4.02Å; N78-I82 WeakPolarHBondContact O-CG1 3.17Å; N78-I82 PolarHBondContact O-N 2.81Å; I82-A84 VanDerWaalsContact C-N 3.28Å; I82-A84 PolarHBondContact O-N 2.84Å; I82-N85 PolarHBondContact O-N 2.51Å; I82-N85 VanDerWaalsContact O-N 3.13Å
83	K	91.7	Very high	86.3	Confident	190 Å²	190	105.6 Å²	105.6	83%	0.826	54%	0.537	S	S	*	.	H	α-helix	trans	-62.8	-34.4	178.1	-174.8	177.4	179.4	-179.9	0	112.7	A79 K80 E81 N85	A79-K83 VanDerWaalsContact O-CB 3.31Å; A79-K83 WeakPolarHBondContact O-CB 3.32Å; A79-K83 PolarHBondContact O-N 3.33Å; K80-K83 PolarHBondContact O-N 2.86Å; E81-K83 VanDerWaalsContact C-N 3.33Å; E81-K83 PolarHBondContact O-N 2.95Å; K83-N85 VanDerWaalsContact C-N 3.33Å
84	A	90.3	Very high	86.2	Confident	54 Å²	54	106.6 Å²	106.6	45%	0.446	54%	0.541	S	S	.	.	H	α-helix	trans	-81.4	-13.2	178	0	0	0	0	0	113.4	K80 E81 I82 R86	K80-A84 WeakPolarHBondContact O-CB 3.49Å; K80-A84 PolarHBondContact O-N 2.76Å; E81-A84 CarbonylContact O-C 3.59Å; E81-A84 PolarHBondContact O-N 2.84Å; E81-A84 VanDerWaalsContact O-N 3.15Å; I82-A84 VanDerWaalsContact C-N 3.28Å; I82-A84 PolarHBondContact O-N 2.84Å; A84-R86 HydrophobicContact CB-CG 4.09Å; A84-R86 PolarHBondContact O-N 3.3Å
85	N	87.6	Confident	86	Confident	154 Å²	154	107.9 Å²	107.9	82%	0.824	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.7	30.8	-171.3	-161.1	41.5	0	0	0	113.5	E81 I82 K83	E81-N85 PolarHBondContact O-N 2.86Å; I82-N85 PolarHBondContact O-N 2.51Å; I82-N85 VanDerWaalsContact O-N 3.13Å; K83-N85 VanDerWaalsContact C-N 3.33Å
86	R	81	Confident	85.7	Confident	173 Å²	173	112.5 Å²	112.5	65%	0.653	57%	0.571	S	S	*	*			trans	-161.9	153.7	177.9	66.8	-176	-176.7	171.4	1.2	110.4	E81 A84	E81-R86 PolarHBondContact O-N 2.99Å; A84-R86 HydrophobicContact CB-CG 4.09Å; A84-R86 PolarHBondContact O-N 3.3Å
87	T	83.9	Confident	85.6	Confident	61 Å²	61	114.1 Å²	114.1	37%	0.374	57%	0.566	S	S	.	*			trans	-145.4	162.2	170	-179.7	0	0	0	0	110.2	E81 R89	E81-T87 VanDerWaalsContact CD-OG1 3.26Å; E81-T87 WeakPolarHBondContact OE1-CB 3.34Å; E81-T87 PolarHBondContact OE1-OG1 2.96Å; T87-R89 HydrophobicContact CG2-CG 4.41Å
88	Y	82.8	Confident	85.5	Confident	192 Å²	192	116.1 Å²	116.1	75%	0.753	57%	0.57	S	S	*	*			trans	-121.3	127.3	167.2	-62	-83.5	0	0	0	107.4
89	R	83	Confident	85.4	Confident	64 Å²	64	118 Å²	118	24%	0.242	58%	0.577	C	S	.	*			trans	-108	148.6	177.8	-63.5	-71	174.9	151.2	0.9	109.4	V72 D73 A75 A76 E81 T87 I91	V72-R89 HydrophobicContact CG1-CB 4.2Å; D73-R89 WeakPolarHBondContact O-CB 3.21Å; D73-R89 WeakPolarHBondContact O-CD 3.34Å; D73-R89 VanDerWaalsContact O-CG 3.24Å; D73-R89 WeakPolarHBondContact O-CG 3.32Å; D73-R89 IonicContact OD2-CZ 3.8Å; D73-R89 IonicContact OD2-NH1 3.84Å; D73-R89 PolarHBondContact OD2-NH1 3.16Å; A75-R89 PolarHBondContact O-NH2 2.96Å; A76-R89 PolarHBondContact O-NH2 2.88Å; E81-R89 IonicContact OE1-CZ 2.86Å; E81-R89 IonicContact OE1-NE 3.92Å; E81-R89 IonicContact OE1-NH2 3.55Å; E81-R89 IonicContact OE2-NH2 3.11Å; E81-R89 PolarHBondContact OE2-NH2 2.86Å; E81-R89 VanDerWaalsContact OE2-NH2 3.11Å; T87-R89 HydrophobicContact CG2-CG 4.41Å; R89-I91 PolarHBondContact O-N 2.88Å
90	Q	78.6	Confident	84.8	Confident	169 Å²	169	120.2 Å²	120.2	79%	0.79	57%	0.572	S	S	*	*			trans	-67.1	134.4	174.9	-175.2	173	-15.3	0	0	108.8
91	I	78	Confident	84.3	Confident	107 Å²	107	116.6 Å²	116.6	55%	0.549	56%	0.559	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.6	125	175.4	-56.1	-178	0	0	0	106.8	T70 V72 R89	T70-I91 HydrophobicContact CG2-CG2 3.44Å; T70-I91 VanDerWaalsContact CG2-CG2 3.44Å; V72-I91 HydrophobicContact CG2-CG1 4.09Å; V72-I91 HydrophobicContact CG2-CG2 4.22Å; R89-I91 PolarHBondContact O-N 2.88Å
92	M	83.4	Confident	83.9	Confident	97 Å²	97	122.4 Å²	122.4	48%	0.478	59%	0.587	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.6	130.4	167.8	-174.5	174.7	65.9	0	0	108.5	T70 T71 I94	T70-M92 CarbonylContact C-O 3.57Å; T70-M92 WeakPolarHBondContact CA-O 2.95Å; T71-M92 PolarHBondContact N-O 2.92Å; T71-M92 PolarHBondContact O-N 2.9Å; M92-I94 HydrophobicContact CE-CD1 3.83Å; M92-I94 HydrophobicContact CG-CD1 4.37Å; M92-I94 HydrophobicContact CG-CG1 4.21Å; M92-I94 HydrophobicContact SD-CD1 4.07Å
93	Y	81.8	Confident	83.6	Confident	139 Å²	139	123.3 Å²	123.3	55%	0.545	59%	0.589	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-122.9	129.6	177.5	168.8	-89.8	0	0	0	109.1	C68 M95	C68-Y93 HydrophobicContact CB-CE2 4.3Å; C68-Y93 WeakPolarHBondContact SG-CE2 3.41Å; Y93-M95 HydrophobicContact CE1-CG 3.64Å; Y93-M95 HydrophobicContact CE1-SD 4.32Å; Y93-M95 VanDerWaalsContact OH-CG 3.29Å; Y93-M95 WeakPolarHBondContact OH-CG 3.29Å; Y93-M95 PolarHBondContact OH-SD 2.96Å
94	I	85	Confident	83	Confident	77 Å²	77	118.2 Å²	118.2	40%	0.395	57%	0.571	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-131.5	129.4	179.6	-56.4	175.7	0	0	0	108.1	V69 M92 V96	V69-I94 PolarHBondContact N-O 2.97Å; V69-I94 PolarHBondContact O-N 2.76Å; M92-I94 HydrophobicContact CE-CD1 3.83Å; M92-I94 HydrophobicContact CG-CD1 4.37Å; M92-I94 HydrophobicContact CG-CG1 4.21Å; M92-I94 HydrophobicContact SD-CD1 4.07Å; I94-V96 HydrophobicContact CG2-CG2 3.95Å
95	M	81.9	Confident	82.4	Confident	120 Å²	120	123.5 Å²	123.5	59%	0.591	58%	0.581	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-90.5	122.2	163.9	-72.3	-69.5	-74.9	0	0	108	D67 C68 Y93	D67-M95 CarbonylContact O-C 3.59Å; C68-M95 HydrophobicContact CB-SD 4.34Å; Y93-M95 HydrophobicContact CE1-CG 3.64Å; Y93-M95 HydrophobicContact CE1-SD 4.32Å; Y93-M95 VanDerWaalsContact OH-CG 3.29Å; Y93-M95 WeakPolarHBondContact OH-CG 3.29Å; Y93-M95 PolarHBondContact OH-SD 2.96Å
96	V	81.5	Confident	81.9	Confident	129 Å²	129	120.7 Å²	120.7	78%	0.782	56%	0.559	S	S	*	*			trans	-105.9	0	-177.1	-176.4	0	0	0	0	110.1	D67 V69 I94	D67-V96 WeakPolarHBondContact CB-O 3.18Å; D67-V96 PolarHBondContact O-N 3.19Å; V69-V96 HydrophobicContact CG2-CG2 3.81Å; I94-V96 HydrophobicContact CG2-CG2 3.95Å

Retrieved 96 of 96 residues in 120 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).