A0A5K4F703_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F703, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 69 aa.

						>A0A5K4F703_SCHMA|A0A5K4F703
MGVVSIEYYVYYINPMNKIEFEQKQKEIEFINYYIILLRNGIKYLTGTYTYIYVSHLDEGMKSNEMMRL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.4	Very low	56.1	Low	240 Å²	240	134.4 Å²	134.4	100%	1.182	70%	0.698	S	S	*	*				0	93	0	-65.7	170.2	98.2	0	0	107.4	V3	M1-V3 PolarHBondContact O-N 3.27Å
2	G	53	Low	55.9	Low	77 Å²	77	135.9 Å²	135.9	79%	0.794	69%	0.69	S	S	*	*			trans	-86.9	85.2	180	0	0	0	0	0	109.9	V4	G2-V4 PolarHBondContact O-N 3.43Å
3	V	58.3	Low	55.6	Low	135 Å²	135	133.6 Å²	133.6	82%	0.818	68%	0.679	S	S	*	*			trans	-91.2	67.2	159.4	-165.7	0	0	0	0	105.6	M1 S5	M1-V3 PolarHBondContact O-N 3.27Å; V3-S5 VanDerWaalsContact C-N 3.32Å; V3-S5 PolarHBondContact O-N 3.07Å
4	V	55.9	Low	55.4	Low	100 Å²	100	129.5 Å²	129.5	61%	0.606	66%	0.659	S	S	*	*			trans	-71.9	104.5	165.4	-169.8	0	0	0	0	103.6	G2 I6	G2-V4 PolarHBondContact O-N 3.43Å; V4-I6 PolarHBondContact O-N 3.36Å
5	S	60.6	Low	55.4	Low	43 Å²	43	126.7 Å²	126.7	30%	0.301	65%	0.653	S	S	.	*			trans	-54.5	138.4	-167.4	50.3	0	0	0	0	109.7	V3 E7 Y8	V3-S5 VanDerWaalsContact C-N 3.32Å; V3-S5 PolarHBondContact O-N 3.07Å; S5-E7 PolarHBondContact O-N 3.46Å; S5-E7 PolarHBondContact OG-OE2 2.84Å; S5-Y8 WeakPolarHBondContact O-CB 3.49Å; S5-Y8 PolarHBondContact O-N 3.27Å
6	I	61.6	Low	55.5	Low	140 Å²	140	126.6 Å²	126.6	72%	0.718	65%	0.651	S	S	*	*	H	α-helix	trans	-46	-29.3	170	-78.2	167.2	0	0	0	110.9	V4 Y8 Y9 V10	V4-I6 PolarHBondContact O-N 3.36Å; I6-Y8 VanDerWaalsContact C-N 3.27Å; I6-Y8 PolarHBondContact O-N 2.94Å; I6-Y9 CarbonylContact O-C 3.55Å; I6-Y9 WeakPolarHBondContact O-CA 3.35Å; I6-Y9 WeakPolarHBondContact O-CB 3.43Å; I6-Y9 PolarHBondContact O-N 3.46Å; I6-V10 HydrophobicContact CG2-CG2 3.93Å; I6-V10 WeakPolarHBondContact O-CG2 3.47Å; I6-V10 PolarHBondContact O-N 2.81Å
7	E	55.9	Low	56.1	Low	149 Å²	149	124.8 Å²	124.8	70%	0.696	64%	0.643	S	S	*	*	H	α-helix	trans	-51.1	-41.1	172.6	-60.1	178.2	144.2	0	0	113.6	S5 Y9 V10 Y11	S5-E7 PolarHBondContact O-N 3.46Å; S5-E7 PolarHBondContact OG-OE2 2.84Å; E7-Y9 VanDerWaalsContact C-N 3.34Å; E7-V10 PolarHBondContact O-N 3.07Å; E7-Y11 PolarHBondContact O-N 3.4Å
8	Y	56.7	Low	57.2	Low	137 Å²	137	125.4 Å²	125.4	54%	0.537	64%	0.64	S	S	.	*	H	α-helix	trans	-68.1	-37.7	177.4	-137.2	-85.4	0	0	0	111.5	S5 I6 Y11 Y12	S5-Y8 WeakPolarHBondContact O-CB 3.49Å; S5-Y8 PolarHBondContact O-N 3.27Å; I6-Y8 VanDerWaalsContact C-N 3.27Å; I6-Y8 PolarHBondContact O-N 2.94Å; Y8-Y11 PolarHBondContact O-N 3.09Å; Y8-Y12 AromaticContact CD1-CD2 3.58Å; Y8-Y12 HydrophobicContact CD1-CD2 3.58Å; Y8-Y12 AromaticContact CD1-CE2 3.86Å; Y8-Y12 HydrophobicContact CD1-CE2 3.86Å; Y8-Y12 AromaticContact CE1-CD2 3.48Å; Y8-Y12 HydrophobicContact CE1-CD2 3.48Å; Y8-Y12 VanDerWaalsContact CE1-CD2 3.48Å; Y8-Y12 AromaticContact CE1-CE2 3.29Å; Y8-Y12 HydrophobicContact CE1-CE2 3.29Å; Y8-Y12 HydrophobicContact CG-CD2 4.47Å; Y8-Y12 AromaticContact CZ-CE2 3.72Å; Y8-Y12 WeakPolarHBondContact O-CD2 3.35Å; Y8-Y12 PolarHBondContact O-N 3.01Å; Y8-Y12 VanDerWaalsContact O-N 3.09Å
9	Y	55.3	Low	58.7	Low	147 Å²	147	124.1 Å²	124.1	58%	0.576	63%	0.633	S	S	*	*	H	α-helix	trans	-69.3	-37.7	175.7	-91.1	-95.5	0	0	0	112.3	I6 E7 Y11 I13	I6-Y9 CarbonylContact O-C 3.55Å; I6-Y9 WeakPolarHBondContact O-CA 3.35Å; I6-Y9 WeakPolarHBondContact O-CB 3.43Å; I6-Y9 PolarHBondContact O-N 3.46Å; E7-Y9 VanDerWaalsContact C-N 3.34Å; Y9-Y11 VanDerWaalsContact C-N 3.33Å; Y9-I13 HydrophobicContact CD1-CD1 3.22Å; Y9-I13 HydrophobicContact CD1-CG1 3.76Å; Y9-I13 HydrophobicContact CE1-CD1 3.38Å; Y9-I13 HydrophobicContact CE1-CG1 4.3Å; Y9-I13 HydrophobicContact CG-CD1 4.39Å; Y9-I13 WeakPolarHBondContact O-CA 3.38Å; Y9-I13 WeakPolarHBondContact O-CB 3.44Å; Y9-I13 PolarHBondContact O-N 2.84Å
10	V	56.4	Low	60	Low	109 Å²	109	122 Å²	122	66%	0.661	62%	0.621	S	S	*	*	H	α-helix	trans	-66.3	-37.3	175.8	175.1	0	0	0	0	110.9	I6 E7	I6-V10 HydrophobicContact CG2-CG2 3.93Å; I6-V10 WeakPolarHBondContact O-CG2 3.47Å; I6-V10 PolarHBondContact O-N 2.81Å; E7-V10 PolarHBondContact O-N 3.07Å
11	Y	56.5	Low	61.1	Low	201 Å²	201	122.7 Å²	122.7	79%	0.788	62%	0.62	S	S	*	*	H	α-helix	trans	-74.1	-35.8	179.8	-138.8	-88.1	0	0	0	113.1	E7 Y8 Y9	E7-Y11 PolarHBondContact O-N 3.4Å; Y8-Y11 PolarHBondContact O-N 3.09Å; Y9-Y11 VanDerWaalsContact C-N 3.33Å
12	Y	52.7	Low	63.2	Low	153 Å²	153	115.1 Å²	115.1	60%	0.6	58%	0.581	S	S	*	*	H	α-helix	trans	-103.6	-23	-174.3	-78	-85.9	0	0	0	115.7	Y8 N14 P15	Y8-Y12 AromaticContact CD1-CD2 3.58Å; Y8-Y12 HydrophobicContact CD1-CD2 3.58Å; Y8-Y12 AromaticContact CD1-CE2 3.86Å; Y8-Y12 HydrophobicContact CD1-CE2 3.86Å; Y8-Y12 AromaticContact CE1-CD2 3.48Å; Y8-Y12 HydrophobicContact CE1-CD2 3.48Å; Y8-Y12 VanDerWaalsContact CE1-CD2 3.48Å; Y8-Y12 AromaticContact CE1-CE2 3.29Å; Y8-Y12 HydrophobicContact CE1-CE2 3.29Å; Y8-Y12 HydrophobicContact CG-CD2 4.47Å; Y8-Y12 AromaticContact CZ-CE2 3.72Å; Y8-Y12 WeakPolarHBondContact O-CD2 3.35Å; Y8-Y12 PolarHBondContact O-N 3.01Å; Y8-Y12 VanDerWaalsContact O-N 3.09Å; Y12-N14 PolarHBondContact O-N 3.44Å; Y12-P15 WeakPolarHBondContact O-CD 3.39Å
13	I	52.2	Low	64.9	Low	106 Å²	106	116.4 Å²	116.4	54%	0.544	57%	0.567	S	S	.	*	S	Bend	trans	-99.4	49.1	176.3	-45.9	-156.2	0	0	0	111.3	Y9	Y9-I13 HydrophobicContact CD1-CD1 3.22Å; Y9-I13 HydrophobicContact CD1-CG1 3.76Å; Y9-I13 HydrophobicContact CE1-CD1 3.38Å; Y9-I13 HydrophobicContact CE1-CG1 4.3Å; Y9-I13 HydrophobicContact CG-CD1 4.39Å; Y9-I13 WeakPolarHBondContact O-CA 3.38Å; Y9-I13 WeakPolarHBondContact O-CB 3.44Å; Y9-I13 PolarHBondContact O-N 2.84Å
14	N	53.8	Low	66.4	Low	76 Å²	76	115.6 Å²	115.6	41%	0.406	55%	0.552	S	S	.	*				-148.3	82.8	129.9	-125.4	-3.1	0	0	0	109.5	Y12 M16 N17 K18	Y12-N14 PolarHBondContact O-N 3.44Å; N14-M16 PolarHBondContact O-N 3.41Å; N14-M16 VanDerWaalsContact O-N 3.15Å; N14-M16 WeakPolarHBondContact OD1-CB 3.35Å; N14-N17 HydrophobicContact CB-CB 3.91Å; N14-N17 WeakPolarHBondContact O-CA 2.99Å; N14-N17 VanDerWaalsContact O-CB 3.23Å; N14-N17 WeakPolarHBondContact O-CB 3.23Å; N14-N17 PolarHBondContact O-N 3.12Å; N14-K18 PolarHBondContact O-N 3.15Å
15	P	54.5	Low	67.9	Low	88 Å²	88	115.2 Å²	115.2	57%	0.571	54%	0.544	S	S	*	.	H	α-helix	trans	-52.3	-25.9	159.1	22.3	-32.9	0	0	0	111.4	Y12 N17 K18 I19	Y12-P15 WeakPolarHBondContact O-CD 3.39Å; P15-N17 VanDerWaalsContact C-N 3.3Å; P15-N17 PolarHBondContact O-N 3.33Å; P15-K18 PolarHBondContact O-N 2.9Å; P15-K18 VanDerWaalsContact O-N 3.12Å; P15-I19 PolarHBondContact O-N 3.45Å; P15-I19 VanDerWaalsContact O-N 3.15Å
16	M	56.8	Low	69.5	Low	125 Å²	125	119.6 Å²	119.6	62%	0.616	56%	0.557	S	S	*	*	H	α-helix	trans	-56.3	-41.2	165.9	-62.4	-87.6	-165.4	0	0	111.7	N14 K18 I19 E20	N14-M16 PolarHBondContact O-N 3.41Å; N14-M16 VanDerWaalsContact O-N 3.15Å; N14-M16 WeakPolarHBondContact OD1-CB 3.35Å; M16-K18 VanDerWaalsContact C-N 3.33Å; M16-K18 PolarHBondContact O-N 3.35Å; M16-I19 PolarHBondContact O-N 3.17Å; M16-E20 WeakPolarHBondContact O-CB 3.46Å; M16-E20 VanDerWaalsContact O-CG 3.28Å; M16-E20 WeakPolarHBondContact O-CG 3.05Å; M16-E20 PolarHBondContact O-N 3.26Å
17	N	65.9	Low	71.1	Confident	96 Å²	96	118.7 Å²	118.7	51%	0.513	55%	0.55	S	S	.	*	H	α-helix	trans	-63.5	-36.2	174	-110.7	4.1	0	0	0	112.4	N14 P15 F21	N14-N17 HydrophobicContact CB-CB 3.91Å; N14-N17 WeakPolarHBondContact O-CA 2.99Å; N14-N17 VanDerWaalsContact O-CB 3.23Å; N14-N17 WeakPolarHBondContact O-CB 3.23Å; N14-N17 PolarHBondContact O-N 3.12Å; P15-N17 VanDerWaalsContact C-N 3.3Å; P15-N17 PolarHBondContact O-N 3.33Å; N17-F21 WeakPolarHBondContact O-CA 3.33Å; N17-F21 WeakPolarHBondContact O-CB 3.41Å; N17-F21 PolarHBondContact O-N 2.75Å
18	K	76.6	Confident	73	Confident	136 Å²	136	116.3 Å²	116.3	59%	0.591	54%	0.541	S	S	*	.	H	α-helix	trans	-65.5	-45	179.2	-175.4	177.7	172.8	-178.2	0	110.3	N14 P15 M16 F21 E22	N14-K18 PolarHBondContact O-N 3.15Å; P15-K18 PolarHBondContact O-N 2.9Å; P15-K18 VanDerWaalsContact O-N 3.12Å; M16-K18 VanDerWaalsContact C-N 3.33Å; M16-K18 PolarHBondContact O-N 3.35Å; K18-F21 PolarHBondContact O-N 3.15Å; K18-E22 WeakPolarHBondContact CE-OE1 3.5Å; K18-E22 IonicContact NZ-OE1 3.91Å; K18-E22 WeakPolarHBondContact O-CB 3.4Å; K18-E22 WeakPolarHBondContact O-CG 3.28Å; K18-E22 PolarHBondContact O-N 3.35Å
19	I	84.6	Confident	74.9	Confident	100 Å²	100	114.7 Å²	114.7	51%	0.513	54%	0.539	S	S	.	.	H	α-helix	trans	-63.9	-47.3	176.5	-62.5	172.6	0	0	0	110.3	P15 M16 F21 E22 Q23	P15-I19 PolarHBondContact O-N 3.45Å; P15-I19 VanDerWaalsContact O-N 3.15Å; M16-I19 PolarHBondContact O-N 3.17Å; I19-F21 VanDerWaalsContact C-N 3.3Å; I19-F21 PolarHBondContact O-N 2.85Å; I19-E22 PolarHBondContact O-N 3.34Å; I19-Q23 HydrophobicContact CG2-CG 4.47Å; I19-Q23 WeakPolarHBondContact O-CB 3.3Å; I19-Q23 VanDerWaalsContact O-CG 3.27Å; I19-Q23 WeakPolarHBondContact O-CG 3.36Å; I19-Q23 PolarHBondContact O-N 2.91Å
20	E	84.5	Confident	76.9	Confident	82 Å²	82	114.5 Å²	114.5	38%	0.383	54%	0.541	S	S	.	.	H	α-helix	trans	-61.1	-37.1	176.2	-73.8	177.4	-154.6	0	0	112.4	M16 K24	M16-E20 WeakPolarHBondContact O-CB 3.46Å; M16-E20 VanDerWaalsContact O-CG 3.28Å; M16-E20 WeakPolarHBondContact O-CG 3.05Å; M16-E20 PolarHBondContact O-N 3.26Å; E20-K24 WeakPolarHBondContact O-CB 3.38Å; E20-K24 VanDerWaalsContact O-CG 3.3Å; E20-K24 WeakPolarHBondContact O-CG 3.48Å; E20-K24 PolarHBondContact O-N 3.39Å
21	F	84.5	Confident	78.8	Confident	136 Å²	136	113.8 Å²	113.8	60%	0.596	53%	0.532	S	S	*	.	H	α-helix	trans	-67.4	-48	176.3	177.5	-92.7	0	0	0	111.4	N17 K18 I19 Q23 K24 Q25	N17-F21 WeakPolarHBondContact O-CA 3.33Å; N17-F21 WeakPolarHBondContact O-CB 3.41Å; N17-F21 PolarHBondContact O-N 2.75Å; K18-F21 PolarHBondContact O-N 3.15Å; I19-F21 VanDerWaalsContact C-N 3.3Å; I19-F21 PolarHBondContact O-N 2.85Å; F21-Q23 VanDerWaalsContact C-N 3.27Å; F21-Q23 PolarHBondContact O-N 2.76Å; F21-K24 PolarHBondContact O-N 2.9Å; F21-Q25 WeakPolarHBondContact O-CB 3.27Å; F21-Q25 PolarHBondContact O-N 3.08Å
22	E	91	Very high	80.8	Confident	81 Å²	81	108.1 Å²	108.1	38%	0.379	52%	0.516	S	S	.	.	H	α-helix	trans	-61.9	-36.1	175.7	-74.2	178.9	-169.2	0	0	111.7	K18 I19 K26	K18-E22 WeakPolarHBondContact CE-OE1 3.5Å; K18-E22 IonicContact NZ-OE1 3.91Å; K18-E22 WeakPolarHBondContact O-CB 3.4Å; K18-E22 WeakPolarHBondContact O-CG 3.28Å; K18-E22 PolarHBondContact O-N 3.35Å; I19-E22 PolarHBondContact O-N 3.34Å; E22-K26 WeakPolarHBondContact O-CG 3.33Å; E22-K26 PolarHBondContact O-N 3.39Å; E22-K26 VanDerWaalsContact O-N 3.08Å
23	Q	88.5	Confident	82.9	Confident	105 Å²	105	107.6 Å²	107.6	49%	0.491	51%	0.514	S	S	.	.	H	α-helix	trans	-65.1	-49.3	173.1	-75.1	173.8	-12	0	0	111.7	I19 F21 Q25 K26 E27	I19-Q23 HydrophobicContact CG2-CG 4.47Å; I19-Q23 WeakPolarHBondContact O-CB 3.3Å; I19-Q23 VanDerWaalsContact O-CG 3.27Å; I19-Q23 WeakPolarHBondContact O-CG 3.36Å; I19-Q23 PolarHBondContact O-N 2.91Å; F21-Q23 VanDerWaalsContact C-N 3.27Å; F21-Q23 PolarHBondContact O-N 2.76Å; Q23-Q25 VanDerWaalsContact C-N 3.29Å; Q23-Q25 PolarHBondContact O-N 2.91Å; Q23-K26 WeakPolarHBondContact O-CB 3.37Å; Q23-K26 PolarHBondContact O-N 2.92Å; Q23-K26 VanDerWaalsContact O-N 3.14Å; Q23-E27 WeakPolarHBondContact O-CG 3.46Å; Q23-E27 PolarHBondContact O-N 3.14Å
24	K	90	Very high	85.1	Confident	118 Å²	118	108.9 Å²	108.9	51%	0.513	51%	0.513	S	S	.	.	H	α-helix	trans	-60.3	-37.8	175.9	-76.9	172.6	178.9	168.2	0	112.5	E20 F21 E27 I28	E20-K24 WeakPolarHBondContact O-CB 3.38Å; E20-K24 VanDerWaalsContact O-CG 3.3Å; E20-K24 WeakPolarHBondContact O-CG 3.48Å; E20-K24 PolarHBondContact O-N 3.39Å; F21-K24 PolarHBondContact O-N 2.9Å; K24-E27 PolarHBondContact O-N 3.01Å; K24-I28 WeakPolarHBondContact O-CG1 3.42Å; K24-I28 PolarHBondContact O-N 2.88Å
25	Q	88.2	Confident	87.2	Confident	91 Å²	91	108.2 Å²	108.2	43%	0.425	51%	0.509	S	S	.	.	H	α-helix	trans	-62.9	-45.2	174.9	-174.8	177	-2.9	0	0	111.1	F21 Q23 E27 I28 E29	F21-Q25 WeakPolarHBondContact O-CB 3.27Å; F21-Q25 PolarHBondContact O-N 3.08Å; Q23-Q25 VanDerWaalsContact C-N 3.29Å; Q23-Q25 PolarHBondContact O-N 2.91Å; Q25-E27 VanDerWaalsContact C-N 3.34Å; Q25-E27 PolarHBondContact O-N 3.24Å; Q25-I28 PolarHBondContact O-N 3.45Å; Q25-E29 PolarHBondContact NE2-OE1 3.34Å; Q25-E29 WeakPolarHBondContact O-CG 3.33Å; Q25-E29 PolarHBondContact O-N 3.36Å
26	K	94	Very high	89.3	Confident	135 Å²	135	108.4 Å²	108.4	59%	0.587	50%	0.504	S	S	*	.	H	α-helix	trans	-62	-38.6	174.8	-73.2	171	-179.4	172.2	0	112.6	E22 Q23 E29 F30	E22-K26 WeakPolarHBondContact O-CG 3.33Å; E22-K26 PolarHBondContact O-N 3.39Å; E22-K26 VanDerWaalsContact O-N 3.08Å; Q23-K26 WeakPolarHBondContact O-CB 3.37Å; Q23-K26 PolarHBondContact O-N 2.92Å; Q23-K26 VanDerWaalsContact O-N 3.14Å; K26-E29 PolarHBondContact O-N 3.45Å; K26-F30 WeakPolarHBondContact O-CB 3.41Å; K26-F30 PolarHBondContact O-N 2.9Å
27	E	95.5	Very high	91.2	Very high	121 Å²	121	106.2 Å²	106.2	57%	0.565	49%	0.494	S	S	*	.	H	α-helix	trans	-61.4	-44.3	174.3	-72.4	174.7	-178.9	0	0	111.6	Q23 K24 Q25 F30 I31	Q23-E27 WeakPolarHBondContact O-CG 3.46Å; Q23-E27 PolarHBondContact O-N 3.14Å; K24-E27 PolarHBondContact O-N 3.01Å; Q25-E27 VanDerWaalsContact C-N 3.34Å; Q25-E27 PolarHBondContact O-N 3.24Å; E27-F30 PolarHBondContact O-N 2.9Å; E27-I31 VanDerWaalsContact O-CG1 3.29Å; E27-I31 WeakPolarHBondContact O-CG1 3.46Å; E27-I31 PolarHBondContact O-N 2.94Å
28	I	94.9	Very high	92.7	Very high	100 Å²	100	105.6 Å²	105.6	51%	0.513	49%	0.49	S	S	.	.	H	α-helix	trans	-64.8	-44.5	176.6	-68.5	166.8	0	0	0	111.1	K24 Q25 F30 I31 N32	K24-I28 WeakPolarHBondContact O-CG1 3.42Å; K24-I28 PolarHBondContact O-N 2.88Å; Q25-I28 PolarHBondContact O-N 3.45Å; I28-F30 VanDerWaalsContact C-N 3.31Å; I28-F30 PolarHBondContact O-N 3.24Å; I28-I31 PolarHBondContact O-N 3.42Å; I28-N32 WeakPolarHBondContact O-CB 3.44Å; I28-N32 VanDerWaalsContact O-CG 3.29Å; I28-N32 PolarHBondContact O-N 3.29Å; I28-N32 PolarHBondContact O-ND2 3.37Å
29	E	96.9	Very high	93.7	Very high	102 Å²	102	107.4 Å²	107.4	48%	0.477	49%	0.493	S	S	.	.	H	α-helix	trans	-59.8	-42.3	176.2	-74.2	171.7	-171.3	0	0	111.5	Q25 K26 N32 Y33	Q25-E29 PolarHBondContact NE2-OE1 3.34Å; Q25-E29 WeakPolarHBondContact O-CG 3.33Å; Q25-E29 PolarHBondContact O-N 3.36Å; K26-E29 PolarHBondContact O-N 3.45Å; E29-N32 PolarHBondContact O-N 3.46Å; E29-Y33 WeakPolarHBondContact O-CB 3.29Å; E29-Y33 PolarHBondContact O-N 3.33Å
30	F	96.3	Very high	94.2	Very high	143 Å²	143	107.2 Å²	107.2	63%	0.627	49%	0.494	S	S	*	.	H	α-helix	trans	-62	-46.4	175	179.1	-96.1	0	0	0	112.4	K26 E27 I28 N32 Y33 Y34	K26-F30 WeakPolarHBondContact O-CB 3.41Å; K26-F30 PolarHBondContact O-N 2.9Å; E27-F30 PolarHBondContact O-N 2.9Å; I28-F30 VanDerWaalsContact C-N 3.31Å; I28-F30 PolarHBondContact O-N 3.24Å; F30-N32 PolarHBondContact O-N 3.48Å; F30-Y33 PolarHBondContact O-N 3.47Å; F30-Y34 PolarHBondContact O-N 3.36Å
31	I	97.5	Very high	94.8	Very high	94 Å²	94	104.9 Å²	104.9	48%	0.482	49%	0.491	S	S	.	.	H	α-helix	trans	-61	-45.2	176.5	-69.3	164.3	0	0	0	110.7	E27 I28 Y33 Y34 I35	E27-I31 VanDerWaalsContact O-CG1 3.29Å; E27-I31 WeakPolarHBondContact O-CG1 3.46Å; E27-I31 PolarHBondContact O-N 2.94Å; I28-I31 PolarHBondContact O-N 3.42Å; I31-Y33 VanDerWaalsContact C-N 3.35Å; I31-Y33 PolarHBondContact O-N 3.05Å; I31-Y34 PolarHBondContact O-N 3.04Å; I31-I35 HydrophobicContact CG2-CD1 3.88Å; I31-I35 HydrophobicContact CG2-CG1 4.46Å; I31-I35 WeakPolarHBondContact O-CG1 3.5Å; I31-I35 PolarHBondContact O-N 3.02Å
32	N	98	Very high	95.3	Very high	83 Å²	83	103.3 Å²	103.3	44%	0.444	49%	0.488	S	S	.	.	H	α-helix	trans	-62.4	-42.4	179.3	-75.6	-30	0	0	0	112	I28 E29 F30 Y34 I35 I36	I28-N32 WeakPolarHBondContact O-CB 3.44Å; I28-N32 VanDerWaalsContact O-CG 3.29Å; I28-N32 PolarHBondContact O-N 3.29Å; I28-N32 PolarHBondContact O-ND2 3.37Å; E29-N32 PolarHBondContact O-N 3.46Å; F30-N32 PolarHBondContact O-N 3.48Å; N32-Y34 VanDerWaalsContact C-N 3.34Å; N32-Y34 PolarHBondContact O-N 3.39Å; N32-I35 PolarHBondContact O-N 3.05Å; N32-I36 WeakPolarHBondContact O-CG1 3.42Å; N32-I36 PolarHBondContact O-N 2.96Å
33	Y	97.7	Very high	95.6	Very high	142 Å²	142	107 Å²	107	56%	0.557	50%	0.503	S	S	*	.	H	α-helix	trans	-57.4	-46.7	173.1	173.9	-102.5	0	0	0	111.6	E29 F30 I31 I35 I36 L37	E29-Y33 WeakPolarHBondContact O-CB 3.29Å; E29-Y33 PolarHBondContact O-N 3.33Å; F30-Y33 PolarHBondContact O-N 3.47Å; I31-Y33 VanDerWaalsContact C-N 3.35Å; I31-Y33 PolarHBondContact O-N 3.05Å; Y33-I35 PolarHBondContact O-N 3.47Å; Y33-I36 WeakPolarHBondContact O-CB 3.38Å; Y33-I36 PolarHBondContact O-N 3.2Å; Y33-L37 HydrophobicContact CD1-CD1 4.01Å; Y33-L37 HydrophobicContact CD1-CG 4.48Å; Y33-L37 HydrophobicContact CE1-CD1 3.33Å; Y33-L37 HydrophobicContact CE1-CG 4.05Å; Y33-L37 HydrophobicContact CE2-CD1 4.39Å; Y33-L37 HydrophobicContact CE2-CD2 4.41Å; Y33-L37 HydrophobicContact CE2-CG 4.33Å; Y33-L37 PolarHBondContact O-N 3.19Å
34	Y	97.4	Very high	95.9	Very high	133 Å²	133	110.2 Å²	110.2	52%	0.522	51%	0.512	S	S	.	.	H	α-helix	trans	-63.7	-40	178.7	-168.6	-108.2	0	0	0	112.8	F30 I31 N32 I36 L37 L38	F30-Y34 PolarHBondContact O-N 3.36Å; I31-Y34 PolarHBondContact O-N 3.04Å; N32-Y34 VanDerWaalsContact C-N 3.34Å; N32-Y34 PolarHBondContact O-N 3.39Å; Y34-I36 VanDerWaalsContact C-N 3.31Å; Y34-I36 PolarHBondContact O-N 3.42Å; Y34-L37 PolarHBondContact O-N 3.06Å; Y34-L38 HydrophobicContact CD1-CD1 3.67Å; Y34-L38 HydrophobicContact CD1-CG 4.13Å; Y34-L38 HydrophobicContact CE1-CD1 3.44Å; Y34-L38 VanDerWaalsContact CE1-CD1 3.44Å; Y34-L38 HydrophobicContact CE1-CD2 4.24Å; Y34-L38 HydrophobicContact CE1-CG 3.86Å; Y34-L38 WeakPolarHBondContact O-CG 3.34Å; Y34-L38 PolarHBondContact O-N 3.27Å
35	I	98.1	Very high	96.1	Very high	62 Å²	62	110.1 Å²	110.1	32%	0.318	52%	0.516	S	S	.	.	H	α-helix	trans	-60.1	-41.7	174.2	-69.8	168.4	0	0	0	111.2	I31 N32 Y33 L38 R39	I31-I35 HydrophobicContact CG2-CD1 3.88Å; I31-I35 HydrophobicContact CG2-CG1 4.46Å; I31-I35 WeakPolarHBondContact O-CG1 3.5Å; I31-I35 PolarHBondContact O-N 3.02Å; N32-I35 PolarHBondContact O-N 3.05Å; Y33-I35 PolarHBondContact O-N 3.47Å; I35-L38 PolarHBondContact O-N 3.32Å; I35-R39 HydrophobicContact CG2-CG 4.44Å; I35-R39 WeakPolarHBondContact O-CB 3.48Å; I35-R39 VanDerWaalsContact O-CG 3.29Å; I35-R39 WeakPolarHBondContact O-CG 3.3Å; I35-R39 PolarHBondContact O-N 3.48Å
36	I	97.8	Very high	96.4	Very high	92 Å²	92	109.4 Å²	109.4	47%	0.472	52%	0.518	S	S	.	.	H	α-helix	trans	-63.3	-45.7	177.3	-68.5	164.9	0	0	0	110.6	N32 Y33 Y34 L38 R39 N40	N32-I36 WeakPolarHBondContact O-CG1 3.42Å; N32-I36 PolarHBondContact O-N 2.96Å; Y33-I36 WeakPolarHBondContact O-CB 3.38Å; Y33-I36 PolarHBondContact O-N 3.2Å; Y34-I36 VanDerWaalsContact C-N 3.31Å; Y34-I36 PolarHBondContact O-N 3.42Å; I36-L38 PolarHBondContact O-N 3.45Å; I36-R39 PolarHBondContact O-N 2.95Å; I36-N40 PolarHBondContact O-N 2.92Å; I36-N40 PolarHBondContact O-ND2 3.31Å
37	L	96.8	Very high	96.3	Very high	79 Å²	79	105 Å²	105	41%	0.414	51%	0.511	S	S	.	.	H	α-helix	trans	-59.2	-46.5	176.3	-70.2	-176.3	0	0	0	112	Y33 Y34 R39 N40 G41	Y33-L37 HydrophobicContact CD1-CD1 4.01Å; Y33-L37 HydrophobicContact CD1-CG 4.48Å; Y33-L37 HydrophobicContact CE1-CD1 3.33Å; Y33-L37 HydrophobicContact CE1-CG 4.05Å; Y33-L37 HydrophobicContact CE2-CD1 4.39Å; Y33-L37 HydrophobicContact CE2-CD2 4.41Å; Y33-L37 HydrophobicContact CE2-CG 4.33Å; Y33-L37 PolarHBondContact O-N 3.19Å; Y34-L37 PolarHBondContact O-N 3.06Å; L37-R39 PolarHBondContact O-N 3.42Å; L37-N40 PolarHBondContact O-N 2.88Å; L37-G41 PolarHBondContact O-N 3.47Å
38	L	97.2	Very high	96.2	Very high	82 Å²	82	101.6 Å²	101.6	43%	0.429	50%	0.498	S	S	.	.	H	α-helix	trans	-59.7	-45.7	176.8	-75.6	175.3	0	0	0	112.1	Y34 I35 I36 N40 G41 I42	Y34-L38 HydrophobicContact CD1-CD1 3.67Å; Y34-L38 HydrophobicContact CD1-CG 4.13Å; Y34-L38 HydrophobicContact CE1-CD1 3.44Å; Y34-L38 VanDerWaalsContact CE1-CD1 3.44Å; Y34-L38 HydrophobicContact CE1-CD2 4.24Å; Y34-L38 HydrophobicContact CE1-CG 3.86Å; Y34-L38 WeakPolarHBondContact O-CG 3.34Å; Y34-L38 PolarHBondContact O-N 3.27Å; I35-L38 PolarHBondContact O-N 3.32Å; I36-L38 PolarHBondContact O-N 3.45Å; L38-N40 VanDerWaalsContact C-N 3.34Å; L38-N40 PolarHBondContact O-N 3.01Å; L38-G41 PolarHBondContact O-N 2.9Å; L38-I42 VanDerWaalsContact O-CG1 3.3Å; L38-I42 WeakPolarHBondContact O-CG1 3.29Å; L38-I42 PolarHBondContact O-N 2.96Å
39	R	97.6	Very high	96.1	Very high	174 Å²	174	104.7 Å²	104.7	66%	0.657	51%	0.505	S	S	*	.	H	α-helix	trans	-60.2	-43.1	178.1	-74.8	173.1	178.2	-179.9	1.6	111.8	I35 I36 L37 K43	I35-R39 HydrophobicContact CG2-CG 4.44Å; I35-R39 WeakPolarHBondContact O-CB 3.48Å; I35-R39 VanDerWaalsContact O-CG 3.29Å; I35-R39 WeakPolarHBondContact O-CG 3.3Å; I35-R39 PolarHBondContact O-N 3.48Å; I36-R39 PolarHBondContact O-N 2.95Å; L37-R39 PolarHBondContact O-N 3.42Å; R39-K43 PolarHBondContact O-N 3.26Å
40	N	96.3	Very high	95.8	Very high	97 Å²	97	103.7 Å²	103.7	52%	0.519	51%	0.506	S	S	.	.	H	α-helix	trans	-67.1	-40.6	176.8	-71.9	-23	0	0	0	111.9	I36 L37 L38 K43 Y44	I36-N40 PolarHBondContact O-N 2.92Å; I36-N40 PolarHBondContact O-ND2 3.31Å; L37-N40 PolarHBondContact O-N 2.88Å; L38-N40 VanDerWaalsContact C-N 3.34Å; L38-N40 PolarHBondContact O-N 3.01Å; N40-K43 PolarHBondContact O-N 3.34Å; N40-Y44 PolarHBondContact O-N 3.43Å
41	G	95.8	Very high	95.5	Very high	32 Å²	32	104.9 Å²	104.9	33%	0.33	51%	0.507	S	S	.	.	H	α-helix	trans	-60.1	-47.3	174.6	0	0	0	0	0	112.5	L37 L38 K43 Y44 L45	L37-G41 PolarHBondContact O-N 3.47Å; L38-G41 PolarHBondContact O-N 2.9Å; G41-K43 VanDerWaalsContact C-N 3.34Å; G41-K43 PolarHBondContact O-N 3.46Å; G41-Y44 PolarHBondContact O-N 3.39Å; G41-L45 WeakPolarHBondContact O-CG 3.41Å; G41-L45 PolarHBondContact O-N 3.44Å
42	I	97	Very high	95.1	Very high	104 Å²	104	104.3 Å²	104.3	53%	0.533	51%	0.505	S	S	.	.	H	α-helix	trans	-61.5	-42.2	177	-67.6	165.2	0	0	0	111	L38 Y44 L45 T46	L38-I42 VanDerWaalsContact O-CG1 3.3Å; L38-I42 WeakPolarHBondContact O-CG1 3.29Å; L38-I42 PolarHBondContact O-N 2.96Å; I42-Y44 PolarHBondContact O-N 2.99Å; I42-L45 PolarHBondContact O-N 2.92Å; I42-T46 HydrophobicContact CG2-CG2 4.27Å; I42-T46 WeakPolarHBondContact O-CB 3.44Å; I42-T46 WeakPolarHBondContact O-CG2 3.47Å; I42-T46 PolarHBondContact O-N 2.96Å; I42-T46 PolarHBondContact O-OG1 2.78Å
43	K	95.3	Very high	94.6	Very high	159 Å²	159	106.7 Å²	106.7	69%	0.691	51%	0.508	S	S	*	.	H	α-helix	trans	-61.7	-42.6	176.8	-174.8	-180	177.6	-177.1	0	112.3	R39 N40 G41 T46 G47	R39-K43 PolarHBondContact O-N 3.26Å; N40-K43 PolarHBondContact O-N 3.34Å; G41-K43 VanDerWaalsContact C-N 3.34Å; G41-K43 PolarHBondContact O-N 3.46Å; K43-T46 WeakPolarHBondContact CA-OG1 3.42Å; K43-T46 PolarHBondContact O-OG1 3.36Å; K43-G47 PolarHBondContact O-N 2.8Å
44	Y	95.5	Very high	94	Very high	171 Å²	171	103.1 Å²	103.1	67%	0.671	50%	0.501	S	S	*	.	H	α-helix	trans	-64.1	-46.1	177.1	177.1	-97.4	0	0	0	111.9	N40 G41 I42 G47 T48	N40-Y44 PolarHBondContact O-N 3.43Å; G41-Y44 PolarHBondContact O-N 3.39Å; I42-Y44 PolarHBondContact O-N 2.99Å; Y44-G47 PolarHBondContact O-N 3.48Å; Y44-T48 WeakPolarHBondContact O-CB 3.34Å; Y44-T48 PolarHBondContact O-N 3.27Å; Y44-T48 PolarHBondContact O-OG1 3.06Å
45	L	95.1	Very high	93.4	Very high	117 Å²	117	98.1 Å²	98.1	61%	0.613	49%	0.485	S	S	*	.	H	α-helix	trans	-63.9	-45.3	179.8	-70.4	172.8	0	0	0	112.1	G41 I42 T48 Y49	G41-L45 WeakPolarHBondContact O-CG 3.41Å; G41-L45 PolarHBondContact O-N 3.44Å; I42-L45 PolarHBondContact O-N 2.92Å; L45-T48 PolarHBondContact O-N 2.98Å; L45-Y49 WeakPolarHBondContact O-CB 3.34Å; L45-Y49 PolarHBondContact O-N 2.99Å
46	T	93.9	Very high	92.7	Very high	75 Å²	75	100.8 Å²	100.8	46%	0.46	50%	0.496	S	S	.	.	H	α-helix	trans	-63.1	-44.9	177.8	47.8	0	0	0	0	111.8	I42 K43 T48 Y49 T50	I42-T46 HydrophobicContact CG2-CG2 4.27Å; I42-T46 WeakPolarHBondContact O-CB 3.44Å; I42-T46 WeakPolarHBondContact O-CG2 3.47Å; I42-T46 PolarHBondContact O-N 2.96Å; I42-T46 PolarHBondContact O-OG1 2.78Å; K43-T46 WeakPolarHBondContact CA-OG1 3.42Å; K43-T46 PolarHBondContact O-OG1 3.36Å; T46-T48 VanDerWaalsContact C-N 3.35Å; T46-T48 PolarHBondContact O-N 3.28Å; T46-Y49 PolarHBondContact O-N 2.97Å; T46-T50 PolarHBondContact O-N 3.02Å; T46-T50 PolarHBondContact O-OG1 2.73Å; T46-T50 VanDerWaalsContact O-OG1 3.08Å
47	G	92.1	Very high	92.1	Very high	42 Å²	42	100.6 Å²	100.6	43%	0.433	50%	0.496	S	S	.	.	H	α-helix	trans	-59.6	-42.8	174.3	0	0	0	0	0	113.1	K43 Y44 Y51	K43-G47 PolarHBondContact O-N 2.8Å; Y44-G47 PolarHBondContact O-N 3.48Å; G47-Y51 WeakPolarHBondContact O-CB 3.31Å; G47-Y51 PolarHBondContact O-N 2.85Å
48	T	93.2	Very high	91.4	Very high	50 Å²	50	100.5 Å²	100.5	31%	0.307	50%	0.495	S	S	.	.	H	α-helix	trans	-66.9	-43.1	178	-54.3	0	0	0	0	111.7	Y44 L45 T46 Y51 I52	Y44-T48 WeakPolarHBondContact O-CB 3.34Å; Y44-T48 PolarHBondContact O-N 3.27Å; Y44-T48 PolarHBondContact O-OG1 3.06Å; L45-T48 PolarHBondContact O-N 2.98Å; T46-T48 VanDerWaalsContact C-N 3.35Å; T46-T48 PolarHBondContact O-N 3.28Å; T48-Y51 PolarHBondContact O-N 3.44Å; T48-I52 HydrophobicContact CG2-CD1 3.99Å; T48-I52 WeakPolarHBondContact O-CG1 3.35Å; T48-I52 PolarHBondContact O-N 3.33Å
49	Y	91.9	Very high	90.7	Very high	166 Å²	166	102 Å²	102	65%	0.651	50%	0.501	S	S	*	.	H	α-helix	trans	-62.1	-44.9	177.1	-179.5	-99	0	0	0	111.6	L45 T46 Y51 I52 Y53	L45-Y49 WeakPolarHBondContact O-CB 3.34Å; L45-Y49 PolarHBondContact O-N 2.99Å; T46-Y49 PolarHBondContact O-N 2.97Å; Y49-Y51 VanDerWaalsContact C-N 3.34Å; Y49-Y51 PolarHBondContact O-N 3.33Å; Y49-I52 PolarHBondContact O-N 2.93Å; Y49-Y53 WeakPolarHBondContact O-CB 3.36Å; Y49-Y53 PolarHBondContact O-N 3.5Å
50	T	90.9	Very high	89.8	Confident	81 Å²	81	95.7 Å²	95.7	50%	0.497	49%	0.489	S	S	.	.	H	α-helix	trans	-61	-43.3	174.9	-59.7	0	0	0	0	111.5	T46 I52 Y53 V54	T46-T50 PolarHBondContact O-N 3.02Å; T46-T50 PolarHBondContact O-OG1 2.73Å; T46-T50 VanDerWaalsContact O-OG1 3.08Å; T50-I52 PolarHBondContact O-N 2.93Å; T50-Y53 PolarHBondContact O-N 3.08Å; T50-V54 HydrophobicContact CG2-CG2 4.27Å; T50-V54 WeakPolarHBondContact O-CB 3.49Å; T50-V54 VanDerWaalsContact O-CG2 3.31Å; T50-V54 WeakPolarHBondContact O-CG2 3.33Å; T50-V54 PolarHBondContact O-N 3.37Å
51	Y	90.6	Very high	88.8	Confident	168 Å²	168	97.4 Å²	97.4	66%	0.659	50%	0.496	S	S	*	.	H	α-helix	trans	-59.5	-47.2	177.1	177.2	-96.2	0	0	0	112.3	G47 T48 Y49 S55	G47-Y51 WeakPolarHBondContact O-CB 3.31Å; G47-Y51 PolarHBondContact O-N 2.85Å; T48-Y51 PolarHBondContact O-N 3.44Å; Y49-Y51 VanDerWaalsContact C-N 3.34Å; Y49-Y51 PolarHBondContact O-N 3.33Å; Y51-S55 WeakPolarHBondContact O-CB 3.36Å; Y51-S55 PolarHBondContact O-N 3.48Å; Y51-S55 PolarHBondContact O-OG 2.93Å
52	I	89.8	Confident	87.8	Confident	82 Å²	82	102.3 Å²	102.3	42%	0.421	51%	0.508	S	S	.	.	H	α-helix	trans	-62.5	-45.7	178	-68.5	167.3	0	0	0	110.6	T48 Y49 T50 S55 H56	T48-I52 HydrophobicContact CG2-CD1 3.99Å; T48-I52 WeakPolarHBondContact O-CG1 3.35Å; T48-I52 PolarHBondContact O-N 3.33Å; Y49-I52 PolarHBondContact O-N 2.93Å; T50-I52 PolarHBondContact O-N 2.93Å; I52-S55 PolarHBondContact O-N 3.36Å; I52-H56 PolarHBondContact O-CD2 3.17Å; I52-H56 PolarHBondContact O-N 2.99Å
53	Y	87.6	Confident	86.8	Confident	133 Å²	133	101 Å²	101	52%	0.522	51%	0.508	S	S	.	.	H	α-helix	trans	-61.6	-47.3	-179.9	-177.9	-104.9	0	0	0	112.3	Y49 T50 H56 L57	Y49-Y53 WeakPolarHBondContact O-CB 3.36Å; Y49-Y53 PolarHBondContact O-N 3.5Å; T50-Y53 PolarHBondContact O-N 3.08Å; Y53-H56 PolarHBondContact O-N 2.86Å; Y53-L57 HydrophobicContact CD1-CD1 4.01Å; Y53-L57 HydrophobicContact CE1-CD1 3.49Å; Y53-L57 VanDerWaalsContact CE1-CD1 3.49Å; Y53-L57 HydrophobicContact CE1-CG 4.29Å; Y53-L57 WeakPolarHBondContact O-CG 3.26Å; Y53-L57 PolarHBondContact O-N 2.9Å; Y53-L57 VanDerWaalsContact O-N 3.1Å
54	V	84.8	Confident	85.8	Confident	66 Å²	66	99 Å²	99	40%	0.4	51%	0.505	S	S	.	.	H	α-helix	trans	-64.1	-42	176.9	174	0	0	0	0	111	T50 H56 L57 D58	T50-V54 HydrophobicContact CG2-CG2 4.27Å; T50-V54 WeakPolarHBondContact O-CB 3.49Å; T50-V54 VanDerWaalsContact O-CG2 3.31Å; T50-V54 WeakPolarHBondContact O-CG2 3.33Å; T50-V54 PolarHBondContact O-N 3.37Å; V54-H56 VanDerWaalsContact C-N 3.31Å; V54-H56 PolarHBondContact O-N 3.41Å; V54-L57 PolarHBondContact O-N 3.38Å; V54-L57 VanDerWaalsContact O-N 3.14Å; V54-D58 PolarHBondContact O-N 2.91Å
55	S	85.2	Confident	84.7	Confident	28 Å²	28	97.1 Å²	97.1	20%	0.196	50%	0.502	C	S	.	.	H	α-helix	trans	-59.7	-41.5	177.3	-57.9	0	0	0	0	111.9	Y51 I52 D58 E59	Y51-S55 WeakPolarHBondContact O-CB 3.36Å; Y51-S55 PolarHBondContact O-N 3.48Å; Y51-S55 PolarHBondContact O-OG 2.93Å; I52-S55 PolarHBondContact O-N 3.36Å; S55-D58 PolarHBondContact O-N 3.14Å; S55-E59 WeakPolarHBondContact O-CB 3.24Å; S55-E59 VanDerWaalsContact O-CG 3.26Å; S55-E59 WeakPolarHBondContact O-CG 3.41Å; S55-E59 PolarHBondContact O-N 3.35Å
56	H	83	Confident	83.7	Confident	119 Å²	119	98.7 Å²	98.7	55%	0.551	51%	0.508	S	S	*	.	H	α-helix	trans	-68	-34.4	175.9	-76.1	-51.9	0	0	0	113.6	I52 Y53 V54 E59 G60	I52-H56 PolarHBondContact O-CD2 3.17Å; I52-H56 PolarHBondContact O-N 2.99Å; Y53-H56 PolarHBondContact O-N 2.86Å; V54-H56 VanDerWaalsContact C-N 3.31Å; V54-H56 PolarHBondContact O-N 3.41Å; H56-E59 IonicContact ND1-OE2 3.69Å; H56-G60 PolarHBondContact O-N 2.94Å
57	L	83.7	Confident	82.5	Confident	87 Å²	87	102.7 Å²	102.7	46%	0.455	52%	0.524	S	S	.	.	H	α-helix	trans	-66.8	-44.2	173.3	-69.5	178	0	0	0	111	Y53 V54 G60 M61	Y53-L57 HydrophobicContact CD1-CD1 4.01Å; Y53-L57 HydrophobicContact CE1-CD1 3.49Å; Y53-L57 VanDerWaalsContact CE1-CD1 3.49Å; Y53-L57 HydrophobicContact CE1-CG 4.29Å; Y53-L57 WeakPolarHBondContact O-CG 3.26Å; Y53-L57 PolarHBondContact O-N 2.9Å; Y53-L57 VanDerWaalsContact O-N 3.1Å; V54-L57 PolarHBondContact O-N 3.38Å; V54-L57 VanDerWaalsContact O-N 3.14Å; L57-G60 PolarHBondContact O-N 3.43Å; L57-M61 WeakPolarHBondContact O-CG 3.31Å; L57-M61 PolarHBondContact O-N 2.87Å
58	D	84	Confident	81.5	Confident	77 Å²	77	111.6 Å²	111.6	41%	0.412	54%	0.544	S	S	.	.	H	α-helix	trans	-65.4	-40.5	177.8	-73.8	-17.9	0	0	0	111.9	V54 S55 M61 K62	V54-D58 PolarHBondContact O-N 2.91Å; S55-D58 PolarHBondContact O-N 3.14Å; D58-M61 PolarHBondContact O-N 3.1Å; D58-K62 WeakPolarHBondContact O-CB 3.36Å; D58-K62 VanDerWaalsContact O-CG 3.24Å; D58-K62 WeakPolarHBondContact O-CG 3.47Å; D58-K62 PolarHBondContact O-N 3.37Å
59	E	80.7	Confident	80.2	Confident	115 Å²	115	118.5 Å²	118.5	54%	0.537	58%	0.578	S	S	.	*	H	α-helix	trans	-64.8	-40.3	172.7	-75.5	174.4	-178.6	0	0	111.8	S55 H56 K62 S63	S55-E59 WeakPolarHBondContact O-CB 3.24Å; S55-E59 VanDerWaalsContact O-CG 3.26Å; S55-E59 WeakPolarHBondContact O-CG 3.41Å; S55-E59 PolarHBondContact O-N 3.35Å; H56-E59 IonicContact ND1-OE2 3.69Å; E59-K62 PolarHBondContact O-N 3.01Å; E59-S63 VanDerWaalsContact O-CB 3.27Å; E59-S63 WeakPolarHBondContact O-CB 3.27Å; E59-S63 PolarHBondContact O-N 2.87Å
60	G	79.6	Confident	79.6	Confident	40 Å²	40	116.1 Å²	116.1	41%	0.412	57%	0.574	S	S	.	*	H	α-helix	trans	-61.6	-42.8	173.9	0	0	0	0	0	112.3	H56 L57 N64	H56-G60 PolarHBondContact O-N 2.94Å; L57-G60 PolarHBondContact O-N 3.43Å; G60-N64 VanDerWaalsContact O-CB 3.31Å; G60-N64 WeakPolarHBondContact O-CB 3.37Å; G60-N64 PolarHBondContact O-N 3.4Å
61	M	75.7	Confident	79	Confident	134 Å²	134	117.9 Å²	117.9	66%	0.66	58%	0.579	S	S	*	*	H	α-helix	trans	-65.3	-46.6	174.9	-72.4	-176.8	69	0	0	111.8	L57 D58 S63 N64 E65	L57-M61 WeakPolarHBondContact O-CG 3.31Å; L57-M61 PolarHBondContact O-N 2.87Å; D58-M61 PolarHBondContact O-N 3.1Å; M61-S63 PolarHBondContact O-N 3.26Å; M61-N64 PolarHBondContact O-N 3.45Å; M61-E65 WeakPolarHBondContact O-CB 3.42Å; M61-E65 PolarHBondContact O-N 2.86Å
62	K	75	Confident	78.4	Confident	134 Å²	134	115.2 Å²	115.2	58%	0.583	57%	0.574	S	S	*	*	H	α-helix	trans	-61	-41.7	177.2	-74.6	169.9	-177.5	171.6	0	112.5	D58 E59 E65 M66	D58-K62 WeakPolarHBondContact O-CB 3.36Å; D58-K62 VanDerWaalsContact O-CG 3.24Å; D58-K62 WeakPolarHBondContact O-CG 3.47Å; D58-K62 PolarHBondContact O-N 3.37Å; E59-K62 PolarHBondContact O-N 3.01Å; K62-E65 PolarHBondContact O-N 3.25Å; K62-M66 PolarHBondContact O-N 2.89Å
63	S	75.3	Confident	77.7	Confident	78 Å²	78	117.1 Å²	117.1	55%	0.545	58%	0.583	S	S	.	*	H	α-helix	trans	-65.1	-41.8	176.6	-174.7	0	0	0	0	111.6	E59 M61 M66 M67	E59-S63 VanDerWaalsContact O-CB 3.27Å; E59-S63 WeakPolarHBondContact O-CB 3.27Å; E59-S63 PolarHBondContact O-N 2.87Å; M61-S63 PolarHBondContact O-N 3.26Å; S63-M66 PolarHBondContact O-N 3.25Å; S63-M67 PolarHBondContact O-N 2.99Å
64	N	74	Confident	77.1	Confident	116 Å²	116	116.1 Å²	116.1	62%	0.62	59%	0.587	S	S	*	*	H	α-helix	trans	-70.2	-32.6	178	-157.2	32.9	0	0	0	112.5	G60 M61 R68	G60-N64 VanDerWaalsContact O-CB 3.31Å; G60-N64 WeakPolarHBondContact O-CB 3.37Å; G60-N64 PolarHBondContact O-N 3.4Å; M61-N64 PolarHBondContact O-N 3.45Å; N64-R68 PolarHBondContact O-N 3.23Å
65	E	73.1	Confident	76.6	Confident	132 Å²	132	119.5 Å²	119.5	62%	0.617	60%	0.599	S	S	*	*	H	α-helix	trans	-71	-41.2	173.6	-168	170.6	-163.8	0	0	111.7	M61 K62 M67 R68 L69	M61-E65 WeakPolarHBondContact O-CB 3.42Å; M61-E65 PolarHBondContact O-N 2.86Å; K62-E65 PolarHBondContact O-N 3.25Å; E65-M67 VanDerWaalsContact C-N 3.32Å; E65-M67 PolarHBondContact O-N 3.12Å; E65-R68 PolarHBondContact O-N 3.44Å; E65-R68 VanDerWaalsContact O-N 3.12Å; E65-L69 PolarHBondContact O-N 3.42Å
66	M	73.3	Confident	76	Confident	149 Å²	149	126 Å²	126	73%	0.734	63%	0.628	S	S	*	*	H	α-helix	trans	-62.9	-34.3	171.7	-83.8	-177	-174.1	0	0	113	K62 S63 R68	K62-M66 PolarHBondContact O-N 2.89Å; S63-M66 PolarHBondContact O-N 3.25Å; M66-R68 VanDerWaalsContact C-N 3.25Å; M66-R68 PolarHBondContact O-N 3.47Å
67	M	69	Low	75.4	Confident	159 Å²	159	126.5 Å²	126.5	78%	0.783	63%	0.634	S	S	*	*	H	α-helix	trans	-71.6	-21.2	175	-176.1	169.7	-79.1	0	0	112.7	S63 E65	S63-M67 PolarHBondContact O-N 2.99Å; E65-M67 VanDerWaalsContact C-N 3.32Å; E65-M67 PolarHBondContact O-N 3.12Å
68	R	71.3	Confident	74.7	Confident	229 Å²	229	129.8 Å²	129.8	86%	0.864	65%	0.649	S	S	*	*	H	α-helix	trans	-85.4	-21.8	177.9	-172.3	174.9	175.6	-172.4	-1.9	113	N64 E65 M66	N64-R68 PolarHBondContact O-N 3.23Å; E65-R68 PolarHBondContact O-N 3.44Å; E65-R68 VanDerWaalsContact O-N 3.12Å; M66-R68 VanDerWaalsContact C-N 3.25Å; M66-R68 PolarHBondContact O-N 3.47Å
69	L	66	Low	73.9	Confident	195 Å²	195	134.6 Å²	134.6	100%	1.021	67%	0.671	S	S	*	*			trans	-84.7	0	175.9	-68.4	173.6	0	0	0	111.4	E65	E65-L69 PolarHBondContact O-N 3.42Å

Retrieved 69 of 69 residues in 14.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).