A0A5K4F766_SCHMA Loading...

U6 snRNA-associated Sm-like protein LSm2

Binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB , UniProt , Accession A0A5K4F766, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 98 aa.

						>A0A5K4F766_SCHMA|A0A5K4F766
MLFFSFFKTLVGKDVLIELKNDLCICGTLHSVDQYHNFKLTDISVTDPEKHPHMLSVKNCFIRGSIVRYVQLPADECDTIELQNASRKEATVGKQPQN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	88.5	Confident	95.3	Very high	117 Å²	117	64 Å²	64	58%	0.576	33%	0.328	S	S	*	.				0	3.3	0	-77.7	-70.3	96.9	0	0	114.1	F3 F4 S5 E89	M1-F3 PolarHBondContact O-N 2.83Å; M1-F4 HydrophobicContact SD-CB 4.4Å; M1-F4 HydrophobicContact SD-CD1 3.83Å; M1-F4 HydrophobicContact SD-CG 4.48Å; M1-S5 PolarHBondContact O-N 3.45Å; M1-S5 VanDerWaalsContact O-N 3.13Å; M1-S5 PolarHBondContact O-OG 3.03Å; M1-E89 PolarHBondContact N-OE1 3.36Å
2	L	94.4	Very high	95.5	Very high	24 Å²	24	62.9 Å²	62.9	13%	0.126	34%	0.344	C	S	.	.	H	α-helix	trans	-49	-62.2	-179.4	179.2	65.5	0	0	0	114.2	F4 S5 F6 L82 A85 S86 E89	L2-F4 PolarHBondContact O-N 3.17Å; L2-S5 PolarHBondContact O-N 2.95Å; L2-S5 VanDerWaalsContact O-N 3.15Å; L2-F6 PolarHBondContact O-N 3.33Å; L2-L82 HydrophobicContact CD1-CD1 4.27Å; L2-A85 HydrophobicContact CD1-CB 3.34Å; L2-S86 WeakPolarHBondContact CD2-OG 3.41Å; L2-E89 HydrophobicContact CB-CB 4.45Å; L2-E89 HydrophobicContact CB-CG 4.17Å
3	F	95.8	Very high	95.6	Very high	115 Å²	115	63.5 Å²	63.5	50%	0.504	34%	0.341	S	S	.	.	H	α-helix	trans	-68.7	-35.3	-172.6	-68	-65.2	0	0	0	113.8	M1 S5 F6 F7	M1-F3 PolarHBondContact O-N 2.83Å; F3-S5 VanDerWaalsContact C-N 3.3Å; F3-S5 PolarHBondContact O-N 3.45Å; F3-F6 PolarHBondContact O-N 2.86Å; F3-F7 HydrophobicContact CB-CD2 4.42Å; F3-F7 HydrophobicContact CB-CE2 4.35Å; F3-F7 WeakPolarHBondContact O-CD2 3.34Å; F3-F7 PolarHBondContact O-N 3.35Å
4	F	95.9	Very high	95.6	Very high	45 Å²	45	66.1 Å²	66.1	20%	0.197	36%	0.355	C	S	.	.	H	α-helix	trans	-58.1	-45.2	171.5	170.6	-121.3	0	0	0	111.4	M1 L2 K8 V32 D33	M1-F4 HydrophobicContact SD-CB 4.4Å; M1-F4 HydrophobicContact SD-CD1 3.83Å; M1-F4 HydrophobicContact SD-CG 4.48Å; L2-F4 PolarHBondContact O-N 3.17Å; F4-K8 HydrophobicContact CD2-CG 4.45Å; F4-K8 HydrophobicContact CE2-CD 4.46Å; F4-K8 HydrophobicContact CE2-CG 4.11Å; F4-K8 HydrophobicContact CZ-CD 4.35Å; F4-K8 HydrophobicContact CZ-CG 4.38Å; F4-K8 WeakPolarHBondContact O-CG 2.98Å; F4-K8 PolarHBondContact O-N 3.26Å; F4-K8 VanDerWaalsContact O-N 3.12Å; F4-V32 HydrophobicContact CD2-CG1 4.31Å; F4-V32 HydrophobicContact CE2-CG1 4.4Å; F4-D33 VanDerWaalsContact CD2-C 3.46Å; F4-D33 VanDerWaalsContact CD2-O 3.3Å; F4-D33 WeakPolarHBondContact CD2-O 3.37Å
5	S	95.4	Very high	95.7	Very high	64 Å²	64	62 Å²	62	45%	0.448	33%	0.334	S	S	.	.	H	α-helix	trans	-67.6	-40.6	178.5	-51.2	0	0	0	0	111.5	M1 L2 F3 K8 T9	M1-S5 PolarHBondContact O-N 3.45Å; M1-S5 VanDerWaalsContact O-N 3.13Å; M1-S5 PolarHBondContact O-OG 3.03Å; L2-S5 PolarHBondContact O-N 2.95Å; L2-S5 VanDerWaalsContact O-N 3.15Å; F3-S5 VanDerWaalsContact C-N 3.3Å; F3-S5 PolarHBondContact O-N 3.45Å; S5-K8 WeakPolarHBondContact O-CB 3.49Å; S5-K8 PolarHBondContact O-N 2.97Å; S5-T9 PolarHBondContact O-N 2.9Å
6	F	96.4	Very high	95.9	Very high	33 Å²	33	60.5 Å²	60.5	15%	0.145	33%	0.325	C	S	.	.	H	α-helix	trans	-61.2	-51.2	175.2	173.5	-107.3	0	0	0	112	L2 F3 K8 T9 L10 L72 L82	L2-F6 PolarHBondContact O-N 3.33Å; F3-F6 PolarHBondContact O-N 2.86Å; F6-K8 PolarHBondContact O-N 2.69Å; F6-T9 PolarHBondContact O-N 2.68Å; F6-T9 PolarHBondContact O-OG1 2.79Å; F6-L10 HydrophobicContact CD1-CD1 4.32Å; F6-L10 HydrophobicContact CE1-CD1 3.78Å; F6-L10 HydrophobicContact CE2-CD1 4.5Å; F6-L10 HydrophobicContact CZ-CD1 3.89Å; F6-L72 HydrophobicContact CE1-CD1 3.59Å; F6-L72 HydrophobicContact CZ-CD1 3.69Å; F6-L82 HydrophobicContact CD2-CD1 4.21Å; F6-L82 HydrophobicContact CG-CD1 4.44Å
7	F	96.9	Very high	96	Very high	26 Å²	26	56.9 Å²	56.9	11%	0.114	31%	0.306	C	S	.	.	H	α-helix	trans	-65.3	-25.4	178.6	-73.7	-60.3	0	0	0	113.2	F3 T9 L10 L29 V32 F38 V70 L72	F3-F7 HydrophobicContact CB-CD2 4.42Å; F3-F7 HydrophobicContact CB-CE2 4.35Å; F3-F7 WeakPolarHBondContact O-CD2 3.34Å; F3-F7 PolarHBondContact O-N 3.35Å; F7-T9 VanDerWaalsContact C-N 3.27Å; F7-T9 PolarHBondContact O-N 2.91Å; F7-L10 HydrophobicContact CD1-CD1 3.98Å; F7-L10 HydrophobicContact CE1-CD1 4.49Å; F7-L10 PolarHBondContact O-N 3.43Å; F7-L29 WeakPolarHBondContact O-CD2 3.43Å; F7-V32 HydrophobicContact CB-CB 4.17Å; F7-V32 HydrophobicContact CB-CG1 3.77Å; F7-V32 HydrophobicContact CB-CG2 3.96Å; F7-F38 HydrophobicContact CB-CE1 4.4Å; F7-F38 AromaticContact CD1-CE1 3.88Å; F7-F38 HydrophobicContact CD1-CE1 3.88Å; F7-F38 HydrophobicContact CD1-CZ 4.37Å; F7-F38 HydrophobicContact CD2-CE1 4.15Å; F7-F38 HydrophobicContact CD2-CZ 4.1Å; F7-F38 HydrophobicContact CE1-CE1 4.15Å; F7-F38 HydrophobicContact CE1-CZ 4.26Å; F7-F38 HydrophobicContact CE2-CE1 4.39Å; F7-F38 AromaticContact CE2-CZ 3.98Å; F7-F38 HydrophobicContact CE2-CZ 3.98Å; F7-F38 AromaticContact CG-CE1 3.9Å; F7-F38 HydrophobicContact CG-CE1 3.9Å; F7-F38 HydrophobicContact CG-CZ 4.3Å; F7-F38 HydrophobicContact CZ-CE1 4.39Å; F7-F38 HydrophobicContact CZ-CZ 4.07Å; F7-V70 HydrophobicContact CE1-CB 4.2Å; F7-V70 HydrophobicContact CE1-CG1 4.05Å; F7-V70 HydrophobicContact CE1-CG2 4.34Å; F7-V70 HydrophobicContact CZ-CB 4.4Å; F7-V70 HydrophobicContact CZ-CG2 4.27Å; F7-L72 HydrophobicContact CE1-CD1 4.47Å
8	K	96.1	Very high	96.1	Very high	120 Å²	120	55.8 Å²	55.8	52%	0.522	30%	0.299	S	S	.	.	H	α-helix	trans	-63.3	-31.1	171.5	-80.8	-126.1	-178.2	179.8	0	113	F4 S5 F6 L10 V11 V32	F4-K8 HydrophobicContact CD2-CG 4.45Å; F4-K8 HydrophobicContact CE2-CD 4.46Å; F4-K8 HydrophobicContact CE2-CG 4.11Å; F4-K8 HydrophobicContact CZ-CD 4.35Å; F4-K8 HydrophobicContact CZ-CG 4.38Å; F4-K8 WeakPolarHBondContact O-CG 2.98Å; F4-K8 PolarHBondContact O-N 3.26Å; F4-K8 VanDerWaalsContact O-N 3.12Å; S5-K8 WeakPolarHBondContact O-CB 3.49Å; S5-K8 PolarHBondContact O-N 2.97Å; F6-K8 PolarHBondContact O-N 2.69Å; K8-L10 PolarHBondContact O-N 3.46Å; K8-V11 WeakPolarHBondContact O-CG2 3.35Å; K8-V11 PolarHBondContact O-N 3.37Å; K8-V32 HydrophobicContact CG-CG1 3.89Å
9	T	95.7	Very high	96.2	Very high	93 Å²	93	53.4 Å²	53.4	57%	0.571	29%	0.285	S	S	*	.	H	α-helix	trans	-71.3	-18.4	177.2	71.7	0	0	0	0	112.4	S5 F6 F7	S5-T9 PolarHBondContact O-N 2.9Å; F6-T9 PolarHBondContact O-N 2.68Å; F6-T9 PolarHBondContact O-OG1 2.79Å; F7-T9 VanDerWaalsContact C-N 3.27Å; F7-T9 PolarHBondContact O-N 2.91Å
10	L	96.3	Very high	96.2	Very high	1 Å²	1	57 Å²	57	1%	0.005	30%	0.298	C	S	.	.	T	Hydrogen-bonded Turn	trans	-94.7	3.2	-177.9	-58.4	169.1	0	0	0	112.9	F6 F7 K8 G12 K13 L29 L72 E76	F6-L10 HydrophobicContact CD1-CD1 4.32Å; F6-L10 HydrophobicContact CE1-CD1 3.78Å; F6-L10 HydrophobicContact CE2-CD1 4.5Å; F6-L10 HydrophobicContact CZ-CD1 3.89Å; F7-L10 HydrophobicContact CD1-CD1 3.98Å; F7-L10 HydrophobicContact CE1-CD1 4.49Å; F7-L10 PolarHBondContact O-N 3.43Å; K8-L10 PolarHBondContact O-N 3.46Å; L10-G12 PolarHBondContact O-N 2.99Å; L10-K13 VanDerWaalsContact O-CB 3.29Å; L10-K13 WeakPolarHBondContact O-CB 3.41Å; L10-K13 WeakPolarHBondContact O-CG 3.43Å; L10-K13 PolarHBondContact O-N 3.22Å; L10-L29 HydrophobicContact CB-CD2 3.94Å; L10-L72 HydrophobicContact CD1-CD1 3.64Å; L10-L72 HydrophobicContact CD1-CD2 3.72Å; L10-L72 HydrophobicContact CD1-CG 4.28Å; L10-E76 HydrophobicContact CD2-CB 3.84Å
11	V	97.1	Very high	96.2	Very high	66 Å²	66	59.1 Å²	59.1	40%	0.4	31%	0.31	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.1	129.1	174.9	172.9	0	0	0	0	109.5	K8 L29 H30	K8-V11 WeakPolarHBondContact O-CG2 3.35Å; K8-V11 PolarHBondContact O-N 3.37Å; V11-L29 CarbonylContact C-O 3.53Å; V11-L29 WeakPolarHBondContact CA-O 3.43Å; V11-L29 HydrophobicContact CG2-CG 4.46Å; V11-H30 WeakPolarHBondContact CG1-O 3.29Å
12	G	96.9	Very high	96.4	Very high	51 Å²	51	58.6 Å²	58.6	53%	0.526	31%	0.31	S	S	.	.	T	Hydrogen-bonded Turn	trans	89.3	1.5	-173.9	0	0	0	0	0	114.5	L10 L29	L10-G12 PolarHBondContact O-N 2.99Å; G12-L29 PolarHBondContact N-O 3.43Å
13	K	96.8	Very high	96.5	Very high	70 Å²	70	57.9 Å²	57.9	30%	0.304	31%	0.306	S	S	.	.	S	Bend	trans	-101.7	152.3	177.4	-52.4	-59.9	-178.9	155.3	0	111.5	L10 T28 L29 E76	L10-K13 VanDerWaalsContact O-CB 3.29Å; L10-K13 WeakPolarHBondContact O-CB 3.41Å; L10-K13 WeakPolarHBondContact O-CG 3.43Å; L10-K13 PolarHBondContact O-N 3.22Å; K13-T28 WeakPolarHBondContact O-CA 3.36Å; K13-L29 PolarHBondContact O-N 3.27Å; K13-E76 HydrophobicContact CD-CG 4.23Å; K13-E76 WeakPolarHBondContact CD-OE1 3.45Å; K13-E76 VanDerWaalsContact CE-CD 3.41Å; K13-E76 WeakPolarHBondContact CE-OE1 3.37Å; K13-E76 WeakPolarHBondContact CE-OE2 3.26Å; K13-E76 HydrophobicContact CG-CG 4.33Å; K13-E76 IonicContact NZ-OE1 2.68Å; K13-E76 PolarHBondContact NZ-OE1 3.23Å; K13-E76 IonicContact NZ-OE2 2.91Å; K13-E76 PolarHBondContact NZ-OE2 3.37Å
14	D	96.5	Very high	96.5	Very high	100 Å²	100	53.9 Å²	53.9	54%	0.535	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.1	131.6	174.5	-70.5	-22.2	0	0	0	110.5	T28	D14-T28 PolarHBondContact OD1-OG1 3.48Å
15	V	97.3	Very high	96.6	Very high	5 Å²	5	52 Å²	52	3%	0.03	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.1	151.7	-178.8	-59.5	0	0	0	0	110	I17 C26 G27 L29 L40 V70 L72	V15-I17 HydrophobicContact CG2-CD1 4.47Å; V15-I17 HydrophobicContact CG2-CG1 4.23Å; V15-C26 WeakPolarHBondContact O-CA 3.48Å; V15-G27 PolarHBondContact N-O 2.68Å; V15-G27 PolarHBondContact O-N 3.29Å; V15-L29 HydrophobicContact CG1-CB 4.46Å; V15-L29 HydrophobicContact CG2-CB 4.2Å; V15-L40 HydrophobicContact CG2-CD2 3.7Å; V15-V70 HydrophobicContact CB-CG1 4.32Å; V15-L72 HydrophobicContact CB-CD2 4.22Å; V15-L72 HydrophobicContact CG1-CD2 3.52Å
16	L	97.6	Very high	96.7	Very high	38 Å²	38	51 Å²	51	20%	0.199	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	121.9	169.4	-179	162.6	0	0	0	108.9	C24 I25 V70 Q71	L16-C24 HydrophobicContact CD2-CB 4.23Å; L16-I25 WeakPolarHBondContact CA-O 3.41Å; L16-V70 CarbonylContact O-C 3.54Å; L16-V70 WeakPolarHBondContact O-CA 3.37Å; L16-Q71 HydrophobicContact CB-CB 4.17Å; L16-Q71 HydrophobicContact CD2-CB 4.48Å; L16-Q71 HydrophobicContact CD2-CG 4.22Å; L16-Q71 PolarHBondContact N-O 3.22Å; L16-Q71 VanDerWaalsContact N-O 3.16Å; L16-Q71 PolarHBondContact O-N 3.01Å
17	I	98.1	Very high	96.7	Very high	0 Å²	0	49.6 Å²	49.6	0%	0	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	117.6	178.4	-58.5	-170.4	0	0	0	109	V15 L19 C24 I25 F38 L40 I62 V67 V70	V15-I17 HydrophobicContact CG2-CD1 4.47Å; V15-I17 HydrophobicContact CG2-CG1 4.23Å; I17-L19 HydrophobicContact CG2-CD2 3.76Å; I17-C24 WeakPolarHBondContact O-CA 3.36Å; I17-I25 PolarHBondContact N-O 3.47Å; I17-I25 PolarHBondContact O-N 3.01Å; I17-F38 HydrophobicContact CD1-CB 3.88Å; I17-F38 HydrophobicContact CD1-CD1 4.2Å; I17-F38 HydrophobicContact CD1-CD2 4.11Å; I17-F38 HydrophobicContact CD1-CG 3.8Å; I17-L40 HydrophobicContact CD1-CD1 3.92Å; I17-L40 HydrophobicContact CD1-CD2 4.15Å; I17-L40 HydrophobicContact CD1-CG 4.25Å; I17-L40 HydrophobicContact CG1-CD1 4.22Å; I17-I62 HydrophobicContact CB-CD1 4.34Å; I17-I62 HydrophobicContact CD1-CD1 4.02Å; I17-I62 HydrophobicContact CG2-CD1 4.23Å; I17-V67 HydrophobicContact CG2-CB 4.47Å; I17-V67 HydrophobicContact CG2-CG1 3.88Å; I17-V67 HydrophobicContact CG2-CG2 3.91Å; I17-V70 HydrophobicContact CG1-CG1 4.25Å; I17-V70 HydrophobicContact CG1-CG2 4.31Å
18	E	97.9	Very high	96.7	Very high	37 Å²	37	50 Å²	50	17%	0.173	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	122.5	170.6	-174.7	-175.1	136.7	0	0	109.1	R68 Y69	E18-R68 PolarHBondContact O-N 3.31Å; E18-R68 WeakPolarHBondContact OE1-CD 3.37Å; E18-R68 IonicContact OE1-CZ 2.75Å; E18-R68 IonicContact OE1-NH1 2.79Å; E18-R68 PolarHBondContact OE1-NH1 3.46Å; E18-Y69 PolarHBondContact N-O 2.92Å; E18-Y69 PolarHBondContact O-N 2.86Å; E18-Y69 VanDerWaalsContact O-N 3.1Å
19	L	97.6	Very high	96.8	Very high	9 Å²	9	44.4 Å²	44.4	5%	0.047	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.6	160.4	178.1	-56.1	-172.9	0	0	0	111.4	I17 N21 D22 L23 I25 I62 I66 V67	I17-L19 HydrophobicContact CG2-CD2 3.76Å; L19-N21 WeakPolarHBondContact CB-OD1 3.17Å; L19-N21 PolarHBondContact O-N 3.39Å; L19-D22 PolarHBondContact O-N 3Å; L19-L23 HydrophobicContact CB-CB 4.4Å; L19-L23 WeakPolarHBondContact CB-O 3.37Å; L19-L23 HydrophobicContact CD1-CB 4.24Å; L19-L23 HydrophobicContact CD1-CD2 4.03Å; L19-L23 HydrophobicContact CD1-CG 4.27Å; L19-L23 WeakPolarHBondContact CG-O 3.37Å; L19-L23 PolarHBondContact N-O 3.33Å; L19-I25 HydrophobicContact CD1-CD1 4.06Å; L19-I62 HydrophobicContact CD2-CG2 3.59Å; L19-I66 WeakPolarHBondContact CA-O 3.44Å; L19-I66 HydrophobicContact CD1-CD1 4.03Å; L19-I66 HydrophobicContact CD2-CD1 4.27Å; L19-I66 HydrophobicContact CD2-CG1 4.31Å; L19-V67 HydrophobicContact CD2-CG2 4.2Å
20	K	97.6	Very high	97	Very high	125 Å²	125	44.5 Å²	44.5	54%	0.543	25%	0.246	S	C	.	.	T	Hydrogen-bonded Turn	trans	-62.7	-13.7	179.1	-74.3	176.7	-178.4	174.1	0	114.8	S65 I66 R68	K20-S65 WeakPolarHBondContact CE-O 3.48Å; K20-S65 PolarHBondContact NZ-O 3.04Å; K20-I66 WeakPolarHBondContact CG-O 3.47Å; K20-I66 PolarHBondContact N-O 3.37Å; K20-R68 HydrophobicContact CG-CB 4.15Å; K20-R68 PolarHBondContact O-NH2 2.67Å
21	N	94.5	Very high	97	Very high	102 Å²	102	46.8 Å²	46.8	55%	0.545	26%	0.261	S	S	.	.	T	Hydrogen-bonded Turn	trans	-100	19	174.1	67.8	-21.6	0	0	0	112.4	L19 L23	L19-N21 WeakPolarHBondContact CB-OD1 3.17Å; L19-N21 PolarHBondContact O-N 3.39Å; N21-L23 PolarHBondContact O-N 2.88Å; N21-L23 VanDerWaalsContact O-N 3.15Å; N21-L23 WeakPolarHBondContact OD1-CB 3.4Å; N21-L23 PolarHBondContact OD1-N 3.37Å
22	D	93.5	Very high	97.1	Very high	106 Å²	106	44.2 Å²	44.2	57%	0.567	25%	0.246	S	C	*	.	S	Bend	trans	67.1	8.9	177	-46.9	-35.8	0	0	0	114.8	L19 C24 R68	L19-D22 PolarHBondContact O-N 3Å; D22-C24 PolarHBondContact O-N 3.43Å; D22-R68 IonicContact OD1-CZ 3.22Å; D22-R68 VanDerWaalsContact OD1-CZ 3.22Å; D22-R68 IonicContact OD1-NH1 2.68Å; D22-R68 PolarHBondContact OD1-NH1 2.91Å; D22-R68 IonicContact OD1-NH2 2.81Å; D22-R68 PolarHBondContact OD1-NH2 3.35Å
23	L	95.7	Very high	97.1	Very high	9 Å²	9	44.3 Å²	44.3	5%	0.047	24%	0.235	C	C	.	.			trans	-73.8	123.9	169.9	174.6	60.6	0	0	0	109.8	L19 N21 I25 V45 H51	L19-L23 HydrophobicContact CB-CB 4.4Å; L19-L23 WeakPolarHBondContact CB-O 3.37Å; L19-L23 HydrophobicContact CD1-CB 4.24Å; L19-L23 HydrophobicContact CD1-CD2 4.03Å; L19-L23 HydrophobicContact CD1-CG 4.27Å; L19-L23 WeakPolarHBondContact CG-O 3.37Å; L19-L23 PolarHBondContact N-O 3.33Å; N21-L23 PolarHBondContact O-N 2.88Å; N21-L23 VanDerWaalsContact O-N 3.15Å; N21-L23 WeakPolarHBondContact OD1-CB 3.4Å; N21-L23 PolarHBondContact OD1-N 3.37Å; L23-I25 HydrophobicContact CD1-CG1 4.43Å; L23-I25 HydrophobicContact CD2-CD1 4.04Å; L23-I25 HydrophobicContact CD2-CG1 4.22Å; L23-I25 HydrophobicContact CG-CD1 4.29Å; L23-I25 HydrophobicContact CG-CG1 3.96Å; L23-V45 HydrophobicContact CD1-CG1 3.51Å; L23-V45 HydrophobicContact CD1-CG2 4.24Å; L23-H51 HydrophobicContact CD1-CB 4.05Å
24	C	96.8	Very high	97.1	Very high	31 Å²	31	46.2 Å²	46.2	21%	0.209	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	123.8	175	-66	0	0	0	0	110.5	L16 I17 D22 T46	L16-C24 HydrophobicContact CD2-CB 4.23Å; I17-C24 WeakPolarHBondContact O-CA 3.36Å; D22-C24 PolarHBondContact O-N 3.43Å; C24-T46 WeakPolarHBondContact CB-OG1 3.43Å; C24-T46 PolarHBondContact O-N 2.89Å
25	I	97.3	Very high	97.1	Very high	5 Å²	5	49.3 Å²	49.3	3%	0.026	25%	0.25	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	117.8	-179.7	-53.6	173.6	0	0	0	108.2	L16 I17 L19 L23 L40 I43 M54 I62	L16-I25 WeakPolarHBondContact CA-O 3.41Å; I17-I25 PolarHBondContact N-O 3.47Å; I17-I25 PolarHBondContact O-N 3.01Å; L19-I25 HydrophobicContact CD1-CD1 4.06Å; L23-I25 HydrophobicContact CD1-CG1 4.43Å; L23-I25 HydrophobicContact CD2-CD1 4.04Å; L23-I25 HydrophobicContact CD2-CG1 4.22Å; L23-I25 HydrophobicContact CG-CD1 4.29Å; L23-I25 HydrophobicContact CG-CG1 3.96Å; I25-L40 HydrophobicContact CG2-CD1 3.97Å; I25-I43 HydrophobicContact CG2-CB 3.92Å; I25-I43 HydrophobicContact CG2-CD1 4.1Å; I25-I43 HydrophobicContact CG2-CG2 4.15Å; I25-M54 HydrophobicContact CD1-CE 4.03Å; I25-I62 HydrophobicContact CD1-CD1 3.96Å; I25-I62 HydrophobicContact CD1-CG1 4.46Å
26	C	97.2	Very high	97.1	Very high	44 Å²	44	52.1 Å²	52.1	30%	0.297	26%	0.262	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	142.3	169.4	-171.8	0	0	0	0	109.3	V15 I43 S44	V15-C26 WeakPolarHBondContact O-CA 3.48Å; C26-I43 CarbonylContact O-C 3.48Å; C26-I43 WeakPolarHBondContact O-CA 3.42Å; C26-I43 WeakPolarHBondContact O-CB 3.38Å; C26-S44 PolarHBondContact N-O 3.32Å; C26-S44 PolarHBondContact O-N 2.85Å
27	G	97.2	Very high	97.1	Very high	4 Å²	4	51.5 Å²	51.5	4%	0.041	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	174.4	176.2	172.5	0	0	0	0	0	112.5	V15	V15-G27 PolarHBondContact N-O 2.68Å; V15-G27 PolarHBondContact O-N 3.29Å
28	T	97.8	Very high	97.2	Very high	34 Å²	34	51.7 Å²	51.7	21%	0.209	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.1	128.9	179.9	-50.5	0	0	0	0	110.4	K13 D14 H30 L40 T41	K13-T28 WeakPolarHBondContact O-CA 3.36Å; D14-T28 PolarHBondContact OD1-OG1 3.48Å; T28-H30 PolarHBondContact O-N 3.1Å; T28-H30 VanDerWaalsContact O-N 3.15Å; T28-L40 WeakPolarHBondContact O-CA 3.3Å; T28-T41 PolarHBondContact N-O 2.85Å; T28-T41 PolarHBondContact O-N 3.13Å; T28-T41 PolarHBondContact O-OG1 3.2Å
29	L	98.1	Very high	97.2	Very high	2 Å²	2	53.9 Å²	53.9	1%	0.01	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.2	108.6	179.3	179.3	58.4	0	0	0	111.1	F7 L10 V11 G12 K13 V15 F38 L40	F7-L29 WeakPolarHBondContact O-CD2 3.43Å; L10-L29 HydrophobicContact CB-CD2 3.94Å; V11-L29 CarbonylContact C-O 3.53Å; V11-L29 WeakPolarHBondContact CA-O 3.43Å; V11-L29 HydrophobicContact CG2-CG 4.46Å; G12-L29 PolarHBondContact N-O 3.43Å; K13-L29 PolarHBondContact O-N 3.27Å; V15-L29 HydrophobicContact CG1-CB 4.46Å; V15-L29 HydrophobicContact CG2-CB 4.2Å; L29-F38 HydrophobicContact CD1-CB 4.44Å; L29-F38 HydrophobicContact CD1-CD1 3.78Å; L29-L40 HydrophobicContact CB-CD2 4.32Å; L29-L40 HydrophobicContact CD1-CD2 4.09Å
30	H	98.3	Very high	97.2	Very high	96 Å²	96	53.5 Å²	53.5	44%	0.444	27%	0.267	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.3	-40.9	-179.9	178.3	-71	0	0	0	112.5	V11 T28 K39 T41	V11-H30 WeakPolarHBondContact CG1-O 3.29Å; T28-H30 PolarHBondContact O-N 3.1Å; T28-H30 VanDerWaalsContact O-N 3.15Å; H30-K39 HydrophobicContact CB-CB 4.4Å; H30-K39 HydrophobicContact CB-CG 4.37Å; H30-K39 WeakPolarHBondContact CB-O 3.48Å; H30-K39 PolarHBondContact N-O 3.44Å; H30-T41 HydrophobicContact CB-CG2 3.88Å
31	S	98.1	Very high	97.2	Very high	48 Å²	48	48.8 Å²	48.8	34%	0.336	25%	0.249	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-161.1	153.6	178.1	57.8	0	0	0	0	112.4	K39	S31-K39 PolarHBondContact N-O 3.15Å; S31-K39 PolarHBondContact O-N 2.98Å; S31-K39 VanDerWaalsContact OG-CB 3.25Å; S31-K39 WeakPolarHBondContact OG-CB 3.46Å
32	V	98.2	Very high	97.4	Very high	13 Å²	13	49.7 Å²	49.7	8%	0.079	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.3	146.9	172.6	66.3	0	0	0	0	109.8	F4 F7 K8 N37 F38	F4-V32 HydrophobicContact CD2-CG1 4.31Å; F4-V32 HydrophobicContact CE2-CG1 4.4Å; F7-V32 HydrophobicContact CB-CB 4.17Å; F7-V32 HydrophobicContact CB-CG1 3.77Å; F7-V32 HydrophobicContact CB-CG2 3.96Å; K8-V32 HydrophobicContact CG-CG1 3.89Å; V32-N37 WeakPolarHBondContact CA-O 3.15Å; V32-F38 HydrophobicContact CB-CD1 4.38Å; V32-F38 HydrophobicContact CB-CE1 4.5Å; V32-F38 HydrophobicContact CG2-CD1 4.03Å; V32-F38 HydrophobicContact CG2-CE1 3.84Å; V32-F38 HydrophobicContact CG2-CZ 4.39Å
33	D	97.5	Very high	97.5	Very high	53 Å²	53	45.5 Å²	45.5	28%	0.283	23%	0.231	S	C	.	.			trans	-112.5	179.5	173.7	76	14.9	0	0	0	113.2	F4 Y35 H36 N37	F4-D33 VanDerWaalsContact CD2-C 3.46Å; F4-D33 VanDerWaalsContact CD2-O 3.3Å; F4-D33 WeakPolarHBondContact CD2-O 3.37Å; D33-Y35 PolarHBondContact O-N 3.3Å; D33-Y35 WeakPolarHBondContact OD1-CA 3.47Å; D33-Y35 PolarHBondContact OD1-N 2.97Å; D33-H36 PolarHBondContact O-N 3.38Å; D33-H36 PolarHBondContact OD1-N 2.97Å; D33-H36 VanDerWaalsContact OD1-N 3.15Å; D33-N37 PolarHBondContact N-O 3.2Å; D33-N37 PolarHBondContact OD1-N 3.34Å; D33-N37 PolarHBondContact OD1-ND2 3.2Å; D33-N37 WeakPolarHBondContact OD2-CB 3.03Å; D33-N37 PolarHBondContact OD2-ND2 3.32Å
34	Q	96.1	Very high	97.5	Very high	110 Å²	110	48.3 Å²	48.3	51%	0.514	25%	0.251	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.4	-16.8	-178.4	67.4	-175.5	-8.5	0	0	114.8	H36	Q34-H36 VanDerWaalsContact C-N 3.33Å
35	Y	97.2	Very high	97.5	Very high	164 Å²	164	47.8 Å²	47.8	64%	0.643	25%	0.247	S	C	*	.	T	Hydrogen-bonded Turn	trans	-96.7	7.8	174.6	-62	-68.2	0	0	0	111.9	D33 N37	D33-Y35 PolarHBondContact O-N 3.3Å; D33-Y35 WeakPolarHBondContact OD1-CA 3.47Å; D33-Y35 PolarHBondContact OD1-N 2.97Å; Y35-N37 PolarHBondContact O-N 2.77Å
36	H	97.1	Very high	97.2	Very high	64 Å²	64	51.5 Å²	51.5	30%	0.296	27%	0.271	S	S	.	.			trans	57.6	36.4	-174.1	-43.8	106.5	0	0	0	111.8	D33 Q34 F38 G64	D33-H36 PolarHBondContact O-N 3.38Å; D33-H36 PolarHBondContact OD1-N 2.97Å; D33-H36 VanDerWaalsContact OD1-N 3.15Å; Q34-H36 VanDerWaalsContact C-N 3.33Å; H36-F38 HydrophobicContact CB-CE2 4.04Å; H36-F38 HydrophobicContact CB-CZ 4.12Å; H36-F38 WeakPolarHBondContact O-CD2 3.44Å; H36-F38 WeakPolarHBondContact O-CE2 3.42Å; H36-G64 WeakPolarHBondContact O-CA 3.25Å
37	N	98.2	Very high	96.9	Very high	26 Å²	26	53 Å²	53	14%	0.139	28%	0.275	C	S	.	.			trans	-74.6	133.9	162.8	-55.7	-52.4	0	0	0	108.6	V32 D33 Y35 F61 I62 R63 G64	V32-N37 WeakPolarHBondContact CA-O 3.15Å; D33-N37 PolarHBondContact N-O 3.2Å; D33-N37 PolarHBondContact OD1-N 3.34Å; D33-N37 PolarHBondContact OD1-ND2 3.2Å; D33-N37 WeakPolarHBondContact OD2-CB 3.03Å; D33-N37 PolarHBondContact OD2-ND2 3.32Å; Y35-N37 PolarHBondContact O-N 2.77Å; N37-F61 HydrophobicContact CB-CE1 4.3Å; N37-F61 HydrophobicContact CB-CE2 3.63Å; N37-F61 HydrophobicContact CB-CZ 3.4Å; N37-F61 VanDerWaalsContact CB-CZ 3.4Å; N37-I62 CarbonylContact C-O 3.57Å; N37-I62 VanDerWaalsContact CA-O 3.29Å; N37-I62 WeakPolarHBondContact CA-O 3.24Å; N37-R63 VanDerWaalsContact OD1-CA 3.27Å; N37-R63 WeakPolarHBondContact OD1-CA 3.16Å; N37-G64 PolarHBondContact OD1-N 2.96Å
38	F	98.5	Very high	96.5	Very high	4 Å²	4	55.5 Å²	55.5	2%	0.018	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	138.3	-175.1	-60.8	-89.3	0	0	0	110.2	F7 I17 L29 V32 H36 F61 I62 V67 V70	F7-F38 HydrophobicContact CB-CE1 4.4Å; F7-F38 AromaticContact CD1-CE1 3.88Å; F7-F38 HydrophobicContact CD1-CE1 3.88Å; F7-F38 HydrophobicContact CD1-CZ 4.37Å; F7-F38 HydrophobicContact CD2-CE1 4.15Å; F7-F38 HydrophobicContact CD2-CZ 4.1Å; F7-F38 HydrophobicContact CE1-CE1 4.15Å; F7-F38 HydrophobicContact CE1-CZ 4.26Å; F7-F38 HydrophobicContact CE2-CE1 4.39Å; F7-F38 AromaticContact CE2-CZ 3.98Å; F7-F38 HydrophobicContact CE2-CZ 3.98Å; F7-F38 AromaticContact CG-CE1 3.9Å; F7-F38 HydrophobicContact CG-CE1 3.9Å; F7-F38 HydrophobicContact CG-CZ 4.3Å; F7-F38 HydrophobicContact CZ-CE1 4.39Å; F7-F38 HydrophobicContact CZ-CZ 4.07Å; I17-F38 HydrophobicContact CD1-CB 3.88Å; I17-F38 HydrophobicContact CD1-CD1 4.2Å; I17-F38 HydrophobicContact CD1-CD2 4.11Å; I17-F38 HydrophobicContact CD1-CG 3.8Å; L29-F38 HydrophobicContact CD1-CB 4.44Å; L29-F38 HydrophobicContact CD1-CD1 3.78Å; V32-F38 HydrophobicContact CB-CD1 4.38Å; V32-F38 HydrophobicContact CB-CE1 4.5Å; V32-F38 HydrophobicContact CG2-CD1 4.03Å; V32-F38 HydrophobicContact CG2-CE1 3.84Å; V32-F38 HydrophobicContact CG2-CZ 4.39Å; H36-F38 HydrophobicContact CB-CE2 4.04Å; H36-F38 HydrophobicContact CB-CZ 4.12Å; H36-F38 WeakPolarHBondContact O-CD2 3.44Å; H36-F38 WeakPolarHBondContact O-CE2 3.42Å; F38-F61 CarbonylContact O-C 3.59Å; F38-F61 WeakPolarHBondContact O-CA 3.33Å; F38-I62 HydrophobicContact CB-CB 4.44Å; F38-I62 PolarHBondContact N-O 2.86Å; F38-I62 PolarHBondContact O-N 3.12Å; F38-V67 HydrophobicContact CD2-CG2 4.02Å; F38-V67 HydrophobicContact CE2-CG2 4.04Å; F38-V70 HydrophobicContact CE2-CG2 4.37Å; F38-V70 HydrophobicContact CZ-CG2 4.08Å
39	K	98.5	Very high	96.2	Very high	83 Å²	83	62.7 Å²	62.7	36%	0.361	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	122.6	164.2	-168.6	176.9	178.4	-175	0	108.1	H30 S31 C60	H30-K39 HydrophobicContact CB-CB 4.4Å; H30-K39 HydrophobicContact CB-CG 4.37Å; H30-K39 WeakPolarHBondContact CB-O 3.48Å; H30-K39 PolarHBondContact N-O 3.44Å; S31-K39 PolarHBondContact N-O 3.15Å; S31-K39 PolarHBondContact O-N 2.98Å; S31-K39 VanDerWaalsContact OG-CB 3.25Å; S31-K39 WeakPolarHBondContact OG-CB 3.46Å; K39-C60 WeakPolarHBondContact CA-O 3.47Å
40	L	98.3	Very high	95.9	Very high	0 Å²	0	69.6 Å²	69.6	0%	0	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	146	174.4	-59	-176.8	0	0	0	110.3	V15 I17 I25 T28 L29 I43 N59 C60 I62	V15-L40 HydrophobicContact CG2-CD2 3.7Å; I17-L40 HydrophobicContact CD1-CD1 3.92Å; I17-L40 HydrophobicContact CD1-CD2 4.15Å; I17-L40 HydrophobicContact CD1-CG 4.25Å; I17-L40 HydrophobicContact CG1-CD1 4.22Å; I25-L40 HydrophobicContact CG2-CD1 3.97Å; T28-L40 WeakPolarHBondContact O-CA 3.3Å; L29-L40 HydrophobicContact CB-CD2 4.32Å; L29-L40 HydrophobicContact CD1-CD2 4.09Å; L40-I43 HydrophobicContact CB-CG2 3.54Å; L40-I43 HydrophobicContact CD1-CG2 4.46Å; L40-N59 VanDerWaalsContact O-CA 3.31Å; L40-N59 WeakPolarHBondContact O-CA 2.94Å; L40-C60 PolarHBondContact N-O 2.84Å; L40-C60 PolarHBondContact O-N 3.35Å; L40-I62 HydrophobicContact CD1-CD1 3.93Å; L40-I62 HydrophobicContact CG-CD1 4.36Å
41	T	98.1	Very high	95.6	Very high	27 Å²	27	66.7 Å²	66.7	17%	0.166	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	158.7	171.4	51.8	0	0	0	0	110.9	T28 H30 I43 K58 N59	T28-T41 PolarHBondContact N-O 2.85Å; T28-T41 PolarHBondContact O-N 3.13Å; T28-T41 PolarHBondContact O-OG1 3.2Å; H30-T41 HydrophobicContact CB-CG2 3.88Å; T41-I43 VanDerWaalsContact C-N 3.31Å; T41-I43 PolarHBondContact O-N 3.04Å; T41-K58 CarbonylContact C-O 3.55Å; T41-N59 WeakPolarHBondContact CA-OD1 3.15Å; T41-N59 WeakPolarHBondContact CB-OD1 3.47Å; T41-N59 WeakPolarHBondContact CG2-OD1 3.34Å
42	D	97	Very high	95.4	Very high	120 Å²	120	68 Å²	68	64%	0.642	35%	0.346	S	S	*	.	E	Extended strand (participates in β ladder)	trans	49.4	49.2	-179.1	-63.3	-44.5	0	0	0	113.2	K58 N59	D42-K58 WeakPolarHBondContact CA-O 3.01Å; D42-K58 PolarHBondContact N-O 2.95Å; D42-N59 PolarHBondContact N-OD1 3.15Å
43	I	97.2	Very high	95	Very high	19 Å²	19	73.2 Å²	73.2	10%	0.097	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.3	152.5	-172.3	74.4	171.6	0	0	0	113.3	I25 C26 L40 T41 M54 V57 K58 C60	I25-I43 HydrophobicContact CG2-CB 3.92Å; I25-I43 HydrophobicContact CG2-CD1 4.1Å; I25-I43 HydrophobicContact CG2-CG2 4.15Å; C26-I43 CarbonylContact O-C 3.48Å; C26-I43 WeakPolarHBondContact O-CA 3.42Å; C26-I43 WeakPolarHBondContact O-CB 3.38Å; L40-I43 HydrophobicContact CB-CG2 3.54Å; L40-I43 HydrophobicContact CD1-CG2 4.46Å; T41-I43 VanDerWaalsContact C-N 3.31Å; T41-I43 PolarHBondContact O-N 3.04Å; I43-M54 HydrophobicContact CD1-CE 3.58Å; I43-V57 HydrophobicContact CD1-CB 4.19Å; I43-V57 HydrophobicContact CD1-CG1 3.76Å; I43-V57 WeakPolarHBondContact CG1-O 2.92Å; I43-K58 PolarHBondContact N-O 2.86Å; I43-C60 HydrophobicContact CD1-CB 3.94Å
44	S	95.7	Very high	94.7	Very high	67 Å²	67	72.1 Å²	72.1	47%	0.469	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.9	151	164.4	59.6	0	0	0	0	110.2	C26	C26-S44 PolarHBondContact N-O 3.32Å; C26-S44 PolarHBondContact O-N 2.85Å
45	V	95.4	Very high	94.4	Very high	20 Å²	20	72.8 Å²	72.8	12%	0.121	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	137.3	176.5	175.9	0	0	0	0	108.8	L23 D47 P48 H51 M54	L23-V45 HydrophobicContact CD1-CG1 3.51Å; L23-V45 HydrophobicContact CD1-CG2 4.24Å; V45-D47 PolarHBondContact O-N 3.45Å; V45-P48 WeakPolarHBondContact O-CD 3.2Å; V45-H51 HydrophobicContact CG1-CB 4.13Å; V45-M54 HydrophobicContact CG2-CB 3.52Å; V45-M54 HydrophobicContact CG2-CE 4.18Å; V45-M54 HydrophobicContact CG2-CG 3.87Å
46	T	91.6	Very high	94.2	Very high	84 Å²	84	70.5 Å²	70.5	52%	0.515	38%	0.377	S	S	.	.	S	Bend	trans	-65.8	-37.3	-175.6	-30.5	0	0	0	0	112.6	C24 P48	C24-T46 WeakPolarHBondContact CB-OG1 3.43Å; C24-T46 PolarHBondContact O-N 2.89Å; T46-P48 VanDerWaalsContact C-CD 3.49Å; T46-P48 VanDerWaalsContact O-CD 3.27Å; T46-P48 WeakPolarHBondContact O-CD 3.31Å
47	D	91.2	Very high	94.1	Very high	74 Å²	74	70 Å²	70	40%	0.396	38%	0.378	S	S	.	.			trans	-116.1	74.2	177.8	-77	-15.2	0	0	0	111.2	V45 E49 K50 H51	V45-D47 PolarHBondContact O-N 3.45Å; D47-E49 VanDerWaalsContact C-N 3.26Å; D47-E49 PolarHBondContact O-N 3.11Å; D47-K50 HydrophobicContact CB-CB 4.2Å; D47-K50 HydrophobicContact CB-CD 4.12Å; D47-K50 HydrophobicContact CB-CG 4.31Å; D47-K50 PolarHBondContact O-N 3.5Å; D47-K50 IonicContact OD2-NZ 3.73Å; D47-K50 PolarHBondContact OD2-NZ 3.27Å; D47-H51 PolarHBondContact O-CD2 3.49Å; D47-H51 PolarHBondContact O-N 2.62Å
48	P	89.4	Confident	93.9	Very high	57 Å²	57	75.8 Å²	75.8	37%	0.37	40%	0.403	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.7	-28.8	-174.9	23.2	-31.1	0	0	0	113.3	V45 T46 H51 P52 L55	V45-P48 WeakPolarHBondContact O-CD 3.2Å; T46-P48 VanDerWaalsContact C-CD 3.49Å; T46-P48 VanDerWaalsContact O-CD 3.27Å; T46-P48 WeakPolarHBondContact O-CD 3.31Å; P48-H51 CarbonylContact O-C 3.16Å; P48-H51 PolarHBondContact O-N 3.31Å; P48-P52 WeakPolarHBondContact O-CA 3.39Å; P48-P52 VanDerWaalsContact O-N 3.11Å; P48-L55 HydrophobicContact CB-CD2 3.76Å
49	E	90.7	Very high	93.9	Very high	185 Å²	185	79.9 Å²	79.9	86%	0.864	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.3	-34.6	177.7	-63	-167.2	168.1	0	0	113	D47 H51	D47-E49 VanDerWaalsContact C-N 3.26Å; D47-E49 PolarHBondContact O-N 3.11Å; E49-H51 VanDerWaalsContact C-N 3.33Å
50	K	92	Very high	93.8	Very high	147 Å²	147	76.9 Å²	76.9	64%	0.639	41%	0.414	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77	-24.7	174.6	-66.6	-178.2	-169.9	153.4	0	112.1	D47 P52	D47-K50 HydrophobicContact CB-CB 4.2Å; D47-K50 HydrophobicContact CB-CD 4.12Å; D47-K50 HydrophobicContact CB-CG 4.31Å; D47-K50 PolarHBondContact O-N 3.5Å; D47-K50 IonicContact OD2-NZ 3.73Å; D47-K50 PolarHBondContact OD2-NZ 3.27Å; K50-P52 WeakPolarHBondContact O-CD 3.46Å
51	H	91.4	Very high	93.8	Very high	35 Å²	35	83.4 Å²	83.4	16%	0.162	44%	0.442	C	S	.	.			trans	-127.4	58.1	-176	-56	-73.2	0	0	0	112.5	L23 V45 D47 P48 E49 H53 M54	L23-H51 HydrophobicContact CD1-CB 4.05Å; V45-H51 HydrophobicContact CG1-CB 4.13Å; D47-H51 PolarHBondContact O-CD2 3.49Å; D47-H51 PolarHBondContact O-N 2.62Å; P48-H51 CarbonylContact O-C 3.16Å; P48-H51 PolarHBondContact O-N 3.31Å; E49-H51 VanDerWaalsContact C-N 3.33Å; H51-H53 AromaticContact ND1-CE1 3.7Å; H51-H53 PolarHBondContact O-N 3.4Å; H51-H53 VanDerWaalsContact O-N 3.08Å; H51-M54 PolarHBondContact O-N 3.47Å
52	P	93.2	Very high	93.8	Very high	76 Å²	76	82.4 Å²	82.4	49%	0.494	44%	0.436	S	S	.	.	G	3₁₀ helix	trans	-64.7	-21.7	-173.9	26.3	-35.3	0	0	0	112.9	P48 K50 M54 L55	P48-P52 WeakPolarHBondContact O-CA 3.39Å; P48-P52 VanDerWaalsContact O-N 3.11Å; K50-P52 WeakPolarHBondContact O-CD 3.46Å; P52-M54 PolarHBondContact O-N 3.33Å; P52-M54 VanDerWaalsContact O-N 3.17Å; P52-L55 HydrophobicContact CB-CD1 4.13Å; P52-L55 WeakPolarHBondContact O-CB 3.36Å; P52-L55 WeakPolarHBondContact O-CG 3.39Å; P52-L55 PolarHBondContact O-N 2.94Å
53	H	90.1	Very high	93.8	Very high	123 Å²	123	84.7 Å²	84.7	57%	0.569	44%	0.435	S	S	*	.	G	3₁₀ helix	trans	-62.9	-17.6	175.7	56.3	-87.9	0	0	0	113.6	H51	H51-H53 AromaticContact ND1-CE1 3.7Å; H51-H53 PolarHBondContact O-N 3.4Å; H51-H53 VanDerWaalsContact O-N 3.08Å
54	M	92.5	Very high	93.9	Very high	30 Å²	30	84.5 Å²	84.5	15%	0.148	44%	0.438	C	S	.	.	G	3₁₀ helix	trans	-91.3	-10.3	178.7	-67	-65	-71.9	0	0	113.7	I25 I43 V45 H51 P52 S56 V57	I25-M54 HydrophobicContact CD1-CE 4.03Å; I43-M54 HydrophobicContact CD1-CE 3.58Å; V45-M54 HydrophobicContact CG2-CB 3.52Å; V45-M54 HydrophobicContact CG2-CE 4.18Å; V45-M54 HydrophobicContact CG2-CG 3.87Å; H51-M54 PolarHBondContact O-N 3.47Å; P52-M54 PolarHBondContact O-N 3.33Å; P52-M54 VanDerWaalsContact O-N 3.17Å; M54-S56 PolarHBondContact O-N 2.74Å; M54-S56 VanDerWaalsContact O-N 3.12Å; M54-V57 HydrophobicContact CE-CB 4.46Å; M54-V57 HydrophobicContact CE-CG1 4.45Å; M54-V57 WeakPolarHBondContact O-CB 3.29Å; M54-V57 PolarHBondContact O-N 3.48Å; M54-V57 HydrophobicContact SD-CG2 4.33Å
55	L	89	Confident	94	Very high	124 Å²	124	84.4 Å²	84.4	65%	0.649	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.9	-32.5	-172.2	-74.3	170.2	0	0	0	114.1	P48 P52	P48-L55 HydrophobicContact CB-CD2 3.76Å; P52-L55 HydrophobicContact CB-CD1 4.13Å; P52-L55 WeakPolarHBondContact O-CB 3.36Å; P52-L55 WeakPolarHBondContact O-CG 3.39Å; P52-L55 PolarHBondContact O-N 2.94Å
56	S	93	Very high	94.1	Very high	115 Å²	115	87 Å²	87	80%	0.804	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.8	-4.7	-179	-46.7	0	0	0	0	113.3	M54	M54-S56 PolarHBondContact O-N 2.74Å; M54-S56 VanDerWaalsContact O-N 3.12Å
57	V	94.7	Very high	94.5	Very high	53 Å²	53	84.1 Å²	84.1	32%	0.321	43%	0.432	S	S	.	.			trans	-91.6	117.5	-173.2	-174.9	0	0	0	0	109	I43 M54 N59	I43-V57 HydrophobicContact CD1-CB 4.19Å; I43-V57 HydrophobicContact CD1-CG1 3.76Å; I43-V57 WeakPolarHBondContact CG1-O 2.92Å; M54-V57 HydrophobicContact CE-CB 4.46Å; M54-V57 HydrophobicContact CE-CG1 4.45Å; M54-V57 WeakPolarHBondContact O-CB 3.29Å; M54-V57 PolarHBondContact O-N 3.48Å; M54-V57 HydrophobicContact SD-CG2 4.33Å; V57-N59 VanDerWaalsContact CG1-O 3.24Å; V57-N59 WeakPolarHBondContact CG1-O 3.39Å
58	K	95.5	Very high	94.8	Very high	149 Å²	149	85 Å²	85	65%	0.648	43%	0.43	S	S	*	.			trans	-96.4	-28.3	176.5	-65.3	-164	174.9	-166.3	0	114.1	T41 D42 I43	T41-K58 CarbonylContact C-O 3.55Å; D42-K58 WeakPolarHBondContact CA-O 3.01Å; D42-K58 PolarHBondContact N-O 2.95Å; I43-K58 PolarHBondContact N-O 2.86Å
59	N	96.8	Very high	95.2	Very high	90 Å²	90	89 Å²	89	48%	0.481	44%	0.439	S	S	.	.			trans	-131.7	141.3	-178.6	-56.7	-38.6	0	0	0	108.4	L40 T41 D42 V57	L40-N59 VanDerWaalsContact O-CA 3.31Å; L40-N59 WeakPolarHBondContact O-CA 2.94Å; T41-N59 WeakPolarHBondContact CA-OD1 3.15Å; T41-N59 WeakPolarHBondContact CB-OD1 3.47Å; T41-N59 WeakPolarHBondContact CG2-OD1 3.34Å; D42-N59 PolarHBondContact N-OD1 3.15Å; V57-N59 VanDerWaalsContact CG1-O 3.24Å; V57-N59 WeakPolarHBondContact CG1-O 3.39Å
60	C	96.9	Very high	95.5	Very high	19 Å²	19	81.8 Å²	81.8	13%	0.128	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.5	152.7	177	69.6	0	0	0	0	112.2	K39 L40 I43	K39-C60 WeakPolarHBondContact CA-O 3.47Å; L40-C60 PolarHBondContact N-O 2.84Å; L40-C60 PolarHBondContact O-N 3.35Å; I43-C60 HydrophobicContact CD1-CB 3.94Å
61	F	98.1	Very high	95.8	Very high	137 Å²	137	79.9 Å²	79.9	60%	0.601	40%	0.401	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.8	125.2	165.7	175.3	-92.1	0	0	0	107.9	N37 F38	N37-F61 HydrophobicContact CB-CE1 4.3Å; N37-F61 HydrophobicContact CB-CE2 3.63Å; N37-F61 HydrophobicContact CB-CZ 3.4Å; N37-F61 VanDerWaalsContact CB-CZ 3.4Å; F38-F61 CarbonylContact O-C 3.59Å; F38-F61 WeakPolarHBondContact O-CA 3.33Å
62	I	98.2	Very high	96	Very high	6 Å²	6	80.6 Å²	80.6	3%	0.031	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.9	124.2	-176.7	-60.8	168.7	0	0	0	107.7	I17 L19 I25 N37 F38 L40 G64 I66 V67	I17-I62 HydrophobicContact CB-CD1 4.34Å; I17-I62 HydrophobicContact CD1-CD1 4.02Å; I17-I62 HydrophobicContact CG2-CD1 4.23Å; L19-I62 HydrophobicContact CD2-CG2 3.59Å; I25-I62 HydrophobicContact CD1-CD1 3.96Å; I25-I62 HydrophobicContact CD1-CG1 4.46Å; N37-I62 CarbonylContact C-O 3.57Å; N37-I62 VanDerWaalsContact CA-O 3.29Å; N37-I62 WeakPolarHBondContact CA-O 3.24Å; F38-I62 HydrophobicContact CB-CB 4.44Å; F38-I62 PolarHBondContact N-O 2.86Å; F38-I62 PolarHBondContact O-N 3.12Å; L40-I62 HydrophobicContact CD1-CD1 3.93Å; L40-I62 HydrophobicContact CG-CD1 4.36Å; I62-G64 PolarHBondContact O-N 3.23Å; I62-I66 HydrophobicContact CG2-CD1 4.29Å; I62-I66 HydrophobicContact CG2-CG1 4.17Å; I62-V67 HydrophobicContact CG2-CG2 3.66Å
63	R	98.3	Very high	95.7	Very high	168 Å²	168	79 Å²	79	63%	0.634	40%	0.395	S	S	*	.			trans	-70.9	127.4	175.3	-169.9	179.2	178.1	170.6	0.3	109.9	N37 S65 I66	N37-R63 VanDerWaalsContact OD1-CA 3.27Å; N37-R63 WeakPolarHBondContact OD1-CA 3.16Å; R63-S65 WeakPolarHBondContact CD-OG 3.27Å; R63-S65 PolarHBondContact NE-OG 3.16Å; R63-S65 PolarHBondContact O-N 2.98Å; R63-I66 HydrophobicContact CB-CG1 4.39Å; R63-I66 WeakPolarHBondContact O-CG1 3.06Å; R63-I66 PolarHBondContact O-N 3.21Å
64	G	98.1	Very high	95.8	Very high	15 Å²	15	77.3 Å²	77.3	16%	0.155	40%	0.402	C	S	.	.	G	3₁₀ helix	trans	-56.9	-31.3	-174.9	0	0	0	0	0	114.2	H36 N37 I62 I66 V67	H36-G64 WeakPolarHBondContact O-CA 3.25Å; N37-G64 PolarHBondContact OD1-N 2.96Å; I62-G64 PolarHBondContact O-N 3.23Å; G64-I66 PolarHBondContact O-N 2.77Å; G64-V67 PolarHBondContact O-N 2.73Å
65	S	98	Very high	95.8	Very high	66 Å²	66	82.4 Å²	82.4	46%	0.462	43%	0.43	S	S	.	.	G	3₁₀ helix	trans	-66.2	-18.3	179.9	63.1	0	0	0	0	114.9	K20 R63	K20-S65 WeakPolarHBondContact CE-O 3.48Å; K20-S65 PolarHBondContact NZ-O 3.04Å; R63-S65 WeakPolarHBondContact CD-OG 3.27Å; R63-S65 PolarHBondContact NE-OG 3.16Å; R63-S65 PolarHBondContact O-N 2.98Å
66	I	98.1	Very high	95.9	Very high	73 Å²	73	79.4 Å²	79.4	37%	0.374	41%	0.413	S	S	.	.	G	3₁₀ helix	trans	-98.6	-6.4	178.6	65.6	160.7	0	0	0	113.1	L19 K20 I62 R63 G64	L19-I66 WeakPolarHBondContact CA-O 3.44Å; L19-I66 HydrophobicContact CD1-CD1 4.03Å; L19-I66 HydrophobicContact CD2-CD1 4.27Å; L19-I66 HydrophobicContact CD2-CG1 4.31Å; K20-I66 WeakPolarHBondContact CG-O 3.47Å; K20-I66 PolarHBondContact N-O 3.37Å; I62-I66 HydrophobicContact CG2-CD1 4.29Å; I62-I66 HydrophobicContact CG2-CG1 4.17Å; R63-I66 HydrophobicContact CB-CG1 4.39Å; R63-I66 WeakPolarHBondContact O-CG1 3.06Å; R63-I66 PolarHBondContact O-N 3.21Å; G64-I66 PolarHBondContact O-N 2.77Å
67	V	98.4	Very high	95.8	Very high	24 Å²	24	75.3 Å²	75.3	15%	0.145	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.7	135.1	176.5	178.8	0	0	0	0	109.2	I17 L19 F38 I62 G64 V70	I17-V67 HydrophobicContact CG2-CB 4.47Å; I17-V67 HydrophobicContact CG2-CG1 3.88Å; I17-V67 HydrophobicContact CG2-CG2 3.91Å; L19-V67 HydrophobicContact CD2-CG2 4.2Å; F38-V67 HydrophobicContact CD2-CG2 4.02Å; F38-V67 HydrophobicContact CE2-CG2 4.04Å; I62-V67 HydrophobicContact CG2-CG2 3.66Å; G64-V67 PolarHBondContact O-N 2.73Å; V67-V70 HydrophobicContact CG1-CG2 3.78Å
68	R	98.3	Very high	95.7	Very high	92 Å²	92	77.1 Å²	77.1	35%	0.347	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.5	-53.4	170.5	-170.9	-173.4	-65.4	149.4	-4.3	110.1	E18 K20 D22	E18-R68 PolarHBondContact O-N 3.31Å; E18-R68 WeakPolarHBondContact OE1-CD 3.37Å; E18-R68 IonicContact OE1-CZ 2.75Å; E18-R68 IonicContact OE1-NH1 2.79Å; E18-R68 PolarHBondContact OE1-NH1 3.46Å; K20-R68 HydrophobicContact CG-CB 4.15Å; K20-R68 PolarHBondContact O-NH2 2.67Å; D22-R68 IonicContact OD1-CZ 3.22Å; D22-R68 VanDerWaalsContact OD1-CZ 3.22Å; D22-R68 IonicContact OD1-NH1 2.68Å; D22-R68 PolarHBondContact OD1-NH1 2.91Å; D22-R68 IonicContact OD1-NH2 2.81Å; D22-R68 PolarHBondContact OD1-NH2 3.35Å
69	Y	98.3	Very high	95.7	Very high	141 Å²	141	74.1 Å²	74.1	55%	0.553	39%	0.386	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-136.1	151.2	179.3	-56.3	-56	0	0	0	111.6	E18	E18-Y69 PolarHBondContact N-O 2.92Å; E18-Y69 PolarHBondContact O-N 2.86Å; E18-Y69 VanDerWaalsContact O-N 3.1Å
70	V	97.7	Very high	95.6	Very high	34 Å²	34	75.1 Å²	75.1	21%	0.206	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.3	112	166.5	-175.1	0	0	0	0	106.4	F7 V15 L16 I17 F38 V67 L72	F7-V70 HydrophobicContact CE1-CB 4.2Å; F7-V70 HydrophobicContact CE1-CG1 4.05Å; F7-V70 HydrophobicContact CE1-CG2 4.34Å; F7-V70 HydrophobicContact CZ-CB 4.4Å; F7-V70 HydrophobicContact CZ-CG2 4.27Å; V15-V70 HydrophobicContact CB-CG1 4.32Å; L16-V70 CarbonylContact O-C 3.54Å; L16-V70 WeakPolarHBondContact O-CA 3.37Å; I17-V70 HydrophobicContact CG1-CG1 4.25Å; I17-V70 HydrophobicContact CG1-CG2 4.31Å; F38-V70 HydrophobicContact CE2-CG2 4.37Å; F38-V70 HydrophobicContact CZ-CG2 4.08Å; V67-V70 HydrophobicContact CG1-CG2 3.78Å; V70-L72 HydrophobicContact CG1-CD2 3.61Å; V70-L72 HydrophobicContact CG1-CG 4.23Å
71	Q	97.1	Very high	95.5	Very high	108 Å²	108	80.6 Å²	80.6	51%	0.505	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	132	174.3	-62.8	-178.7	-6.8	0	0	109	L16	L16-Q71 HydrophobicContact CB-CB 4.17Å; L16-Q71 HydrophobicContact CD2-CB 4.48Å; L16-Q71 HydrophobicContact CD2-CG 4.22Å; L16-Q71 PolarHBondContact N-O 3.22Å; L16-Q71 VanDerWaalsContact N-O 3.16Å; L16-Q71 PolarHBondContact O-N 3.01Å
72	L	95.1	Very high	95.4	Very high	49 Å²	49	76.5 Å²	76.5	26%	0.257	40%	0.398	S	S	.	.			trans	-127.2	147.3	-170.7	-58.4	175.6	0	0	0	110.1	F6 F7 L10 V15 V70 A74	F6-L72 HydrophobicContact CE1-CD1 3.59Å; F6-L72 HydrophobicContact CZ-CD1 3.69Å; F7-L72 HydrophobicContact CE1-CD1 4.47Å; L10-L72 HydrophobicContact CD1-CD1 3.64Å; L10-L72 HydrophobicContact CD1-CD2 3.72Å; L10-L72 HydrophobicContact CD1-CG 4.28Å; V15-L72 HydrophobicContact CB-CD2 4.22Å; V15-L72 HydrophobicContact CG1-CD2 3.52Å; V70-L72 HydrophobicContact CG1-CD2 3.61Å; V70-L72 HydrophobicContact CG1-CG 4.23Å; L72-A74 PolarHBondContact O-N 2.91Å
73	P	88.4	Confident	95.3	Very high	42 Å²	42	81 Å²	81	27%	0.273	42%	0.419	S	S	.	.			trans	-61.8	133	168.2	-14	27.3	0	0	0	110.1	D75 E76 C77	P73-D75 VanDerWaalsContact C-N 3.27Å; P73-D75 WeakPolarHBondContact CB-OD1 3.48Å; P73-D75 PolarHBondContact O-N 2.78Å; P73-E76 HydrophobicContact CB-CB 4.3Å; P73-E76 HydrophobicContact CB-CG 3.85Å; P73-E76 HydrophobicContact CG-CG 4Å; P73-E76 PolarHBondContact O-N 2.9Å; P73-C77 PolarHBondContact O-SG 2.9Å; P73-C77 VanDerWaalsContact O-SG 3.4Å
74	A	91.4	Very high	95.2	Very high	88 Å²	88	77 Å²	77	73%	0.727	41%	0.41	S	S	*	.	G	3₁₀ helix	trans	-66.2	-31.8	-175.9	0	0	0	0	0	112.7	L72 E76 C77	L72-A74 PolarHBondContact O-N 2.91Å; A74-E76 VanDerWaalsContact C-N 3.28Å; A74-E76 PolarHBondContact O-N 3.47Å; A74-C77 PolarHBondContact O-N 3.38Å
75	D	92.6	Very high	95.1	Very high	137 Å²	137	78 Å²	78	73%	0.733	42%	0.417	S	S	*	.	G	3₁₀ helix	trans	-68.1	-23.2	176.7	54.2	-38.5	0	0	0	113.5	P73 C77	P73-D75 VanDerWaalsContact C-N 3.27Å; P73-D75 WeakPolarHBondContact CB-OD1 3.48Å; P73-D75 PolarHBondContact O-N 2.78Å; D75-C77 VanDerWaalsContact C-N 3.32Å
76	E	90.4	Very high	94.9	Very high	61 Å²	61	77.1 Å²	77.1	29%	0.285	41%	0.411	S	S	.	.	G	3₁₀ helix	trans	-87.5	-1.7	176.6	-60.7	-67.6	173.1	0	0	112.9	L10 K13 P73 A74	L10-E76 HydrophobicContact CD2-CB 3.84Å; K13-E76 HydrophobicContact CD-CG 4.23Å; K13-E76 WeakPolarHBondContact CD-OE1 3.45Å; K13-E76 VanDerWaalsContact CE-CD 3.41Å; K13-E76 WeakPolarHBondContact CE-OE1 3.37Å; K13-E76 WeakPolarHBondContact CE-OE2 3.26Å; K13-E76 HydrophobicContact CG-CG 4.33Å; K13-E76 IonicContact NZ-OE1 2.68Å; K13-E76 PolarHBondContact NZ-OE1 3.23Å; K13-E76 IonicContact NZ-OE2 2.91Å; K13-E76 PolarHBondContact NZ-OE2 3.37Å; P73-E76 HydrophobicContact CB-CB 4.3Å; P73-E76 HydrophobicContact CB-CG 3.85Å; P73-E76 HydrophobicContact CG-CG 4Å; P73-E76 PolarHBondContact O-N 2.9Å; A74-E76 VanDerWaalsContact C-N 3.28Å; A74-E76 PolarHBondContact O-N 3.47Å
77	C	91.6	Very high	94.8	Very high	29 Å²	29	79.9 Å²	79.9	20%	0.196	42%	0.417	C	S	.	.			trans	-114.8	95.4	-174	-63.1	0	0	0	0	111.8	P73 A74 D75 T79	P73-C77 PolarHBondContact O-SG 2.9Å; P73-C77 VanDerWaalsContact O-SG 3.4Å; A74-C77 PolarHBondContact O-N 3.38Å; D75-C77 VanDerWaalsContact C-N 3.32Å; C77-T79 PolarHBondContact O-N 2.84Å
78	D	93	Very high	94.6	Very high	92 Å²	92	86 Å²	86	49%	0.492	44%	0.441	S	S	.	.			trans	-70.5	97.9	169.6	-169.6	-34.3	0	0	0	110.5	I80 E81 L82	D78-I80 VanDerWaalsContact C-N 3.28Å; D78-I80 PolarHBondContact O-N 3.15Å; D78-I80 WeakPolarHBondContact OD1-CA 3.22Å; D78-I80 WeakPolarHBondContact OD1-CB 3.27Å; D78-I80 PolarHBondContact OD1-N 2.83Å; D78-E81 HydrophobicContact CB-CB 4.11Å; D78-E81 PolarHBondContact O-N 2.97Å; D78-E81 PolarHBondContact OD1-N 2.8Å; D78-L82 WeakPolarHBondContact O-CB 3.39Å; D78-L82 PolarHBondContact O-N 2.86Å
79	T	94.3	Very high	94.3	Very high	86 Å²	86	85.7 Å²	85.7	53%	0.528	44%	0.443	S	S	.	.	H	α-helix	trans	-67	-26.8	-179.3	60.9	0	0	0	0	113.2	C77 Q83	C77-T79 PolarHBondContact O-N 2.84Å; T79-Q83 WeakPolarHBondContact O-CB 3.49Å; T79-Q83 WeakPolarHBondContact O-CG 3.13Å; T79-Q83 PolarHBondContact O-N 3.04Å
80	I	95.7	Very high	94	Very high	110 Å²	110	81.8 Å²	81.8	56%	0.564	44%	0.44	S	S	*	.	H	α-helix	trans	-71.7	-46.8	178.8	-63.5	171.3	0	0	0	109	D78 Q83 N84	D78-I80 VanDerWaalsContact C-N 3.28Å; D78-I80 PolarHBondContact O-N 3.15Å; D78-I80 WeakPolarHBondContact OD1-CA 3.22Å; D78-I80 WeakPolarHBondContact OD1-CB 3.27Å; D78-I80 PolarHBondContact OD1-N 2.83Å; I80-Q83 PolarHBondContact O-N 2.82Å; I80-N84 PolarHBondContact O-N 2.88Å; I80-N84 PolarHBondContact O-ND2 3.1Å
81	E	94.9	Very high	93.7	Very high	134 Å²	134	84.5 Å²	84.5	63%	0.626	46%	0.457	S	S	*	.	H	α-helix	trans	-62.6	-44.6	175.6	-172.5	168.6	-172.7	0	0	111.1	D78 Q83 N84 A85	D78-E81 HydrophobicContact CB-CB 4.11Å; D78-E81 PolarHBondContact O-N 2.97Å; D78-E81 PolarHBondContact OD1-N 2.8Å; E81-Q83 VanDerWaalsContact C-N 3.32Å; E81-Q83 PolarHBondContact O-N 3.37Å; E81-N84 PolarHBondContact O-N 3.2Å; E81-N84 VanDerWaalsContact O-N 3.17Å; E81-A85 WeakPolarHBondContact O-CB 3.43Å; E81-A85 PolarHBondContact O-N 2.84Å
82	L	95.6	Very high	93.1	Very high	51 Å²	51	83.6 Å²	83.6	27%	0.267	46%	0.459	S	S	.	.	H	α-helix	trans	-60.1	-41	177.1	-175.9	60.3	0	0	0	112.1	L2 F6 D78 S86	L2-L82 HydrophobicContact CD1-CD1 4.27Å; F6-L82 HydrophobicContact CD2-CD1 4.21Å; F6-L82 HydrophobicContact CG-CD1 4.44Å; D78-L82 WeakPolarHBondContact O-CB 3.39Å; D78-L82 PolarHBondContact O-N 2.86Å; L82-S86 VanDerWaalsContact O-CB 3.26Å; L82-S86 WeakPolarHBondContact O-CB 3.45Å; L82-S86 PolarHBondContact O-N 2.89Å; L82-S86 PolarHBondContact O-OG 2.88Å
83	Q	96.2	Very high	91.9	Very high	102 Å²	102	84.8 Å²	84.8	48%	0.477	48%	0.483	S	S	.	.	H	α-helix	trans	-64.6	-44.5	174.4	-77	175.8	26.5	0	0	112.4	T79 I80 E81 S86 R87	T79-Q83 WeakPolarHBondContact O-CB 3.49Å; T79-Q83 WeakPolarHBondContact O-CG 3.13Å; T79-Q83 PolarHBondContact O-N 3.04Å; I80-Q83 PolarHBondContact O-N 2.82Å; E81-Q83 VanDerWaalsContact C-N 3.32Å; E81-Q83 PolarHBondContact O-N 3.37Å; Q83-S86 PolarHBondContact O-N 3.47Å; Q83-R87 PolarHBondContact O-N 2.94Å
84	N	95.7	Very high	90.9	Very high	83 Å²	83	91 Å²	91	44%	0.444	51%	0.506	S	S	.	.	H	α-helix	trans	-60.9	-48	177.2	-77.2	-33.2	0	0	0	111.4	I80 E81 S86 R87 K88	I80-N84 PolarHBondContact O-N 2.88Å; I80-N84 PolarHBondContact O-ND2 3.1Å; E81-N84 PolarHBondContact O-N 3.2Å; E81-N84 VanDerWaalsContact O-N 3.17Å; N84-S86 VanDerWaalsContact C-N 3.31Å; N84-S86 PolarHBondContact O-N 3.05Å; N84-R87 PolarHBondContact O-N 3.19Å; N84-R87 PolarHBondContact OD1-NH2 2.84Å; N84-K88 PolarHBondContact O-N 2.78Å
85	A	95.5	Very high	89.4	Confident	35 Å²	35	94 Å²	94	29%	0.289	51%	0.505	S	S	.	.	H	α-helix	trans	-63.6	-38.1	178.3	0	0	0	0	0	111.4	L2 E81 K88 E89	L2-A85 HydrophobicContact CD1-CB 3.34Å; E81-A85 WeakPolarHBondContact O-CB 3.43Å; E81-A85 PolarHBondContact O-N 2.84Å; A85-K88 PolarHBondContact O-N 3.46Å; A85-E89 WeakPolarHBondContact O-CB 3.46Å; A85-E89 PolarHBondContact O-N 3.38Å
86	S	95.5	Very high	87.6	Confident	48 Å²	48	92.2 Å²	92.2	34%	0.336	50%	0.5	S	S	.	.	H	α-helix	trans	-63.7	-45	175	-61.1	0	0	0	0	112.8	L2 L82 Q83 N84 K88 E89 A90	L2-S86 WeakPolarHBondContact CD2-OG 3.41Å; L82-S86 VanDerWaalsContact O-CB 3.26Å; L82-S86 WeakPolarHBondContact O-CB 3.45Å; L82-S86 PolarHBondContact O-N 2.89Å; L82-S86 PolarHBondContact O-OG 2.88Å; Q83-S86 PolarHBondContact O-N 3.47Å; N84-S86 VanDerWaalsContact C-N 3.31Å; N84-S86 PolarHBondContact O-N 3.05Å; S86-K88 VanDerWaalsContact C-N 3.34Å; S86-K88 PolarHBondContact O-N 2.75Å; S86-E89 PolarHBondContact O-N 3.17Å; S86-A90 WeakPolarHBondContact O-CB 3.38Å; S86-A90 PolarHBondContact O-N 3.04Å
87	R	94.6	Very high	86.1	Confident	132 Å²	132	99 Å²	99	50%	0.498	53%	0.532	S	S	.	.	H	α-helix	trans	-59.5	-46.1	174.8	-76.4	-174.5	-76.3	-91.6	3.8	111.1	Q83 N84 A90 T91	Q83-R87 PolarHBondContact O-N 2.94Å; N84-R87 PolarHBondContact O-N 3.19Å; N84-R87 PolarHBondContact OD1-NH2 2.84Å; R87-A90 PolarHBondContact O-N 3.08Å; R87-T91 WeakPolarHBondContact O-CG2 3.47Å; R87-T91 PolarHBondContact O-N 3.06Å
88	K	93.7	Very high	83.8	Confident	152 Å²	152	107.9 Å²	107.9	66%	0.661	58%	0.578	S	S	*	*	H	α-helix	trans	-61.9	-50.8	178.8	-170.2	178.5	179.5	-178.8	0	111.3	N84 A85 S86 A90 T91 V92	N84-K88 PolarHBondContact O-N 2.78Å; A85-K88 PolarHBondContact O-N 3.46Å; S86-K88 VanDerWaalsContact C-N 3.34Å; S86-K88 PolarHBondContact O-N 2.75Å; K88-A90 VanDerWaalsContact C-N 3.3Å; K88-A90 PolarHBondContact O-N 3.25Å; K88-T91 PolarHBondContact O-N 3.12Å; K88-T91 VanDerWaalsContact O-N 3.1Å; K88-T91 PolarHBondContact O-OG1 3.2Å; K88-V92 PolarHBondContact O-N 3.21Å
89	E	93.1	Very high	83.4	Confident	85 Å²	85	108.7 Å²	108.7	40%	0.397	58%	0.582	S	S	.	*	H	α-helix	trans	-57.3	-42.6	179	-173.4	80.9	178.8	0	0	111.7	M1 L2 A85 S86 T91 V92 G93	M1-E89 PolarHBondContact N-OE1 3.36Å; L2-E89 HydrophobicContact CB-CB 4.45Å; L2-E89 HydrophobicContact CB-CG 4.17Å; A85-E89 WeakPolarHBondContact O-CB 3.46Å; A85-E89 PolarHBondContact O-N 3.38Å; S86-E89 PolarHBondContact O-N 3.17Å; E89-T91 VanDerWaalsContact C-N 3.26Å; E89-T91 PolarHBondContact O-N 3.28Å; E89-V92 PolarHBondContact O-N 3.48Å; E89-G93 PolarHBondContact O-N 3.15Å
90	A	92.3	Very high	82.8	Confident	59 Å²	59	109.9 Å²	109.9	49%	0.488	59%	0.585	S	S	.	*	H	α-helix	trans	-66	-25.3	179.6	0	0	0	0	0	113.8	S86 R87 K88 K94	S86-A90 WeakPolarHBondContact O-CB 3.38Å; S86-A90 PolarHBondContact O-N 3.04Å; R87-A90 PolarHBondContact O-N 3.08Å; K88-A90 VanDerWaalsContact C-N 3.3Å; K88-A90 PolarHBondContact O-N 3.25Å; A90-K94 WeakPolarHBondContact O-CG 3.47Å
91	T	90.5	Very high	82.1	Confident	91 Å²	91	109.9 Å²	109.9	56%	0.558	59%	0.586	S	S	*	*	H	α-helix	trans	-79.2	-35.1	174.1	59.2	0	0	0	0	112.6	R87 K88 E89 G93 K94	R87-T91 WeakPolarHBondContact O-CG2 3.47Å; R87-T91 PolarHBondContact O-N 3.06Å; K88-T91 PolarHBondContact O-N 3.12Å; K88-T91 VanDerWaalsContact O-N 3.1Å; K88-T91 PolarHBondContact O-OG1 3.2Å; E89-T91 VanDerWaalsContact C-N 3.26Å; E89-T91 PolarHBondContact O-N 3.28Å; T91-G93 PolarHBondContact O-N 2.82Å; T91-K94 PolarHBondContact O-N 3.22Å
92	V	84.5	Confident	81.3	Confident	90 Å²	90	108.5 Å²	108.5	55%	0.545	58%	0.584	S	S	.	*	H	α-helix	trans	-63.6	-43	179.1	175	0	0	0	0	110.8	K88 E89 K94 Q95	K88-V92 PolarHBondContact O-N 3.21Å; E89-V92 PolarHBondContact O-N 3.48Å; V92-K94 PolarHBondContact O-N 3.46Å; V92-K94 VanDerWaalsContact O-N 3.11Å; V92-Q95 PolarHBondContact O-N 2.79Å
93	G	70.6	Confident	80.5	Confident	73 Å²	73	112.1 Å²	112.1	75%	0.753	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.3	-9.5	178.7	0	0	0	0	0	115.1	E89 T91	E89-G93 PolarHBondContact O-N 3.15Å; T91-G93 PolarHBondContact O-N 2.82Å
94	K	67	Low	79.4	Confident	174 Å²	174	112.7 Å²	112.7	76%	0.757	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.5	-4.8	-178.3	-71.8	-176.1	179.7	-175.4	0	114.1	A90 T91 V92 P96	A90-K94 WeakPolarHBondContact O-CG 3.47Å; T91-K94 PolarHBondContact O-N 3.22Å; V92-K94 PolarHBondContact O-N 3.46Å; V92-K94 VanDerWaalsContact O-N 3.11Å; K94-P96 WeakPolarHBondContact O-CD 3.37Å
95	Q	59.5	Low	78.2	Confident	151 Å²	151	114.9 Å²	114.9	71%	0.706	62%	0.624	S	S	*	*	S	Bend	trans	-68.2	121	175.1	-78	-175.4	-21.3	0	0	108.9	V92 Q97	V92-Q95 PolarHBondContact O-N 2.79Å; Q95-Q97 PolarHBondContact O-N 2.81Å
96	P	56.2	Low	76.9	Confident	98 Å²	98	121 Å²	121	64%	0.636	65%	0.649	S	S	*	*			trans	-59.5	130.3	174.7	23.9	-30.5	0	0	0	108	K94 N98	K94-P96 WeakPolarHBondContact O-CD 3.37Å; P96-N98 PolarHBondContact O-N 2.68Å
97	Q	57.6	Low	75.4	Confident	203 Å²	203	127.1 Å²	127.1	95%	0.949	68%	0.676	S	S	*	*			trans	-65	89.7	162.5	-72.5	178.4	1.3	0	0	106	Q95	Q95-Q97 PolarHBondContact O-N 2.81Å
98	N	44.7	Very low	73.6	Confident	217 Å²	217	126.6 Å²	126.6	100%	1.16	69%	0.692	S	S	*	*			trans	-69.8	0	166.8	-75.5	-14.9	0	0	0	109.7	P96	P96-N98 PolarHBondContact O-N 2.68Å

Retrieved 98 of 98 residues in 37.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).