A0A5K4F704_SCHMA Loading...

MEG

AlphaFold DB , UniProt , Accession A0A5K4F704, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 64 aa.

						>A0A5K4F704_SCHMA|A0A5K4F704
MNIIFVIGVLLVFQTFQSAETNNSTDSSNNTTQSAWDQFHTWLNLICTIFSLWETIKGILSSWW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.5	Low	72	Confident	191 Å²	191	89.1 Å²	89.1	94%	0.941	48%	0.476	S	S	*	.				0	111.9	0	-102.7	166.2	115.6	0	108.6	I3 V6	M1-I3 PolarHBondContact O-N 3.07Å; M1-V6 HydrophobicContact CE-CG2 4.48Å
2	N	64.4	Low	72.3	Confident	91 Å²	91	87.7 Å²	87.7	49%	0.487	47%	0.473	S	S	.	.			trans	-75.5	110	178.9	-160.1	-26.7	0	0	108.6	I4 F5	N2-I4 PolarHBondContact O-N 3.17Å; N2-I4 VanDerWaalsContact O-N 3.09Å; N2-F5 WeakPolarHBondContact O-CB 3.36Å; N2-F5 PolarHBondContact O-N 3.22Å
3	I	73.8	Confident	72	Confident	120 Å²	120	83.6 Å²	83.6	62%	0.615	45%	0.448	S	S	*	.	H	α-helix	trans	-55	-29.8	-176.2	-166.8	166.5	0	0	112.4	M1 F5 V6 I7	M1-I3 PolarHBondContact O-N 3.07Å; I3-F5 VanDerWaalsContact C-N 3.28Å; I3-F5 PolarHBondContact O-N 2.89Å; I3-V6 PolarHBondContact O-N 3.44Å; I3-I7 HydrophobicContact CG1-CD1 4.04Å; I3-I7 HydrophobicContact CG1-CG1 4.47Å; I3-I7 WeakPolarHBondContact O-CG1 3.37Å; I3-I7 PolarHBondContact O-N 2.8Å
4	I	74.6	Confident	71.9	Confident	120 Å²	120	85.4 Å²	85.4	62%	0.615	45%	0.452	S	S	*	.	H	α-helix	trans	-60.5	-38.4	177.1	-60.3	171	0	0	111.2	N2 I7 G8	N2-I4 PolarHBondContact O-N 3.17Å; N2-I4 VanDerWaalsContact O-N 3.09Å; I4-I7 PolarHBondContact O-N 3.35Å; I4-G8 PolarHBondContact O-N 3.3Å
5	F	71	Confident	71.7	Confident	64 Å²	64	85.6 Å²	85.6	28%	0.281	46%	0.458	S	S	.	.	H	α-helix	trans	-66.2	-44.5	178.6	-178.6	-97.8	0	0	111.2	N2 I3 I7 G8 V9 F50	N2-F5 WeakPolarHBondContact O-CB 3.36Å; N2-F5 PolarHBondContact O-N 3.22Å; I3-F5 VanDerWaalsContact C-N 3.28Å; I3-F5 PolarHBondContact O-N 2.89Å; F5-I7 VanDerWaalsContact C-N 3.34Å; F5-I7 PolarHBondContact O-N 2.77Å; F5-G8 PolarHBondContact O-N 2.96Å; F5-V9 HydrophobicContact CD1-CG2 4.19Å; F5-V9 HydrophobicContact CE1-CG2 3.78Å; F5-V9 HydrophobicContact CE2-CG2 4.29Å; F5-V9 HydrophobicContact CZ-CG2 3.84Å; F5-V9 WeakPolarHBondContact O-CG2 3.42Å; F5-V9 PolarHBondContact O-N 2.77Å; F5-F50 HydrophobicContact CB-CE1 4.28Å; F5-F50 AromaticContact CD1-CD1 3.78Å; F5-F50 HydrophobicContact CD1-CD1 3.78Å; F5-F50 AromaticContact CD1-CE1 3.96Å; F5-F50 HydrophobicContact CD1-CE1 3.96Å; F5-F50 HydrophobicContact CD1-CG 4.33Å; F5-F50 HydrophobicContact CD2-CD1 4.49Å; F5-F50 HydrophobicContact CD2-CE1 4.19Å; F5-F50 HydrophobicContact CD2-CE2 4.27Å; F5-F50 HydrophobicContact CD2-CZ 4.08Å; F5-F50 HydrophobicContact CE1-CB 4.14Å; F5-F50 AromaticContact CE1-CD1 3.78Å; F5-F50 HydrophobicContact CE1-CD1 3.78Å; F5-F50 HydrophobicContact CE1-CE1 4.34Å; F5-F50 AromaticContact CE1-CG 3.89Å; F5-F50 HydrophobicContact CE1-CG 3.89Å; F5-F50 HydrophobicContact CE2-CD1 4.49Å; F5-F50 HydrophobicContact CE2-CD2 4.1Å; F5-F50 HydrophobicContact CE2-CE2 4.18Å; F5-F50 HydrophobicContact CE2-CG 4.26Å; F5-F50 HydrophobicContact CE2-CZ 4.41Å; F5-F50 HydrophobicContact CG-CD1 4.15Å; F5-F50 AromaticContact CG-CE1 3.87Å; F5-F50 HydrophobicContact CG-CE1 3.87Å; F5-F50 HydrophobicContact CG-CZ 4.19Å; F5-F50 HydrophobicContact CZ-CB 4.15Å; F5-F50 HydrophobicContact CZ-CD1 4.15Å; F5-F50 HydrophobicContact CZ-CD2 4.09Å; F5-F50 AromaticContact CZ-CG 3.85Å; F5-F50 HydrophobicContact CZ-CG 3.85Å
6	V	74.3	Confident	71.4	Confident	60 Å²	60	87.2 Å²	87.2	36%	0.364	46%	0.46	S	S	.	.	H	α-helix	trans	-62	-44.2	177.4	179.8	0	0	0	110.4	M1 I3 G8 V9 L10	M1-V6 HydrophobicContact CE-CG2 4.48Å; I3-V6 PolarHBondContact O-N 3.44Å; V6-G8 VanDerWaalsContact C-N 3.35Å; V6-G8 PolarHBondContact O-N 2.85Å; V6-V9 PolarHBondContact O-N 3.49Å; V6-L10 HydrophobicContact CG1-CD1 3.9Å; V6-L10 HydrophobicContact CG1-CG 4.4Å; V6-L10 WeakPolarHBondContact O-CB 3.26Å; V6-L10 VanDerWaalsContact O-CG 3.24Å; V6-L10 WeakPolarHBondContact O-CG 3.3Å; V6-L10 PolarHBondContact O-N 3.28Å
7	I	76.6	Confident	71	Confident	83 Å²	83	87.4 Å²	87.4	43%	0.426	46%	0.458	S	S	.	.	H	α-helix	trans	-61.8	-43.5	175.7	-65.5	165	0	0	110.8	I3 I4 F5 V9 L10 L11	I3-I7 HydrophobicContact CG1-CD1 4.04Å; I3-I7 HydrophobicContact CG1-CG1 4.47Å; I3-I7 WeakPolarHBondContact O-CG1 3.37Å; I3-I7 PolarHBondContact O-N 2.8Å; I4-I7 PolarHBondContact O-N 3.35Å; F5-I7 VanDerWaalsContact C-N 3.34Å; F5-I7 PolarHBondContact O-N 2.77Å; I7-V9 PolarHBondContact O-N 2.9Å; I7-L10 PolarHBondContact O-N 2.85Å; I7-L11 HydrophobicContact CG2-CD1 3.88Å; I7-L11 HydrophobicContact CG2-CG 4.25Å; I7-L11 WeakPolarHBondContact O-CB 3.28Å; I7-L11 VanDerWaalsContact O-CG 3.32Å; I7-L11 WeakPolarHBondContact O-CG 3.38Å; I7-L11 PolarHBondContact O-N 3.13Å
8	G	75.2	Confident	70.5	Confident	33 Å²	33	86.3 Å²	86.3	34%	0.34	46%	0.459	S	S	.	.	H	α-helix	trans	-60.4	-45.5	178	0	0	0	0	112.6	I4 F5 V6 L11 V12	I4-G8 PolarHBondContact O-N 3.3Å; F5-G8 PolarHBondContact O-N 2.96Å; V6-G8 VanDerWaalsContact C-N 3.35Å; V6-G8 PolarHBondContact O-N 2.85Å; G8-L11 PolarHBondContact O-N 3.48Å; G8-V12 WeakPolarHBondContact O-CG2 3.35Å; G8-V12 PolarHBondContact O-N 3.37Å; G8-V12 VanDerWaalsContact O-N 3.08Å
9	V	75.1	Confident	70.1	Confident	29 Å²	29	85 Å²	85	18%	0.176	46%	0.461	C	S	.	.	H	α-helix	trans	-64.1	-41.8	176.3	174.3	0	0	0	111.3	F5 V6 I7 V12 F13 L43	F5-V9 HydrophobicContact CD1-CG2 4.19Å; F5-V9 HydrophobicContact CE1-CG2 3.78Å; F5-V9 HydrophobicContact CE2-CG2 4.29Å; F5-V9 HydrophobicContact CZ-CG2 3.84Å; F5-V9 WeakPolarHBondContact O-CG2 3.42Å; F5-V9 PolarHBondContact O-N 2.77Å; V6-V9 PolarHBondContact O-N 3.49Å; I7-V9 PolarHBondContact O-N 2.9Å; V9-V12 PolarHBondContact O-N 3.25Å; V9-F13 VanDerWaalsContact O-CB 3.29Å; V9-F13 WeakPolarHBondContact O-CB 3.39Å; V9-F13 PolarHBondContact O-N 2.87Å; V9-L43 HydrophobicContact CG1-CD1 3.48Å; V9-L43 VanDerWaalsContact CG1-CD1 3.48Å; V9-L43 HydrophobicContact CG1-CD2 3.73Å; V9-L43 HydrophobicContact CG1-CG 3.64Å
10	L	74.9	Confident	69.3	Low	93 Å²	93	83.8 Å²	83.8	49%	0.487	45%	0.452	S	S	.	.	H	α-helix	trans	-65.9	-37.4	176.9	-73.4	170.1	0	0	113	V6 I7 F13 Q14	V6-L10 HydrophobicContact CG1-CD1 3.9Å; V6-L10 HydrophobicContact CG1-CG 4.4Å; V6-L10 WeakPolarHBondContact O-CB 3.26Å; V6-L10 VanDerWaalsContact O-CG 3.24Å; V6-L10 WeakPolarHBondContact O-CG 3.3Å; V6-L10 PolarHBondContact O-N 3.28Å; I7-L10 PolarHBondContact O-N 2.85Å; L10-F13 WeakPolarHBondContact O-CB 3.44Å; L10-F13 PolarHBondContact O-N 3.48Å; L10-Q14 WeakPolarHBondContact O-CG 3.46Å; L10-Q14 PolarHBondContact O-N 2.98Å
11	L	74.8	Confident	68.8	Low	96 Å²	96	84.1 Å²	84.1	50%	0.503	46%	0.458	S	S	.	.	H	α-helix	trans	-67.6	-45.7	176.9	-74.9	171.5	0	0	111.2	I7 G8 F13 Q14 T15	I7-L11 HydrophobicContact CG2-CD1 3.88Å; I7-L11 HydrophobicContact CG2-CG 4.25Å; I7-L11 WeakPolarHBondContact O-CB 3.28Å; I7-L11 VanDerWaalsContact O-CG 3.32Å; I7-L11 WeakPolarHBondContact O-CG 3.38Å; I7-L11 PolarHBondContact O-N 3.13Å; G8-L11 PolarHBondContact O-N 3.48Å; L11-F13 VanDerWaalsContact C-N 3.28Å; L11-F13 PolarHBondContact O-N 2.8Å; L11-Q14 PolarHBondContact O-N 3.18Å; L11-T15 WeakPolarHBondContact O-CG2 3.5Å; L11-T15 PolarHBondContact O-N 2.86Å; L11-T15 PolarHBondContact O-OG1 2.9Å
12	V	75.6	Confident	68.6	Low	72 Å²	72	81.2 Å²	81.2	44%	0.436	45%	0.446	S	S	.	.	H	α-helix	trans	-58.1	-46.1	174.8	173.2	0	0	0	109.8	G8 V9 Q14 T15 F16	G8-V12 WeakPolarHBondContact O-CG2 3.35Å; G8-V12 PolarHBondContact O-N 3.37Å; G8-V12 VanDerWaalsContact O-N 3.08Å; V9-V12 PolarHBondContact O-N 3.25Å; V12-Q14 PolarHBondContact O-N 2.83Å; V12-T15 WeakPolarHBondContact CA-OG1 3.5Å; V12-T15 PolarHBondContact O-N 2.92Å; V12-T15 VanDerWaalsContact O-N 3.14Å; V12-T15 PolarHBondContact O-OG1 3.44Å; V12-F16 HydrophobicContact CG1-CD2 3.6Å; V12-F16 HydrophobicContact CG1-CE2 3.43Å; V12-F16 VanDerWaalsContact CG1-CE2 3.43Å; V12-F16 VanDerWaalsContact O-CD2 3.25Å; V12-F16 WeakPolarHBondContact O-CD2 3.33Å; V12-F16 PolarHBondContact O-N 3.46Å
13	F	68.8	Low	68	Low	35 Å²	35	83.2 Å²	83.2	15%	0.154	46%	0.457	C	S	.	.	H	α-helix	trans	-54.4	-49.1	174.9	177.9	-92.3	0	0	113.5	V9 L10 L11 T15 F16 Q17 W36 F39 H40 L43	V9-F13 VanDerWaalsContact O-CB 3.29Å; V9-F13 WeakPolarHBondContact O-CB 3.39Å; V9-F13 PolarHBondContact O-N 2.87Å; L10-F13 WeakPolarHBondContact O-CB 3.44Å; L10-F13 PolarHBondContact O-N 3.48Å; L11-F13 VanDerWaalsContact C-N 3.28Å; L11-F13 PolarHBondContact O-N 2.8Å; F13-T15 VanDerWaalsContact C-N 3.3Å; F13-T15 PolarHBondContact O-N 3.47Å; F13-F16 PolarHBondContact O-N 3.45Å; F13-Q17 WeakPolarHBondContact O-CB 3.39Å; F13-Q17 PolarHBondContact O-N 2.92Å; F13-W36 HydrophobicContact CD1-CH2 4.26Å; F13-W36 AromaticContact CD2-CH2 3.72Å; F13-W36 HydrophobicContact CD2-CH2 3.72Å; F13-W36 HydrophobicContact CD2-CZ2 4.31Å; F13-W36 HydrophobicContact CD2-CZ3 4.38Å; F13-W36 AromaticContact CE1-CH2 3.77Å; F13-W36 HydrophobicContact CE1-CH2 3.77Å; F13-W36 AromaticContact CE1-CZ2 3.87Å; F13-W36 HydrophobicContact CE1-CZ2 3.87Å; F13-W36 AromaticContact CE2-CH2 3.11Å; F13-W36 HydrophobicContact CE2-CH2 3.11Å; F13-W36 AromaticContact CE2-CZ2 3.28Å; F13-W36 HydrophobicContact CE2-CZ2 3.28Å; F13-W36 AromaticContact CE2-CZ3 4Å; F13-W36 HydrophobicContact CE2-CZ3 4Å; F13-W36 HydrophobicContact CG-CH2 4.25Å; F13-W36 AromaticContact CZ-CH2 3.2Å; F13-W36 HydrophobicContact CZ-CH2 3.2Å; F13-W36 AromaticContact CZ-CZ2 3.04Å; F13-W36 HydrophobicContact CZ-CZ2 3.04Å; F13-W36 HydrophobicContact CZ-CZ3 4.42Å; F13-F39 HydrophobicContact CD2-CD1 4.3Å; F13-F39 AromaticContact CD2-CE1 3.78Å; F13-F39 HydrophobicContact CD2-CE1 3.78Å; F13-F39 HydrophobicContact CE2-CE1 4.5Å; F13-H40 AromaticContact CE2-CE1 3.16Å; F13-H40 WeakPolarHBondContact CE2-CE1 3.33Å; F13-H40 AromaticContact CE2-ND1 3.84Å; F13-H40 AromaticContact CE2-NE2 3.34Å; F13-H40 VanDerWaalsContact CE2-NE2 3.34Å; F13-H40 WeakPolarHBondContact CE2-NE2 3.33Å; F13-H40 AromaticContact CZ-CE1 3.35Å; F13-H40 WeakPolarHBondContact CZ-CE1 3.32Å; F13-H40 AromaticContact CZ-NE2 3.48Å; F13-H40 WeakPolarHBondContact CZ-NE2 3.35Å; F13-L43 HydrophobicContact CD2-CD1 4.42Å
14	Q	69.8	Low	66.9	Low	108 Å²	108	80 Å²	80	51%	0.505	45%	0.445	S	S	.	.	H	α-helix	trans	-62	-37	177.4	-75.1	177.6	-6.6	0	112.4	L10 L11 V12 S18	L10-Q14 WeakPolarHBondContact O-CG 3.46Å; L10-Q14 PolarHBondContact O-N 2.98Å; L11-Q14 PolarHBondContact O-N 3.18Å; V12-Q14 PolarHBondContact O-N 2.83Å; Q14-S18 VanDerWaalsContact O-CB 3.3Å; Q14-S18 WeakPolarHBondContact O-CB 3.4Å; Q14-S18 PolarHBondContact O-N 2.9Å; Q14-S18 PolarHBondContact O-OG 3.36Å
15	T	69.3	Low	66	Low	89 Å²	89	80.2 Å²	80.2	55%	0.546	45%	0.452	S	S	.	.	H	α-helix	trans	-68.6	-40.6	177.8	58.2	0	0	0	112.4	L11 V12 F13 S18 A19	L11-T15 WeakPolarHBondContact O-CG2 3.5Å; L11-T15 PolarHBondContact O-N 2.86Å; L11-T15 PolarHBondContact O-OG1 2.9Å; V12-T15 WeakPolarHBondContact CA-OG1 3.5Å; V12-T15 PolarHBondContact O-N 2.92Å; V12-T15 VanDerWaalsContact O-N 3.14Å; V12-T15 PolarHBondContact O-OG1 3.44Å; F13-T15 VanDerWaalsContact C-N 3.3Å; F13-T15 PolarHBondContact O-N 3.47Å; T15-S18 PolarHBondContact O-N 3.24Å; T15-A19 WeakPolarHBondContact O-CB 3.33Å; T15-A19 PolarHBondContact O-N 3.39Å
16	F	67.3	Low	65.1	Low	111 Å²	111	84.4 Å²	84.4	49%	0.487	48%	0.477	S	S	.	.	H	α-helix	trans	-64.5	-45.2	174.2	-83.3	-76.2	0	0	111.4	V12 F13 S18 A19 E20 F39	V12-F16 HydrophobicContact CG1-CD2 3.6Å; V12-F16 HydrophobicContact CG1-CE2 3.43Å; V12-F16 VanDerWaalsContact CG1-CE2 3.43Å; V12-F16 VanDerWaalsContact O-CD2 3.25Å; V12-F16 WeakPolarHBondContact O-CD2 3.33Å; V12-F16 PolarHBondContact O-N 3.46Å; F13-F16 PolarHBondContact O-N 3.45Å; F16-S18 VanDerWaalsContact C-N 3.32Å; F16-S18 PolarHBondContact O-N 2.88Å; F16-A19 PolarHBondContact O-N 3.44Å; F16-E20 WeakPolarHBondContact O-CB 3.42Å; F16-E20 PolarHBondContact O-N 3.35Å; F16-F39 HydrophobicContact CD2-CE2 4.42Å; F16-F39 AromaticContact CD2-CZ 3.99Å; F16-F39 HydrophobicContact CD2-CZ 3.99Å; F16-F39 HydrophobicContact CE2-CZ 4.49Å; F16-F39 HydrophobicContact CG-CZ 4.43Å
17	Q	63.7	Low	64.1	Low	91 Å²	91	85 Å²	85	43%	0.425	48%	0.484	S	S	.	.	H	α-helix	trans	-60.3	-42.4	176.7	-166.2	-179.1	9.5	0	112.3	F13 E20 T21 W36	F13-Q17 WeakPolarHBondContact O-CB 3.39Å; F13-Q17 PolarHBondContact O-N 2.92Å; Q17-E20 PolarHBondContact O-N 2.99Å; Q17-T21 WeakPolarHBondContact O-CB 3.29Å; Q17-T21 PolarHBondContact O-N 3.21Å; Q17-T21 PolarHBondContact O-OG1 2.94Å; Q17-W36 HydrophobicContact CB-CH2 3.73Å; Q17-W36 HydrophobicContact CB-CZ3 4.11Å; Q17-W36 HydrophobicContact CG-CH2 3.92Å; Q17-W36 HydrophobicContact CG-CZ2 4.31Å; Q17-W36 HydrophobicContact CG-CZ3 4.47Å
18	S	63.1	Low	63.1	Low	68 Å²	68	85.4 Å²	85.4	48%	0.476	49%	0.494	S	S	.	.	H	α-helix	trans	-66.6	-40.6	178.2	-59.6	0	0	0	111.5	Q14 T15 F16 E20 N22	Q14-S18 VanDerWaalsContact O-CB 3.3Å; Q14-S18 WeakPolarHBondContact O-CB 3.4Å; Q14-S18 PolarHBondContact O-N 2.9Å; Q14-S18 PolarHBondContact O-OG 3.36Å; T15-S18 PolarHBondContact O-N 3.24Å; F16-S18 VanDerWaalsContact C-N 3.32Å; F16-S18 PolarHBondContact O-N 2.88Å; S18-E20 VanDerWaalsContact C-N 3.33Å; S18-N22 PolarHBondContact O-N 2.86Å; S18-N22 PolarHBondContact O-ND2 2.95Å
19	A	62.7	Low	62.1	Low	61 Å²	61	89.8 Å²	89.8	50%	0.504	51%	0.51	S	S	.	.	H	α-helix	trans	-64.2	-37.8	175.5	0	0	0	0	112.1	T15 F16 N23	T15-A19 WeakPolarHBondContact O-CB 3.33Å; T15-A19 PolarHBondContact O-N 3.39Å; F16-A19 PolarHBondContact O-N 3.44Å; A19-N23 PolarHBondContact O-N 3.09Å
20	E	54	Low	61.2	Low	60 Å²	60	95.2 Å²	95.2	28%	0.28	54%	0.538	S	S	.	.	H	α-helix	trans	-77.5	-39	-178.4	-165.3	168.6	-173.2	0	112.8	F16 Q17 S18 N22 N23 S24 T32	F16-E20 WeakPolarHBondContact O-CB 3.42Å; F16-E20 PolarHBondContact O-N 3.35Å; Q17-E20 PolarHBondContact O-N 2.99Å; S18-E20 VanDerWaalsContact C-N 3.33Å; E20-N22 PolarHBondContact O-N 3.24Å; E20-N23 PolarHBondContact O-N 3.37Å; E20-S24 PolarHBondContact O-N 3.27Å; E20-T32 WeakPolarHBondContact OE1-CB 3.35Å
21	T	59.4	Low	60.4	Low	92 Å²	92	95.8 Å²	95.8	56%	0.564	55%	0.545	S	S	*	.	H	α-helix	trans	-57	-39.3	172.6	-56.4	0	0	0	111	Q17 N23 S24	Q17-T21 WeakPolarHBondContact O-CB 3.29Å; Q17-T21 PolarHBondContact O-N 3.21Å; Q17-T21 PolarHBondContact O-OG1 2.94Å; T21-N23 VanDerWaalsContact C-N 3.3Å; T21-N23 PolarHBondContact O-N 3.3Å; T21-S24 PolarHBondContact O-N 3.47Å
22	N	51.9	Low	59.7	Low	130 Å²	130	93.5 Å²	93.5	70%	0.695	54%	0.535	S	S	*	.	H	α-helix	trans	-72.6	-19.8	178.6	-67.4	-12.1	0	0	113.7	S18 E20	S18-N22 PolarHBondContact O-N 2.86Å; S18-N22 PolarHBondContact O-ND2 2.95Å; E20-N22 PolarHBondContact O-N 3.24Å
23	N	52.3	Low	59.3	Low	133 Å²	133	95.2 Å²	95.2	71%	0.711	54%	0.538	S	S	*	.	H	α-helix	trans	-93.5	-10.2	178.4	-161.1	39.9	0	0	112.8	A19 E20 T21 T25	A19-N23 PolarHBondContact O-N 3.09Å; E20-N23 PolarHBondContact O-N 3.37Å; T21-N23 VanDerWaalsContact C-N 3.3Å; T21-N23 PolarHBondContact O-N 3.3Å; N23-T25 VanDerWaalsContact C-N 3.34Å; N23-T25 PolarHBondContact O-N 2.98Å
24	S	51	Low	59.4	Low	52 Å²	52	96.4 Å²	96.4	36%	0.364	55%	0.551	S	S	.	*	T	Hydrogen-bonded Turn	trans	-83.6	0.7	-174.7	-172.6	0	0	0	114.7	E20 T21 D26	E20-S24 PolarHBondContact O-N 3.27Å; T21-S24 PolarHBondContact O-N 3.47Å; S24-D26 PolarHBondContact O-N 3.33Å
25	T	54.8	Low	59.5	Low	124 Å²	124	93.7 Å²	93.7	76%	0.761	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.7	-23.9	173.4	-52.4	0	0	0	112.1	N23	N23-T25 VanDerWaalsContact C-N 3.34Å; N23-T25 PolarHBondContact O-N 2.98Å
26	D	52.8	Low	59.7	Low	152 Å²	152	91.3 Å²	91.3	81%	0.813	53%	0.528	S	S	*	.	S	Bend	trans	-117.1	4.6	-167.1	-80.8	-22.1	0	0	117.9	S24	S24-D26 PolarHBondContact O-N 3.33Å
27	S	53.4	Low	60.2	Low	74 Å²	74	89.9 Å²	89.9	52%	0.517	53%	0.526	S	S	.	.	S	Bend	trans	-156.1	101.3	174.5	-164.7	0	0	0	115.8	N29	S27-N29 PolarHBondContact O-N 2.78Å
28	S	54.4	Low	60.8	Low	90 Å²	90	91 Å²	91	63%	0.629	53%	0.531	S	S	*	.			trans	33.6	68.1	144	57	0	0	0	118.8	N30	S28-N30 VanDerWaalsContact C-N 3.27Å; S28-N30 PolarHBondContact O-N 3.43Å
29	N	55.9	Low	61.6	Low	125 Å²	125	90.5 Å²	90.5	67%	0.668	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	27.3	-1.4	143.2	-64.2	11.7	0	0	124.7	S27	S27-N29 PolarHBondContact O-N 2.78Å
30	N	55	Low	62.5	Low	144 Å²	144	90.4 Å²	90.4	77%	0.77	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-119.2	-25.5	-176.4	-79.4	16.6	0	0	114.3	S28	S28-N30 VanDerWaalsContact C-N 3.27Å; S28-N30 PolarHBondContact O-N 3.43Å
31	T	59.4	Low	63.7	Low	104 Å²	104	92.2 Å²	92.2	64%	0.638	53%	0.525	S	S	*	.	H	α-helix	trans	-82.5	-31.1	-175.6	1.7	0	0	0	113.1
32	T	59.6	Low	64.8	Low	49 Å²	49	95.7 Å²	95.7	30%	0.301	53%	0.527	S	S	.	.	H	α-helix	trans	-71.5	-43.1	-174.6	49.5	0	0	0	112.7	E20 S34 A35 W36	E20-T32 WeakPolarHBondContact OE1-CB 3.35Å; T32-S34 PolarHBondContact O-N 3.18Å; T32-S34 VanDerWaalsContact O-N 3.15Å; T32-A35 PolarHBondContact O-N 3.45Å; T32-W36 PolarHBondContact O-N 2.93Å
33	Q	66.2	Low	66.2	Low	107 Å²	107	91 Å²	91	50%	0.5	50%	0.502	S	S	.	.	H	α-helix	trans	-55.1	-39	178.1	-172.7	64.6	40.5	0	111.8	W36 D37	Q33-W36 PolarHBondContact O-N 3.44Å; Q33-D37 PolarHBondContact NE2-OD1 3.04Å; Q33-D37 WeakPolarHBondContact O-CB 3.4Å; Q33-D37 PolarHBondContact O-N 3.28Å
34	S	71	Confident	67.5	Low	61 Å²	61	89.4 Å²	89.4	43%	0.427	49%	0.494	S	S	.	.	H	α-helix	trans	-66.6	-41.4	179	-174.5	0	0	0	112.7	T32 W36 Q38	T32-S34 PolarHBondContact O-N 3.18Å; T32-S34 VanDerWaalsContact O-N 3.15Å; S34-W36 VanDerWaalsContact C-N 3.32Å; S34-Q38 WeakPolarHBondContact O-CB 3.34Å; S34-Q38 VanDerWaalsContact O-CG 3.28Å; S34-Q38 WeakPolarHBondContact O-CG 3.45Å; S34-Q38 PolarHBondContact O-N 2.97Å
35	A	72.3	Confident	69	Low	50 Å²	50	91.2 Å²	91.2	41%	0.413	50%	0.499	S	S	.	.	H	α-helix	trans	-65.5	-39.1	176.5	0	0	0	0	111.2	T32 Q38 F39	T32-A35 PolarHBondContact O-N 3.45Å; A35-Q38 PolarHBondContact O-N 3.48Å; A35-F39 WeakPolarHBondContact O-CB 3.46Å; A35-F39 PolarHBondContact O-N 2.9Å
36	W	73.7	Confident	70.4	Confident	39 Å²	39	89.7 Å²	89.7	15%	0.148	49%	0.485	C	S	.	.	H	α-helix	trans	-64.2	-46.7	176.8	-174.6	-111.3	0	0	113	F13 Q17 T32 Q33 S34 Q38 F39 H40	F13-W36 HydrophobicContact CD1-CH2 4.26Å; F13-W36 AromaticContact CD2-CH2 3.72Å; F13-W36 HydrophobicContact CD2-CH2 3.72Å; F13-W36 HydrophobicContact CD2-CZ2 4.31Å; F13-W36 HydrophobicContact CD2-CZ3 4.38Å; F13-W36 AromaticContact CE1-CH2 3.77Å; F13-W36 HydrophobicContact CE1-CH2 3.77Å; F13-W36 AromaticContact CE1-CZ2 3.87Å; F13-W36 HydrophobicContact CE1-CZ2 3.87Å; F13-W36 AromaticContact CE2-CH2 3.11Å; F13-W36 HydrophobicContact CE2-CH2 3.11Å; F13-W36 AromaticContact CE2-CZ2 3.28Å; F13-W36 HydrophobicContact CE2-CZ2 3.28Å; F13-W36 AromaticContact CE2-CZ3 4Å; F13-W36 HydrophobicContact CE2-CZ3 4Å; F13-W36 HydrophobicContact CG-CH2 4.25Å; F13-W36 AromaticContact CZ-CH2 3.2Å; F13-W36 HydrophobicContact CZ-CH2 3.2Å; F13-W36 AromaticContact CZ-CZ2 3.04Å; F13-W36 HydrophobicContact CZ-CZ2 3.04Å; F13-W36 HydrophobicContact CZ-CZ3 4.42Å; Q17-W36 HydrophobicContact CB-CH2 3.73Å; Q17-W36 HydrophobicContact CB-CZ3 4.11Å; Q17-W36 HydrophobicContact CG-CH2 3.92Å; Q17-W36 HydrophobicContact CG-CZ2 4.31Å; Q17-W36 HydrophobicContact CG-CZ3 4.47Å; T32-W36 PolarHBondContact O-N 2.93Å; Q33-W36 PolarHBondContact O-N 3.44Å; S34-W36 VanDerWaalsContact C-N 3.32Å; W36-Q38 VanDerWaalsContact C-N 3.31Å; W36-Q38 PolarHBondContact O-N 3.49Å; W36-F39 HydrophobicContact CE3-CD1 4.35Å; W36-F39 HydrophobicContact CZ3-CD1 4.14Å; W36-F39 PolarHBondContact O-N 3.48Å; W36-H40 AromaticContact CD1-CD2 3.62Å; W36-H40 AromaticContact CD1-NE2 3.89Å; W36-H40 AromaticContact CD2-CD2 3.94Å; W36-H40 AromaticContact CE2-CD2 3.49Å; W36-H40 VanDerWaalsContact CE2-CD2 3.49Å; W36-H40 AromaticContact CE2-NE2 3.18Å; W36-H40 AromaticContact CZ2-NE2 3.36Å; W36-H40 WeakPolarHBondContact CZ2-NE2 3.24Å; W36-H40 AromaticContact NE1-CD2 3.24Å; W36-H40 PolarHBondContact NE1-CD2 3.48Å; W36-H40 AromaticContact NE1-NE2 3.02Å; W36-H40 PolarHBondContact NE1-NE2 2.86Å; W36-H40 PolarHBondContact O-CD2 2.93Å; W36-H40 PolarHBondContact O-N 3.39Å
37	D	78.5	Confident	71.8	Confident	82 Å²	82	84.6 Å²	84.6	44%	0.439	46%	0.461	S	S	.	.	H	α-helix	trans	-63.6	-38.5	177	-67.5	-20.2	0	0	111.5	Q33 T41	Q33-D37 PolarHBondContact NE2-OD1 3.04Å; Q33-D37 WeakPolarHBondContact O-CB 3.4Å; Q33-D37 PolarHBondContact O-N 3.28Å; D37-T41 PolarHBondContact O-N 2.89Å; D37-T41 VanDerWaalsContact O-N 3.08Å; D37-T41 PolarHBondContact O-OG1 3.38Å
38	Q	76	Confident	73.1	Confident	115 Å²	115	85.4 Å²	85.4	54%	0.537	46%	0.463	S	S	.	.	H	α-helix	trans	-63.1	-47.3	172.6	-74.5	178.4	14.5	0	111.1	S34 A35 W36 H40 T41 W42	S34-Q38 WeakPolarHBondContact O-CB 3.34Å; S34-Q38 VanDerWaalsContact O-CG 3.28Å; S34-Q38 WeakPolarHBondContact O-CG 3.45Å; S34-Q38 PolarHBondContact O-N 2.97Å; A35-Q38 PolarHBondContact O-N 3.48Å; W36-Q38 VanDerWaalsContact C-N 3.31Å; W36-Q38 PolarHBondContact O-N 3.49Å; Q38-H40 VanDerWaalsContact C-N 3.35Å; Q38-H40 PolarHBondContact O-N 3.28Å; Q38-T41 WeakPolarHBondContact O-CB 3.39Å; Q38-T41 PolarHBondContact O-N 3.48Å; Q38-T41 VanDerWaalsContact O-N 3.1Å; Q38-W42 PolarHBondContact O-N 2.94Å
39	F	80.3	Confident	74.6	Confident	57 Å²	57	85.9 Å²	85.9	25%	0.25	46%	0.457	C	S	.	.	H	α-helix	trans	-58.6	-44.9	178.5	-179.5	-109.7	0	0	112.2	F13 F16 A35 W36 T41 W42 L43	F13-F39 HydrophobicContact CD2-CD1 4.3Å; F13-F39 AromaticContact CD2-CE1 3.78Å; F13-F39 HydrophobicContact CD2-CE1 3.78Å; F13-F39 HydrophobicContact CE2-CE1 4.5Å; F16-F39 HydrophobicContact CD2-CE2 4.42Å; F16-F39 AromaticContact CD2-CZ 3.99Å; F16-F39 HydrophobicContact CD2-CZ 3.99Å; F16-F39 HydrophobicContact CE2-CZ 4.49Å; F16-F39 HydrophobicContact CG-CZ 4.43Å; A35-F39 WeakPolarHBondContact O-CB 3.46Å; A35-F39 PolarHBondContact O-N 2.9Å; W36-F39 HydrophobicContact CE3-CD1 4.35Å; W36-F39 HydrophobicContact CZ3-CD1 4.14Å; W36-F39 PolarHBondContact O-N 3.48Å; F39-T41 VanDerWaalsContact C-N 3.3Å; F39-T41 PolarHBondContact O-N 3.39Å; F39-W42 PolarHBondContact O-N 3.08Å; F39-L43 HydrophobicContact CE1-CD1 4Å; F39-L43 HydrophobicContact CZ-CD1 4.03Å; F39-L43 WeakPolarHBondContact O-CB 3.48Å; F39-L43 PolarHBondContact O-N 3.42Å
40	H	80	Confident	75.9	Confident	59 Å²	59	82.9 Å²	82.9	27%	0.273	44%	0.438	S	S	.	.	H	α-helix	trans	-58	-41.6	173.4	-91.1	-74.9	0	0	112.9	F13 W36 Q38 L43 N44	F13-H40 AromaticContact CE2-CE1 3.16Å; F13-H40 WeakPolarHBondContact CE2-CE1 3.33Å; F13-H40 AromaticContact CE2-ND1 3.84Å; F13-H40 AromaticContact CE2-NE2 3.34Å; F13-H40 VanDerWaalsContact CE2-NE2 3.34Å; F13-H40 WeakPolarHBondContact CE2-NE2 3.33Å; F13-H40 AromaticContact CZ-CE1 3.35Å; F13-H40 WeakPolarHBondContact CZ-CE1 3.32Å; F13-H40 AromaticContact CZ-NE2 3.48Å; F13-H40 WeakPolarHBondContact CZ-NE2 3.35Å; W36-H40 AromaticContact CD1-CD2 3.62Å; W36-H40 AromaticContact CD1-NE2 3.89Å; W36-H40 AromaticContact CD2-CD2 3.94Å; W36-H40 AromaticContact CE2-CD2 3.49Å; W36-H40 VanDerWaalsContact CE2-CD2 3.49Å; W36-H40 AromaticContact CE2-NE2 3.18Å; W36-H40 AromaticContact CZ2-NE2 3.36Å; W36-H40 WeakPolarHBondContact CZ2-NE2 3.24Å; W36-H40 AromaticContact NE1-CD2 3.24Å; W36-H40 PolarHBondContact NE1-CD2 3.48Å; W36-H40 AromaticContact NE1-NE2 3.02Å; W36-H40 PolarHBondContact NE1-NE2 2.86Å; W36-H40 PolarHBondContact O-CD2 2.93Å; W36-H40 PolarHBondContact O-N 3.39Å; Q38-H40 VanDerWaalsContact C-N 3.35Å; Q38-H40 PolarHBondContact O-N 3.28Å; H40-L43 PolarHBondContact O-N 2.94Å; H40-N44 WeakPolarHBondContact O-CB 3.49Å; H40-N44 PolarHBondContact O-N 3.45Å
41	T	80.7	Confident	77.2	Confident	98 Å²	98	78.5 Å²	78.5	60%	0.601	42%	0.419	S	S	*	.	H	α-helix	trans	-63.8	-45.5	177.5	-57.6	0	0	0	111.2	D37 Q38 F39 L43 N44 L45	D37-T41 PolarHBondContact O-N 2.89Å; D37-T41 VanDerWaalsContact O-N 3.08Å; D37-T41 PolarHBondContact O-OG1 3.38Å; Q38-T41 WeakPolarHBondContact O-CB 3.39Å; Q38-T41 PolarHBondContact O-N 3.48Å; Q38-T41 VanDerWaalsContact O-N 3.1Å; F39-T41 VanDerWaalsContact C-N 3.3Å; F39-T41 PolarHBondContact O-N 3.39Å; T41-L43 VanDerWaalsContact C-N 3.34Å; T41-L43 PolarHBondContact O-N 2.68Å; T41-N44 PolarHBondContact O-N 3.42Å; T41-L45 PolarHBondContact O-N 3.24Å
42	W	81.4	Confident	78.4	Confident	164 Å²	164	78.4 Å²	78.4	62%	0.621	41%	0.414	S	S	*	.	H	α-helix	trans	-60.8	-42.5	175	-79.5	106.4	0	0	112.3	Q38 F39 L45 I46	Q38-W42 PolarHBondContact O-N 2.94Å; F39-W42 PolarHBondContact O-N 3.08Å; W42-L45 HydrophobicContact CE3-CD2 4.43Å; W42-L45 HydrophobicContact CZ3-CD2 4.5Å; W42-L45 WeakPolarHBondContact O-CB 3.32Å; W42-L45 PolarHBondContact O-N 2.97Å; W42-I46 WeakPolarHBondContact O-CG1 3.25Å; W42-I46 PolarHBondContact O-N 3.45Å
43	L	81.3	Confident	79.6	Confident	32 Å²	32	82.9 Å²	82.9	17%	0.168	43%	0.426	C	S	.	.	H	α-helix	trans	-66.4	-42.4	-180	-169.1	137.4	0	0	111.7	V9 F13 F39 H40 T41 L45 I46 C47	V9-L43 HydrophobicContact CG1-CD1 3.48Å; V9-L43 VanDerWaalsContact CG1-CD1 3.48Å; V9-L43 HydrophobicContact CG1-CD2 3.73Å; V9-L43 HydrophobicContact CG1-CG 3.64Å; F13-L43 HydrophobicContact CD2-CD1 4.42Å; F39-L43 HydrophobicContact CE1-CD1 4Å; F39-L43 HydrophobicContact CZ-CD1 4.03Å; F39-L43 WeakPolarHBondContact O-CB 3.48Å; F39-L43 PolarHBondContact O-N 3.42Å; H40-L43 PolarHBondContact O-N 2.94Å; T41-L43 VanDerWaalsContact C-N 3.34Å; T41-L43 PolarHBondContact O-N 2.68Å; L43-L45 VanDerWaalsContact C-N 3.32Å; L43-L45 PolarHBondContact O-N 3.41Å; L43-I46 PolarHBondContact O-N 3.14Å; L43-C47 WeakPolarHBondContact O-CB 3.43Å; L43-C47 PolarHBondContact O-N 3.02Å; L43-C47 PolarHBondContact O-SG 2.94Å
44	N	80.1	Confident	80.4	Confident	100 Å²	100	80.9 Å²	80.9	54%	0.535	42%	0.416	S	S	.	.	H	α-helix	trans	-61.6	-39.3	173.4	-81.8	-18.3	0	0	112.4	H40 T41 C47 T48	H40-N44 WeakPolarHBondContact O-CB 3.49Å; H40-N44 PolarHBondContact O-N 3.45Å; T41-N44 PolarHBondContact O-N 3.42Å; N44-C47 PolarHBondContact O-N 3.02Å; N44-T48 WeakPolarHBondContact O-CB 3.38Å; N44-T48 PolarHBondContact O-N 3.39Å; N44-T48 PolarHBondContact O-OG1 3.4Å
45	L	83.3	Confident	81	Confident	89 Å²	89	81.7 Å²	81.7	47%	0.466	42%	0.419	S	S	.	.	H	α-helix	trans	-62.7	-48.6	175.7	-175.5	70.2	0	0	111.1	T41 W42 L43 C47 T48 I49	T41-L45 PolarHBondContact O-N 3.24Å; W42-L45 HydrophobicContact CE3-CD2 4.43Å; W42-L45 HydrophobicContact CZ3-CD2 4.5Å; W42-L45 WeakPolarHBondContact O-CB 3.32Å; W42-L45 PolarHBondContact O-N 2.97Å; L43-L45 VanDerWaalsContact C-N 3.32Å; L43-L45 PolarHBondContact O-N 3.41Å; L45-C47 VanDerWaalsContact C-N 3.34Å; L45-C47 PolarHBondContact O-N 3.42Å; L45-T48 WeakPolarHBondContact O-CB 3.38Å; L45-T48 PolarHBondContact O-N 3.26Å; L45-I49 HydrophobicContact CD1-CD1 4.4Å; L45-I49 HydrophobicContact CG-CD1 3.97Å; L45-I49 WeakPolarHBondContact O-CG1 3.34Å; L45-I49 PolarHBondContact O-N 2.87Å
46	I	83	Confident	81.7	Confident	93 Å²	93	83.2 Å²	83.2	48%	0.477	42%	0.419	S	S	.	.	H	α-helix	trans	-61.3	-43.9	178.3	-67.2	165.4	0	0	110.7	W42 L43 T48 I49 F50	W42-I46 WeakPolarHBondContact O-CG1 3.25Å; W42-I46 PolarHBondContact O-N 3.45Å; L43-I46 PolarHBondContact O-N 3.14Å; I46-T48 VanDerWaalsContact C-N 3.32Å; I46-T48 PolarHBondContact O-N 3.24Å; I46-I49 PolarHBondContact O-N 3.42Å; I46-F50 WeakPolarHBondContact O-CB 3.16Å; I46-F50 PolarHBondContact O-N 2.86Å
47	C	82	Confident	82.2	Confident	45 Å²	45	85.9 Å²	85.9	30%	0.304	43%	0.432	S	S	.	.	H	α-helix	trans	-60.1	-41.4	175.5	-75.6	0	0	0	112.2	L43 N44 L45 F50 S51	L43-C47 WeakPolarHBondContact O-CB 3.43Å; L43-C47 PolarHBondContact O-N 3.02Å; L43-C47 PolarHBondContact O-SG 2.94Å; N44-C47 PolarHBondContact O-N 3.02Å; L45-C47 VanDerWaalsContact C-N 3.34Å; L45-C47 PolarHBondContact O-N 3.42Å; C47-F50 PolarHBondContact O-N 3.1Å; C47-S51 WeakPolarHBondContact O-CB 3.41Å; C47-S51 PolarHBondContact O-N 3.05Å
48	T	81.5	Confident	82.5	Confident	91 Å²	91	83.7 Å²	83.7	56%	0.558	43%	0.429	S	S	*	.	H	α-helix	trans	-65.3	-46.7	177.7	-57.6	0	0	0	111.1	N44 L45 I46 F50 S51 L52	N44-T48 WeakPolarHBondContact O-CB 3.38Å; N44-T48 PolarHBondContact O-N 3.39Å; N44-T48 PolarHBondContact O-OG1 3.4Å; L45-T48 WeakPolarHBondContact O-CB 3.38Å; L45-T48 PolarHBondContact O-N 3.26Å; I46-T48 VanDerWaalsContact C-N 3.32Å; I46-T48 PolarHBondContact O-N 3.24Å; T48-F50 VanDerWaalsContact C-N 3.32Å; T48-F50 PolarHBondContact O-N 3.08Å; T48-S51 PolarHBondContact O-N 2.94Å; T48-L52 WeakPolarHBondContact O-CB 3.47Å; T48-L52 PolarHBondContact O-N 3.43Å
49	I	85.4	Confident	82.9	Confident	99 Å²	99	82.4 Å²	82.4	51%	0.508	42%	0.424	S	S	.	.	H	α-helix	trans	-61.1	-43.2	177.3	-67.7	166.5	0	0	110.5	L45 I46 L52 W53	L45-I49 HydrophobicContact CD1-CD1 4.4Å; L45-I49 HydrophobicContact CG-CD1 3.97Å; L45-I49 WeakPolarHBondContact O-CG1 3.34Å; L45-I49 PolarHBondContact O-N 2.87Å; I46-I49 PolarHBondContact O-N 3.42Å; I49-L52 PolarHBondContact O-N 3.39Å; I49-W53 VanDerWaalsContact O-CB 3.28Å; I49-W53 WeakPolarHBondContact O-CB 3.3Å; I49-W53 PolarHBondContact O-N 2.75Å
50	F	82.4	Confident	82.9	Confident	62 Å²	62	85.1 Å²	85.1	27%	0.272	44%	0.441	S	S	.	.	H	α-helix	trans	-67.5	-42.2	179.6	-169.1	-95.9	0	0	112.2	F5 I46 C47 T48 L52 W53 E54	F5-F50 HydrophobicContact CB-CE1 4.28Å; F5-F50 AromaticContact CD1-CD1 3.78Å; F5-F50 HydrophobicContact CD1-CD1 3.78Å; F5-F50 AromaticContact CD1-CE1 3.96Å; F5-F50 HydrophobicContact CD1-CE1 3.96Å; F5-F50 HydrophobicContact CD1-CG 4.33Å; F5-F50 HydrophobicContact CD2-CD1 4.49Å; F5-F50 HydrophobicContact CD2-CE1 4.19Å; F5-F50 HydrophobicContact CD2-CE2 4.27Å; F5-F50 HydrophobicContact CD2-CZ 4.08Å; F5-F50 HydrophobicContact CE1-CB 4.14Å; F5-F50 AromaticContact CE1-CD1 3.78Å; F5-F50 HydrophobicContact CE1-CD1 3.78Å; F5-F50 HydrophobicContact CE1-CE1 4.34Å; F5-F50 AromaticContact CE1-CG 3.89Å; F5-F50 HydrophobicContact CE1-CG 3.89Å; F5-F50 HydrophobicContact CE2-CD1 4.49Å; F5-F50 HydrophobicContact CE2-CD2 4.1Å; F5-F50 HydrophobicContact CE2-CE2 4.18Å; F5-F50 HydrophobicContact CE2-CG 4.26Å; F5-F50 HydrophobicContact CE2-CZ 4.41Å; F5-F50 HydrophobicContact CG-CD1 4.15Å; F5-F50 AromaticContact CG-CE1 3.87Å; F5-F50 HydrophobicContact CG-CE1 3.87Å; F5-F50 HydrophobicContact CG-CZ 4.19Å; F5-F50 HydrophobicContact CZ-CB 4.15Å; F5-F50 HydrophobicContact CZ-CD1 4.15Å; F5-F50 HydrophobicContact CZ-CD2 4.09Å; F5-F50 AromaticContact CZ-CG 3.85Å; F5-F50 HydrophobicContact CZ-CG 3.85Å; I46-F50 WeakPolarHBondContact O-CB 3.16Å; I46-F50 PolarHBondContact O-N 2.86Å; C47-F50 PolarHBondContact O-N 3.1Å; T48-F50 VanDerWaalsContact C-N 3.32Å; T48-F50 PolarHBondContact O-N 3.08Å; F50-L52 VanDerWaalsContact C-N 3.32Å; F50-L52 PolarHBondContact O-N 3.2Å; F50-W53 WeakPolarHBondContact O-CB 3.42Å; F50-W53 PolarHBondContact O-N 3.43Å; F50-E54 HydrophobicContact CD1-CG 4.1Å; F50-E54 HydrophobicContact CE1-CG 3.7Å; F50-E54 HydrophobicContact CZ-CG 4.06Å; F50-E54 WeakPolarHBondContact O-CG 3.47Å; F50-E54 PolarHBondContact O-N 2.94Å
51	S	82.4	Confident	82.8	Confident	52 Å²	52	86.1 Å²	86.1	36%	0.364	46%	0.455	S	S	.	.	H	α-helix	trans	-61.8	-41.9	174.7	-167	0	0	0	111.6	C47 T48 E54 T55	C47-S51 WeakPolarHBondContact O-CB 3.41Å; C47-S51 PolarHBondContact O-N 3.05Å; T48-S51 PolarHBondContact O-N 2.94Å; S51-E54 PolarHBondContact O-N 3.4Å; S51-T55 WeakPolarHBondContact O-CB 3.28Å; S51-T55 PolarHBondContact O-N 3.32Å; S51-T55 PolarHBondContact O-OG1 3.02Å
52	L	86	Confident	82.5	Confident	103 Å²	103	85.9 Å²	85.9	54%	0.539	46%	0.457	S	S	.	.	H	α-helix	trans	-62.9	-44.2	174.2	-175.5	67.2	0	0	111.2	T48 I49 F50 T55 I56	T48-L52 WeakPolarHBondContact O-CB 3.47Å; T48-L52 PolarHBondContact O-N 3.43Å; I49-L52 PolarHBondContact O-N 3.39Å; F50-L52 VanDerWaalsContact C-N 3.32Å; F50-L52 PolarHBondContact O-N 3.2Å; L52-T55 WeakPolarHBondContact O-CB 3.38Å; L52-T55 PolarHBondContact O-N 2.96Å; L52-I56 HydrophobicContact CG-CD1 4.05Å; L52-I56 VanDerWaalsContact O-CG1 3.3Å; L52-I56 WeakPolarHBondContact O-CG1 3.35Å; L52-I56 PolarHBondContact O-N 3.05Å
53	W	84.8	Confident	82	Confident	142 Å²	142	87.9 Å²	87.9	54%	0.538	47%	0.465	S	S	.	.	H	α-helix	trans	-61.2	-43.9	177.6	175.8	-107.5	0	0	112.7	I49 F50 T55 I56 K57	I49-W53 VanDerWaalsContact O-CB 3.28Å; I49-W53 WeakPolarHBondContact O-CB 3.3Å; I49-W53 PolarHBondContact O-N 2.75Å; F50-W53 WeakPolarHBondContact O-CB 3.42Å; F50-W53 PolarHBondContact O-N 3.43Å; W53-T55 VanDerWaalsContact C-N 3.3Å; W53-T55 PolarHBondContact O-N 2.92Å; W53-I56 PolarHBondContact O-N 2.98Å; W53-K57 PolarHBondContact O-N 2.92Å
54	E	82.2	Confident	80.9	Confident	65 Å²	65	99.7 Å²	99.7	30%	0.304	51%	0.507	S	S	.	.	H	α-helix	trans	-67	-33.2	175.1	-69.4	-65.6	122	0	111.9	F50 S51 K57 G58	F50-E54 HydrophobicContact CD1-CG 4.1Å; F50-E54 HydrophobicContact CE1-CG 3.7Å; F50-E54 HydrophobicContact CZ-CG 4.06Å; F50-E54 WeakPolarHBondContact O-CG 3.47Å; F50-E54 PolarHBondContact O-N 2.94Å; S51-E54 PolarHBondContact O-N 3.4Å; E54-K57 PolarHBondContact O-N 3.37Å; E54-K57 WeakPolarHBondContact OE1-CD 3.36Å; E54-K57 IonicContact OE1-NZ 2.86Å; E54-K57 PolarHBondContact OE1-NZ 2.96Å; E54-G58 PolarHBondContact O-N 3.29Å
55	T	84.6	Confident	81	Confident	78 Å²	78	99.7 Å²	99.7	48%	0.479	51%	0.506	S	S	.	.	H	α-helix	trans	-65.2	-44.9	172.1	-54.9	0	0	0	110.8	S51 L52 W53 G58 I59	S51-T55 WeakPolarHBondContact O-CB 3.28Å; S51-T55 PolarHBondContact O-N 3.32Å; S51-T55 PolarHBondContact O-OG1 3.02Å; L52-T55 WeakPolarHBondContact O-CB 3.38Å; L52-T55 PolarHBondContact O-N 2.96Å; W53-T55 VanDerWaalsContact C-N 3.3Å; W53-T55 PolarHBondContact O-N 2.92Å; T55-G58 PolarHBondContact O-N 3.25Å; T55-I59 HydrophobicContact CG2-CD1 4.07Å; T55-I59 VanDerWaalsContact O-CG1 3.26Å; T55-I59 WeakPolarHBondContact O-CG1 3.48Å; T55-I59 PolarHBondContact O-N 3.31Å
56	I	87	Confident	80.8	Confident	83 Å²	83	100.2 Å²	100.2	43%	0.426	51%	0.508	S	S	.	.	H	α-helix	trans	-62.8	-43.4	176.3	-67.8	164.1	0	0	110.8	L52 W53 I59 L60	L52-I56 HydrophobicContact CG-CD1 4.05Å; L52-I56 VanDerWaalsContact O-CG1 3.3Å; L52-I56 WeakPolarHBondContact O-CG1 3.35Å; L52-I56 PolarHBondContact O-N 3.05Å; W53-I56 PolarHBondContact O-N 2.98Å; I56-I59 PolarHBondContact O-N 3.15Å; I56-L60 WeakPolarHBondContact O-CB 3.48Å; I56-L60 PolarHBondContact O-N 3.29Å
57	K	83.1	Confident	80.7	Confident	94 Å²	94	100.6 Å²	100.6	41%	0.409	51%	0.509	S	S	.	.	H	α-helix	trans	-60.4	-44.8	173.6	-81.5	174.7	166.2	172.5	112.1	W53 E54 I59 L60 S61	W53-K57 PolarHBondContact O-N 2.92Å; E54-K57 PolarHBondContact O-N 3.37Å; E54-K57 WeakPolarHBondContact OE1-CD 3.36Å; E54-K57 IonicContact OE1-NZ 2.86Å; E54-K57 PolarHBondContact OE1-NZ 2.96Å; K57-I59 VanDerWaalsContact C-N 3.33Å; K57-I59 PolarHBondContact O-N 2.92Å; K57-L60 PolarHBondContact O-N 3.19Å; K57-S61 WeakPolarHBondContact O-CB 3.46Å; K57-S61 PolarHBondContact O-N 3.38Å; K57-S61 PolarHBondContact O-OG 3.43Å; K57-S61 VanDerWaalsContact O-OG 3.13Å
58	G	84.6	Confident	80.6	Confident	36 Å²	36	103.9 Å²	103.9	37%	0.371	52%	0.521	S	S	.	.	H	α-helix	trans	-59.2	-45.4	177.3	0	0	0	0	111.6	E54 T55 S61 S62	E54-G58 PolarHBondContact O-N 3.29Å; T55-G58 PolarHBondContact O-N 3.25Å; G58-S61 WeakPolarHBondContact CA-OG 3.36Å; G58-S61 PolarHBondContact O-N 3.4Å; G58-S61 PolarHBondContact O-OG 3.43Å; G58-S62 PolarHBondContact O-N 3.44Å
59	I	84	Confident	80.6	Confident	88 Å²	88	104.7 Å²	104.7	45%	0.451	52%	0.519	S	S	.	.	H	α-helix	trans	-60.5	-53.4	172.1	-64.5	162.9	0	0	109.5	T55 I56 K57 S61 S62 W63	T55-I59 HydrophobicContact CG2-CD1 4.07Å; T55-I59 VanDerWaalsContact O-CG1 3.26Å; T55-I59 WeakPolarHBondContact O-CG1 3.48Å; T55-I59 PolarHBondContact O-N 3.31Å; I56-I59 PolarHBondContact O-N 3.15Å; K57-I59 VanDerWaalsContact C-N 3.33Å; K57-I59 PolarHBondContact O-N 2.92Å; I59-S61 PolarHBondContact O-N 2.82Å; I59-S61 VanDerWaalsContact O-N 3.17Å; I59-S62 PolarHBondContact O-N 3.39Å; I59-S62 PolarHBondContact O-OG 3.02Å; I59-W63 PolarHBondContact O-N 3.2Å
60	L	81.7	Confident	80.3	Confident	115 Å²	115	105.1 Å²	105.1	60%	0.602	52%	0.52	S	S	*	.	H	α-helix	trans	-59.3	-35.9	-177.3	-161.4	75.4	0	0	112.3	I56 K57 S62 W63	I56-L60 WeakPolarHBondContact O-CB 3.48Å; I56-L60 PolarHBondContact O-N 3.29Å; K57-L60 PolarHBondContact O-N 3.19Å; L60-S62 VanDerWaalsContact C-N 3.33Å; L60-W63 PolarHBondContact O-N 2.68Å
61	S	77.8	Confident	80.1	Confident	80 Å²	80	108.1 Å²	108.1	56%	0.559	54%	0.538	S	S	*	.	H	α-helix	trans	-73.1	-19.1	174.5	66.3	0	0	0	114.5	K57 G58 I59 W63 W64	K57-S61 WeakPolarHBondContact O-CB 3.46Å; K57-S61 PolarHBondContact O-N 3.38Å; K57-S61 PolarHBondContact O-OG 3.43Å; K57-S61 VanDerWaalsContact O-OG 3.13Å; G58-S61 WeakPolarHBondContact CA-OG 3.36Å; G58-S61 PolarHBondContact O-N 3.4Å; G58-S61 PolarHBondContact O-OG 3.43Å; I59-S61 PolarHBondContact O-N 2.82Å; I59-S61 VanDerWaalsContact O-N 3.17Å; S61-W63 VanDerWaalsContact C-N 3.33Å; S61-W64 VanDerWaalsContact O-OXT 3.11Å
62	S	74.7	Confident	79.9	Confident	92 Å²	92	112.5 Å²	112.5	64%	0.643	55%	0.551	S	S	*	*	H	α-helix	trans	-86.6	-9.8	173.7	79.6	0	0	0	112.6	G58 I59 L60	G58-S62 PolarHBondContact O-N 3.44Å; I59-S62 PolarHBondContact O-N 3.39Å; I59-S62 PolarHBondContact O-OG 3.02Å; L60-S62 VanDerWaalsContact C-N 3.33Å
63	W	69.4	Low	79.4	Confident	207 Å²	207	113.3 Å²	113.3	78%	0.784	55%	0.552	S	S	*	*	H	α-helix	trans	-95.5	-15	177.4	-75.1	60.9	0	0	113.2	I59 L60 S61	I59-W63 PolarHBondContact O-N 3.2Å; L60-W63 PolarHBondContact O-N 2.68Å; S61-W63 VanDerWaalsContact C-N 3.33Å
64	W	59.4	Low	79	Confident	279 Å²	279	110.6 Å²	110.6	100%	1.057	55%	0.553	S	S	*	*			trans	-107.1	0	172.7	-81.4	84.7	0	0	110.3	S61	S61-W64 VanDerWaalsContact O-OXT 3.11Å

Retrieved 64 of 64 residues in 22.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).