A0A5K4F775_SCHMA Loading...

Ovule protein

AlphaFold DB , UniProt , Accession A0A5K4F775, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 66 aa.

						>A0A5K4F775_SCHMA|A0A5K4F775
MIASLYHLFVMKNSVHLGSTMEIMVDIISTHFIQHKLSLPNYEHFTMRPNFMQMSDVFLSEEDSGR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.5	Low	74.7	Confident	206 Å²	206	118.5 Å²	118.5	100%	1.015	61%	0.61	S	S	*	*				0	-45.6	0	-65.5	-177.4	78.5	0	0	112.7	A3 S4	M1-A3 PolarHBondContact O-N 3.21Å; M1-S4 PolarHBondContact O-N 3.09Å
2	I	73.6	Confident	74.7	Confident	146 Å²	146	120.9 Å²	120.9	75%	0.749	61%	0.613	S	S	*	*	H	α-helix	trans	-61.6	-41.7	-177.4	-61.8	167.9	0	0	0	113.4	S4 L5 Y6	I2-S4 VanDerWaalsContact C-N 3.31Å; I2-S4 PolarHBondContact O-N 2.78Å; I2-L5 PolarHBondContact O-N 3.34Å; I2-Y6 PolarHBondContact O-N 2.82Å; I2-Y6 VanDerWaalsContact O-N 3.12Å
3	A	72	Confident	74.2	Confident	63 Å²	63	117 Å²	117	52%	0.521	60%	0.595	S	S	.	*	H	α-helix	trans	-59.1	-39	-179.8	0	0	0	0	0	113.1	M1 L5 Y6 H7	M1-A3 PolarHBondContact O-N 3.21Å; A3-L5 VanDerWaalsContact C-N 3.34Å; A3-L5 PolarHBondContact O-N 3.21Å; A3-Y6 PolarHBondContact O-N 3.25Å; A3-H7 PolarHBondContact O-CD2 2.85Å; A3-H7 PolarHBondContact O-N 3.07Å
4	S	76.6	Confident	73.4	Confident	89 Å²	89	113.9 Å²	113.9	62%	0.622	59%	0.589	S	S	*	*	H	α-helix	trans	-65.4	-36.6	179	-50.7	0	0	0	0	112.4	M1 I2 L8	M1-S4 PolarHBondContact O-N 3.09Å; I2-S4 VanDerWaalsContact C-N 3.31Å; I2-S4 PolarHBondContact O-N 2.78Å; S4-L8 PolarHBondContact O-N 2.95Å; S4-L8 VanDerWaalsContact O-N 3.14Å
5	L	75.2	Confident	73	Confident	121 Å²	121	113.5 Å²	113.5	63%	0.634	59%	0.593	S	S	*	*	H	α-helix	trans	-67.9	-40.2	175	-79.3	153.6	0	0	0	111.6	I2 A3 L8 F9	I2-L5 PolarHBondContact O-N 3.34Å; A3-L5 VanDerWaalsContact C-N 3.34Å; A3-L5 PolarHBondContact O-N 3.21Å; L5-L8 PolarHBondContact O-N 2.78Å; L5-F9 WeakPolarHBondContact O-CB 3.05Å; L5-F9 PolarHBondContact O-N 2.69Å
6	Y	78	Confident	72.5	Confident	153 Å²	153	114.4 Å²	114.4	60%	0.6	59%	0.593	S	S	*	*	H	α-helix	trans	-62.7	-46.7	176.1	-179	-98.8	0	0	0	111.8	I2 A3 L8 F9 V10	I2-Y6 PolarHBondContact O-N 2.82Å; I2-Y6 VanDerWaalsContact O-N 3.12Å; A3-Y6 PolarHBondContact O-N 3.25Å; Y6-L8 VanDerWaalsContact C-N 3.33Å; Y6-L8 PolarHBondContact O-N 3.11Å; Y6-F9 PolarHBondContact O-N 2.94Å; Y6-V10 HydrophobicContact CD1-CG2 4.11Å; Y6-V10 HydrophobicContact CD2-CG2 4.48Å; Y6-V10 HydrophobicContact CE1-CG2 3.7Å; Y6-V10 HydrophobicContact CE2-CG2 4.1Å; Y6-V10 HydrophobicContact CG-CG2 4.49Å; Y6-V10 WeakPolarHBondContact O-CG2 3.5Å; Y6-V10 PolarHBondContact O-N 2.62Å
7	H	79.2	Confident	72	Confident	115 Å²	115	114.1 Å²	114.1	53%	0.532	59%	0.592	S	S	.	*	H	α-helix	trans	-60.6	-41.5	176.6	-77.6	-68.3	0	0	0	112.4	A3 V10 M11	A3-H7 PolarHBondContact O-CD2 2.85Å; A3-H7 PolarHBondContact O-N 3.07Å; H7-V10 PolarHBondContact O-N 2.94Å; H7-M11 WeakPolarHBondContact O-CB 3.1Å; H7-M11 VanDerWaalsContact O-CG 3.31Å; H7-M11 WeakPolarHBondContact O-CG 3.3Å; H7-M11 PolarHBondContact O-N 3.02Å
8	L	75.4	Confident	71.9	Confident	101 Å²	101	109.1 Å²	109.1	53%	0.529	57%	0.573	S	S	.	*	H	α-helix	trans	-65.3	-39.5	177.5	-167.7	71.2	0	0	0	112.1	S4 L5 Y6 K12	S4-L8 PolarHBondContact O-N 2.95Å; S4-L8 VanDerWaalsContact O-N 3.14Å; L5-L8 PolarHBondContact O-N 2.78Å; Y6-L8 VanDerWaalsContact C-N 3.33Å; Y6-L8 PolarHBondContact O-N 3.11Å; L8-K12 WeakPolarHBondContact O-CB 3.23Å; L8-K12 PolarHBondContact O-N 2.74Å
9	F	77.4	Confident	72	Confident	132 Å²	132	106.1 Å²	106.1	58%	0.579	56%	0.562	S	S	*	*	H	α-helix	trans	-65	-46.2	176	-179.3	-103.7	0	0	0	111.7	L5 Y6 K12 N13	L5-F9 WeakPolarHBondContact O-CB 3.05Å; L5-F9 PolarHBondContact O-N 2.69Å; Y6-F9 PolarHBondContact O-N 2.94Å; F9-K12 PolarHBondContact O-N 3.39Å; F9-N13 VanDerWaalsContact CD1-ND2 3.28Å; F9-N13 WeakPolarHBondContact CD1-ND2 3.24Å; F9-N13 WeakPolarHBondContact CD2-ND2 3.2Å; F9-N13 WeakPolarHBondContact CE1-ND2 3.24Å; F9-N13 WeakPolarHBondContact CE2-ND2 3.16Å; F9-N13 WeakPolarHBondContact CG-ND2 3.37Å; F9-N13 WeakPolarHBondContact CZ-ND2 3.33Å; F9-N13 WeakPolarHBondContact O-CB 3.29Å; F9-N13 PolarHBondContact O-N 3.48Å; F9-N13 PolarHBondContact O-ND2 3.31Å
10	V	76.8	Confident	72.2	Confident	52 Å²	52	103.8 Å²	103.8	32%	0.315	55%	0.552	S	S	.	*	H	α-helix	trans	-62.1	-46.1	176.5	173.7	0	0	0	0	110.6	Y6 H7 K12 N13 S14	Y6-V10 HydrophobicContact CD1-CG2 4.11Å; Y6-V10 HydrophobicContact CD2-CG2 4.48Å; Y6-V10 HydrophobicContact CE1-CG2 3.7Å; Y6-V10 HydrophobicContact CE2-CG2 4.1Å; Y6-V10 HydrophobicContact CG-CG2 4.49Å; Y6-V10 WeakPolarHBondContact O-CG2 3.5Å; Y6-V10 PolarHBondContact O-N 2.62Å; H7-V10 PolarHBondContact O-N 2.94Å; V10-K12 PolarHBondContact O-N 2.81Å; V10-N13 PolarHBondContact O-N 2.85Å; V10-S14 VanDerWaalsContact O-CB 3.27Å; V10-S14 WeakPolarHBondContact O-CB 3.46Å; V10-S14 PolarHBondContact O-N 3.45Å; V10-S14 PolarHBondContact O-OG 2.81Å
11	M	74.6	Confident	72.5	Confident	125 Å²	125	104 Å²	104	62%	0.616	55%	0.551	S	S	*	*	H	α-helix	trans	-59.7	-45.7	177.8	-75.1	-178.7	179.5	0	0	112.1	H7 V15	H7-M11 WeakPolarHBondContact O-CB 3.1Å; H7-M11 VanDerWaalsContact O-CG 3.31Å; H7-M11 WeakPolarHBondContact O-CG 3.3Å; H7-M11 PolarHBondContact O-N 3.02Å; M11-V15 WeakPolarHBondContact O-CB 3.25Å; M11-V15 WeakPolarHBondContact O-CG2 3.43Å; M11-V15 PolarHBondContact O-N 3.45Å
12	K	73.9	Confident	73.2	Confident	148 Å²	148	100.9 Å²	100.9	64%	0.643	53%	0.534	S	S	*	.	H	α-helix	trans	-63	-45.1	177.9	-83	-171.9	165.1	-175.3	0	112.5	L8 F9 V10 H16	L8-K12 WeakPolarHBondContact O-CB 3.23Å; L8-K12 PolarHBondContact O-N 2.74Å; F9-K12 PolarHBondContact O-N 3.39Å; V10-K12 PolarHBondContact O-N 2.81Å; K12-H16 WeakPolarHBondContact O-CB 3.25Å; K12-H16 PolarHBondContact O-N 2.83Å
13	N	68.3	Low	73.6	Confident	70 Å²	70	98.4 Å²	98.4	37%	0.374	52%	0.522	S	S	.	.	H	α-helix	trans	-69.9	-39.5	179.9	-70.4	-40.4	0	0	0	111.9	F9 V10 H16 L17	F9-N13 VanDerWaalsContact CD1-ND2 3.28Å; F9-N13 WeakPolarHBondContact CD1-ND2 3.24Å; F9-N13 WeakPolarHBondContact CD2-ND2 3.2Å; F9-N13 WeakPolarHBondContact CE1-ND2 3.24Å; F9-N13 WeakPolarHBondContact CE2-ND2 3.16Å; F9-N13 WeakPolarHBondContact CG-ND2 3.37Å; F9-N13 WeakPolarHBondContact CZ-ND2 3.33Å; F9-N13 WeakPolarHBondContact O-CB 3.29Å; F9-N13 PolarHBondContact O-N 3.48Å; F9-N13 PolarHBondContact O-ND2 3.31Å; V10-N13 PolarHBondContact O-N 2.85Å; N13-H16 PolarHBondContact O-N 2.83Å; N13-L17 VanDerWaalsContact O-CB 3.32Å; N13-L17 WeakPolarHBondContact O-CB 3.26Å; N13-L17 PolarHBondContact O-N 2.83Å
14	S	63.2	Low	74.2	Confident	73 Å²	73	100.6 Å²	100.6	51%	0.51	52%	0.522	S	S	.	.	H	α-helix	trans	-65.7	-40.4	177.4	-64.9	0	0	0	0	112.3	V10 G18	V10-S14 VanDerWaalsContact O-CB 3.27Å; V10-S14 WeakPolarHBondContact O-CB 3.46Å; V10-S14 PolarHBondContact O-N 3.45Å; V10-S14 PolarHBondContact O-OG 2.81Å; S14-G18 PolarHBondContact O-N 3.44Å
15	V	68.2	Low	74.6	Confident	109 Å²	109	100.6 Å²	100.6	66%	0.661	52%	0.518	S	S	*	.	H	α-helix	trans	-66.3	-41.8	175.6	172.3	0	0	0	0	110.7	M11 G18 S19	M11-V15 WeakPolarHBondContact O-CB 3.25Å; M11-V15 WeakPolarHBondContact O-CG2 3.43Å; M11-V15 PolarHBondContact O-N 3.45Å; V15-G18 PolarHBondContact O-N 2.85Å; V15-S19 PolarHBondContact O-N 3.37Å
16	H	64.8	Low	75	Confident	128 Å²	128	99.8 Å²	99.8	59%	0.593	52%	0.515	S	S	*	.	H	α-helix	trans	-67.6	-41.3	177.3	-168.1	61.9	0	0	0	112.3	K12 N13 S19 T20	K12-H16 WeakPolarHBondContact O-CB 3.25Å; K12-H16 PolarHBondContact O-N 2.83Å; N13-H16 PolarHBondContact O-N 2.83Å; H16-S19 PolarHBondContact O-N 3.38Å; H16-T20 WeakPolarHBondContact O-CB 3.25Å; H16-T20 PolarHBondContact O-N 2.82Å; H16-T20 PolarHBondContact O-OG1 3.45Å
17	L	62.8	Low	75.3	Confident	108 Å²	108	97.5 Å²	97.5	57%	0.565	51%	0.512	S	S	*	.	H	α-helix	trans	-64	-42.5	175.6	-132.2	79.8	0	0	0	110.9	N13 T20 M21	N13-L17 VanDerWaalsContact O-CB 3.32Å; N13-L17 WeakPolarHBondContact O-CB 3.26Å; N13-L17 PolarHBondContact O-N 2.83Å; L17-T20 PolarHBondContact O-N 3.49Å; L17-M21 WeakPolarHBondContact O-CG 3.24Å; L17-M21 PolarHBondContact O-N 2.95Å
18	G	70.5	Confident	75.6	Confident	24 Å²	24	97 Å²	97	25%	0.247	51%	0.512	C	S	.	.	H	α-helix	trans	-57.1	-53.5	175.6	0	0	0	0	0	111.5	S14 V15 T20 M21 E22	S14-G18 PolarHBondContact O-N 3.44Å; V15-G18 PolarHBondContact O-N 2.85Å; G18-T20 VanDerWaalsContact C-N 3.31Å; G18-T20 PolarHBondContact O-N 3.41Å; G18-M21 PolarHBondContact O-N 3.41Å; G18-E22 WeakPolarHBondContact O-CG 3.24Å; G18-E22 PolarHBondContact O-N 2.94Å
19	S	73.8	Confident	75.9	Confident	53 Å²	53	94.6 Å²	94.6	37%	0.371	50%	0.504	S	S	.	.	H	α-helix	trans	-61.5	-37.6	177.5	179.3	0	0	0	0	112.7	V15 H16 E22 I23	V15-S19 PolarHBondContact O-N 3.37Å; H16-S19 PolarHBondContact O-N 3.38Å; S19-E22 PolarHBondContact O-N 2.83Å; S19-I23 WeakPolarHBondContact O-CD1 3.42Å; S19-I23 VanDerWaalsContact O-CG1 3.22Å; S19-I23 WeakPolarHBondContact O-CG1 3.25Å; S19-I23 PolarHBondContact O-N 3.41Å
20	T	76.6	Confident	76	Confident	59 Å²	59	91 Å²	91	36%	0.362	49%	0.492	S	S	.	.	H	α-helix	trans	-66.9	-40.4	177.6	-54.7	0	0	0	0	111.7	H16 L17 G18 I23 M24	H16-T20 WeakPolarHBondContact O-CB 3.25Å; H16-T20 PolarHBondContact O-N 2.82Å; H16-T20 PolarHBondContact O-OG1 3.45Å; L17-T20 PolarHBondContact O-N 3.49Å; G18-T20 VanDerWaalsContact C-N 3.31Å; G18-T20 PolarHBondContact O-N 3.41Å; T20-I23 PolarHBondContact O-N 2.72Å; T20-M24 WeakPolarHBondContact O-CB 3.45Å; T20-M24 PolarHBondContact O-N 2.85Å
21	M	78.3	Confident	76.2	Confident	108 Å²	108	94.4 Å²	94.4	53%	0.532	51%	0.505	S	S	.	.	H	α-helix	trans	-66.7	-40.9	176.1	-72.3	-174.4	-64.6	0	0	111.6	L17 G18 M24 V25	L17-M21 WeakPolarHBondContact O-CG 3.24Å; L17-M21 PolarHBondContact O-N 2.95Å; G18-M21 PolarHBondContact O-N 3.41Å; M21-M24 PolarHBondContact O-N 2.9Å; M21-V25 WeakPolarHBondContact O-CB 3.41Å; M21-V25 VanDerWaalsContact O-CG2 3.29Å; M21-V25 WeakPolarHBondContact O-CG2 3.34Å; M21-V25 PolarHBondContact O-N 3.28Å
22	E	78.3	Confident	76.4	Confident	141 Å²	141	94.9 Å²	94.9	66%	0.659	50%	0.503	S	S	*	.	H	α-helix	trans	-59.3	-47.7	174.9	-72.3	174.6	172.2	0	0	111.3	G18 S19 M24 V25 D26	G18-E22 WeakPolarHBondContact O-CG 3.24Å; G18-E22 PolarHBondContact O-N 2.94Å; S19-E22 PolarHBondContact O-N 2.83Å; E22-M24 PolarHBondContact O-N 3.47Å; E22-V25 PolarHBondContact O-N 3.33Å; E22-D26 WeakPolarHBondContact O-CB 3.29Å; E22-D26 PolarHBondContact O-N 3.48Å
23	I	82	Confident	76.4	Confident	95 Å²	95	92.2 Å²	92.2	49%	0.487	50%	0.495	S	S	.	.	H	α-helix	trans	-62.1	-42.8	176.2	-66.8	163.8	0	0	0	111	S19 T20 D26 I27	S19-I23 WeakPolarHBondContact O-CD1 3.42Å; S19-I23 VanDerWaalsContact O-CG1 3.22Å; S19-I23 WeakPolarHBondContact O-CG1 3.25Å; S19-I23 PolarHBondContact O-N 3.41Å; T20-I23 PolarHBondContact O-N 2.72Å; I23-D26 PolarHBondContact O-N 2.89Å; I23-I27 HydrophobicContact CG2-CD1 3.7Å; I23-I27 HydrophobicContact CG2-CG1 4.35Å; I23-I27 VanDerWaalsContact O-CG1 3.25Å; I23-I27 WeakPolarHBondContact O-CG1 3.49Å; I23-I27 PolarHBondContact O-N 2.9Å
24	M	84.9	Confident	76.5	Confident	109 Å²	109	94.5 Å²	94.5	54%	0.537	50%	0.504	S	S	.	.	H	α-helix	trans	-62.4	-45.1	178.9	-175.7	-175.4	-66.3	0	0	111.6	T20 M21 E22 D26 I27 I28	T20-M24 WeakPolarHBondContact O-CB 3.45Å; T20-M24 PolarHBondContact O-N 2.85Å; M21-M24 PolarHBondContact O-N 2.9Å; E22-M24 PolarHBondContact O-N 3.47Å; M24-D26 VanDerWaalsContact C-N 3.33Å; M24-I27 PolarHBondContact O-N 3.37Å; M24-I28 HydrophobicContact CG-CD1 3.84Å; M24-I28 WeakPolarHBondContact O-CB 3.22Å; M24-I28 VanDerWaalsContact O-CG1 3.25Å; M24-I28 WeakPolarHBondContact O-CG1 3.36Å; M24-I28 PolarHBondContact O-N 2.72Å
25	V	84.4	Confident	76.5	Confident	88 Å²	88	96.3 Å²	96.3	53%	0.533	50%	0.504	S	S	.	.	H	α-helix	trans	-63.7	-40.4	177.6	170.9	0	0	0	0	110.9	M21 E22 I28 S29	M21-V25 WeakPolarHBondContact O-CB 3.41Å; M21-V25 VanDerWaalsContact O-CG2 3.29Å; M21-V25 WeakPolarHBondContact O-CG2 3.34Å; M21-V25 PolarHBondContact O-N 3.28Å; E22-V25 PolarHBondContact O-N 3.33Å; V25-I28 PolarHBondContact O-N 2.91Å; V25-S29 VanDerWaalsContact O-CB 3.24Å; V25-S29 WeakPolarHBondContact O-CB 3.38Å; V25-S29 PolarHBondContact O-N 3.35Å; V25-S29 PolarHBondContact O-OG 2.8Å
26	D	84.3	Confident	76.2	Confident	105 Å²	105	98 Å²	98	56%	0.561	50%	0.503	S	S	*	.	H	α-helix	trans	-65.7	-42.5	177.8	-169.2	45.6	0	0	0	112.1	E22 I23 M24 S29 T30	E22-D26 WeakPolarHBondContact O-CB 3.29Å; E22-D26 PolarHBondContact O-N 3.48Å; I23-D26 PolarHBondContact O-N 2.89Å; M24-D26 VanDerWaalsContact C-N 3.33Å; D26-S29 PolarHBondContact O-N 3.01Å; D26-T30 VanDerWaalsContact O-CB 3.24Å; D26-T30 WeakPolarHBondContact O-CB 3.43Å; D26-T30 PolarHBondContact O-N 2.97Å; D26-T30 PolarHBondContact O-OG1 3.22Å
27	I	84.2	Confident	76	Confident	105 Å²	105	98.5 Å²	98.5	54%	0.538	51%	0.509	S	S	.	.	H	α-helix	trans	-62.6	-47.4	174.7	-68.2	166.9	0	0	0	110.9	I23 M24 T30 H31	I23-I27 HydrophobicContact CG2-CD1 3.7Å; I23-I27 HydrophobicContact CG2-CG1 4.35Å; I23-I27 VanDerWaalsContact O-CG1 3.25Å; I23-I27 WeakPolarHBondContact O-CG1 3.49Å; I23-I27 PolarHBondContact O-N 2.9Å; M24-I27 PolarHBondContact O-N 3.37Å; I27-T30 PolarHBondContact O-N 3.43Å; I27-H31 VanDerWaalsContact O-CB 3.26Å; I27-H31 WeakPolarHBondContact O-CB 3.49Å; I27-H31 PolarHBondContact O-N 2.99Å
28	I	84.8	Confident	75.8	Confident	104 Å²	104	97.3 Å²	97.3	53%	0.533	51%	0.509	S	S	.	.	H	α-helix	trans	-63.3	-43.5	179.1	-68.4	167.3	0	0	0	110.4	M24 V25 H31 F32	M24-I28 HydrophobicContact CG-CD1 3.84Å; M24-I28 WeakPolarHBondContact O-CB 3.22Å; M24-I28 VanDerWaalsContact O-CG1 3.25Å; M24-I28 WeakPolarHBondContact O-CG1 3.36Å; M24-I28 PolarHBondContact O-N 2.72Å; V25-I28 PolarHBondContact O-N 2.91Å; I28-H31 PolarHBondContact O-N 3.03Å; I28-F32 VanDerWaalsContact O-CB 3.24Å; I28-F32 WeakPolarHBondContact O-CB 3.4Å; I28-F32 PolarHBondContact O-N 3.36Å
29	S	81	Confident	75	Confident	51 Å²	51	101.2 Å²	101.2	36%	0.357	52%	0.524	S	S	.	.	H	α-helix	trans	-64.3	-45.6	179.1	-59.7	0	0	0	0	111	V25 D26 F32 I33	V25-S29 VanDerWaalsContact O-CB 3.24Å; V25-S29 WeakPolarHBondContact O-CB 3.38Å; V25-S29 PolarHBondContact O-N 3.35Å; V25-S29 PolarHBondContact O-OG 2.8Å; D26-S29 PolarHBondContact O-N 3.01Å; S29-F32 PolarHBondContact O-N 3.01Å; S29-I33 WeakPolarHBondContact O-CB 2.97Å; S29-I33 WeakPolarHBondContact O-CD1 3.36Å; S29-I33 WeakPolarHBondContact O-CG1 3.17Å; S29-I33 PolarHBondContact O-N 3.3Å
30	T	80.2	Confident	73.7	Confident	56 Å²	56	102.9 Å²	102.9	34%	0.344	53%	0.533	S	S	.	.	H	α-helix	trans	-61.1	-47.2	175.9	-62.5	0	0	0	0	111	D26 I27 F32 I33 Q34	D26-T30 VanDerWaalsContact O-CB 3.24Å; D26-T30 WeakPolarHBondContact O-CB 3.43Å; D26-T30 PolarHBondContact O-N 2.97Å; D26-T30 PolarHBondContact O-OG1 3.22Å; I27-T30 PolarHBondContact O-N 3.43Å; T30-F32 PolarHBondContact O-N 3.45Å; T30-I33 PolarHBondContact O-N 3.46Å; T30-Q34 HydrophobicContact CG2-CG 4.35Å; T30-Q34 VanDerWaalsContact O-CB 3.29Å; T30-Q34 WeakPolarHBondContact O-CB 3.42Å; T30-Q34 VanDerWaalsContact O-CG 3.23Å; T30-Q34 WeakPolarHBondContact O-CG 3.28Å; T30-Q34 PolarHBondContact O-N 2.91Å
31	H	80.3	Confident	72.4	Confident	124 Å²	124	107.3 Å²	107.3	57%	0.574	56%	0.555	S	S	*	*	H	α-helix	trans	-64.7	-40.6	178.8	-171.8	-84.9	0	0	0	111.9	I27 I28 H35	I27-H31 VanDerWaalsContact O-CB 3.26Å; I27-H31 WeakPolarHBondContact O-CB 3.49Å; I27-H31 PolarHBondContact O-N 2.99Å; I28-H31 PolarHBondContact O-N 3.03Å; H31-H35 WeakPolarHBondContact O-CB 3.49Å; H31-H35 PolarHBondContact O-N 2.88Å
32	F	78.9	Confident	70.8	Confident	134 Å²	134	110.7 Å²	110.7	59%	0.588	56%	0.563	S	S	*	*	H	α-helix	trans	-65	-43.5	176.6	-177.3	-98.7	0	0	0	111.9	I28 S29 T30 H35 K36	I28-F32 VanDerWaalsContact O-CB 3.24Å; I28-F32 WeakPolarHBondContact O-CB 3.4Å; I28-F32 PolarHBondContact O-N 3.36Å; S29-F32 PolarHBondContact O-N 3.01Å; T30-F32 PolarHBondContact O-N 3.45Å; F32-H35 PolarHBondContact O-N 3.06Å; F32-K36 HydrophobicContact CE1-CD 4.26Å; F32-K36 VanDerWaalsContact O-CB 3.25Å; F32-K36 WeakPolarHBondContact O-CB 3.02Å; F32-K36 PolarHBondContact O-N 3.02Å
33	I	75.2	Confident	69.4	Low	92 Å²	92	113 Å²	113	47%	0.472	57%	0.574	S	S	.	*	H	α-helix	trans	-65.9	-45.7	177.4	-70.5	166	0	0	0	110.4	S29 T30 K36 L37	S29-I33 WeakPolarHBondContact O-CB 2.97Å; S29-I33 WeakPolarHBondContact O-CD1 3.36Å; S29-I33 WeakPolarHBondContact O-CG1 3.17Å; S29-I33 PolarHBondContact O-N 3.3Å; T30-I33 PolarHBondContact O-N 3.46Å; I33-K36 PolarHBondContact O-N 2.82Å; I33-L37 HydrophobicContact CG2-CD1 3.47Å; I33-L37 VanDerWaalsContact CG2-CD1 3.47Å; I33-L37 HydrophobicContact CG2-CG 4.41Å; I33-L37 VanDerWaalsContact O-CB 3.3Å; I33-L37 WeakPolarHBondContact O-CB 3.32Å; I33-L37 WeakPolarHBondContact O-CG 3.48Å; I33-L37 PolarHBondContact O-N 2.95Å
34	Q	69.6	Low	67.7	Low	119 Å²	119	116.4 Å²	116.4	56%	0.556	59%	0.588	S	S	*	*	H	α-helix	trans	-60.6	-46.2	175.4	-76.5	177.5	-18.4	0	0	111.1	T30 K36 L37 S38	T30-Q34 HydrophobicContact CG2-CG 4.35Å; T30-Q34 VanDerWaalsContact O-CB 3.29Å; T30-Q34 WeakPolarHBondContact O-CB 3.42Å; T30-Q34 VanDerWaalsContact O-CG 3.23Å; T30-Q34 WeakPolarHBondContact O-CG 3.28Å; T30-Q34 PolarHBondContact O-N 2.91Å; Q34-K36 PolarHBondContact O-N 3.35Å; Q34-L37 PolarHBondContact O-N 3.43Å; Q34-S38 WeakPolarHBondContact O-CB 3.2Å; Q34-S38 PolarHBondContact O-N 3Å; Q34-S38 PolarHBondContact O-OG 2.99Å
35	H	62.9	Low	65.8	Low	111 Å²	111	118 Å²	118	51%	0.514	59%	0.592	S	S	.	*	H	α-helix	trans	-59.4	-49	176.1	-172.3	-88.3	0	0	0	110.5	H31 F32 L37 S38 L39	H31-H35 WeakPolarHBondContact O-CB 3.49Å; H31-H35 PolarHBondContact O-N 2.88Å; F32-H35 PolarHBondContact O-N 3.06Å; H35-L37 PolarHBondContact O-N 3.39Å; H35-S38 WeakPolarHBondContact CA-OG 3.27Å; H35-S38 PolarHBondContact O-N 2.91Å; H35-S38 PolarHBondContact O-OG 3.18Å; H35-L39 VanDerWaalsContact O-CD1 3.24Å; H35-L39 WeakPolarHBondContact O-CD1 3.46Å; H35-L39 PolarHBondContact O-N 3.45Å; H35-L39 VanDerWaalsContact O-N 3.11Å
36	K	61.9	Low	64.2	Low	145 Å²	145	120 Å²	120	63%	0.63	60%	0.604	S	S	*	*	H	α-helix	trans	-64.4	-37.1	179.9	-169	176.3	-179.5	-178.7	0	113.6	F32 I33 Q34	F32-K36 HydrophobicContact CE1-CD 4.26Å; F32-K36 VanDerWaalsContact O-CB 3.25Å; F32-K36 WeakPolarHBondContact O-CB 3.02Å; F32-K36 PolarHBondContact O-N 3.02Å; I33-K36 PolarHBondContact O-N 2.82Å; Q34-K36 PolarHBondContact O-N 3.35Å
37	L	61.1	Low	62.6	Low	138 Å²	138	123.4 Å²	123.4	72%	0.723	62%	0.619	S	S	*	*	H	α-helix	trans	-76.5	-28.5	175	-79.2	160.6	0	0	0	112.6	I33 Q34 H35 L39	I33-L37 HydrophobicContact CG2-CD1 3.47Å; I33-L37 VanDerWaalsContact CG2-CD1 3.47Å; I33-L37 HydrophobicContact CG2-CG 4.41Å; I33-L37 VanDerWaalsContact O-CB 3.3Å; I33-L37 WeakPolarHBondContact O-CB 3.32Å; I33-L37 WeakPolarHBondContact O-CG 3.48Å; I33-L37 PolarHBondContact O-N 2.95Å; Q34-L37 PolarHBondContact O-N 3.43Å; H35-L37 PolarHBondContact O-N 3.39Å; L37-L39 VanDerWaalsContact C-N 3.3Å
38	S	59.5	Low	60.7	Low	83 Å²	83	127.9 Å²	127.9	58%	0.58	63%	0.629	S	S	*	*	H	α-helix	trans	-81	-7.5	176.7	73.4	0	0	0	0	113.6	Q34 H35 P40	Q34-S38 WeakPolarHBondContact O-CB 3.2Å; Q34-S38 PolarHBondContact O-N 3Å; Q34-S38 PolarHBondContact O-OG 2.99Å; H35-S38 WeakPolarHBondContact CA-OG 3.27Å; H35-S38 PolarHBondContact O-N 2.91Å; H35-S38 PolarHBondContact O-OG 3.18Å; S38-P40 WeakPolarHBondContact O-CD 3.31Å; S38-P40 VanDerWaalsContact O-N 3.14Å
39	L	51.9	Low	58.9	Low	105 Å²	105	127.8 Å²	127.8	55%	0.55	64%	0.635	S	S	.	*	S	Bend	trans	-65.1	109.7	159	-90.1	92.3	0	0	0	106.4	H35 L37 N41	H35-L39 VanDerWaalsContact O-CD1 3.24Å; H35-L39 WeakPolarHBondContact O-CD1 3.46Å; H35-L39 PolarHBondContact O-N 3.45Å; H35-L39 VanDerWaalsContact O-N 3.11Å; L37-L39 VanDerWaalsContact C-N 3.3Å; L39-N41 PolarHBondContact O-N 3.24Å
40	P	47.5	Very low	57.2	Low	88 Å²	88	129 Å²	129	57%	0.571	64%	0.638	S	S	*	*			trans	-58	133.5	168.3	24.8	-28.1	0	0	0	106.3	S38 Y42	S38-P40 WeakPolarHBondContact O-CD 3.31Å; S38-P40 VanDerWaalsContact O-N 3.14Å; P40-Y42 HydrophobicContact CB-CD2 4.47Å; P40-Y42 HydrophobicContact CG-CD2 3.89Å; P40-Y42 HydrophobicContact CG-CE2 3.95Å; P40-Y42 WeakPolarHBondContact O-CD2 3.44Å; P40-Y42 PolarHBondContact O-N 2.98Å
41	N	49.1	Very low	55.6	Low	153 Å²	153	136.1 Å²	136.1	82%	0.818	66%	0.664	S	S	*	*			trans	-37.5	80.9	172.7	-82.4	-42.2	0	0	0	113.2	L39 E43	L39-N41 PolarHBondContact O-N 3.24Å; N41-E43 VanDerWaalsContact C-N 3.26Å
42	Y	45.2	Very low	53.9	Low	179 Å²	179	137.7 Å²	137.7	70%	0.702	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95	18.5	170.9	-95	-77.2	0	0	0	111.1	P40 F45	P40-Y42 HydrophobicContact CB-CD2 4.47Å; P40-Y42 HydrophobicContact CG-CD2 3.89Å; P40-Y42 HydrophobicContact CG-CE2 3.95Å; P40-Y42 WeakPolarHBondContact O-CD2 3.44Å; P40-Y42 PolarHBondContact O-N 2.98Å; Y42-F45 HydrophobicContact CD1-CE2 4.07Å
43	E	48.5	Very low	52.5	Low	190 Å²	190	140.3 Å²	140.3	89%	0.888	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.1	19.9	153.9	-68.2	-159.2	163.7	0	0	112.2	N41 F45	N41-E43 VanDerWaalsContact C-N 3.26Å; E43-F45 PolarHBondContact O-N 3.4Å; E43-F45 VanDerWaalsContact O-N 3.07Å
44	H	46.9	Very low	51	Low	166 Å²	166	144.6 Å²	144.6	77%	0.769	71%	0.708	S	S	*	*			trans	-77.6	54.4	150.2	-163	-78.3	0	0	0	110.3
45	F	44.2	Very low	50.1	Low	143 Å²	143	142.7 Å²	142.7	63%	0.627	71%	0.708	S	S	*	*	S	Bend	trans	-127.8	87.9	162.3	-87.4	-80.5	0	0	0	106.7	Y42 E43 M47	Y42-F45 HydrophobicContact CD1-CE2 4.07Å; E43-F45 PolarHBondContact O-N 3.4Å; E43-F45 VanDerWaalsContact O-N 3.07Å; F45-M47 VanDerWaalsContact C-N 3.34Å; F45-M47 PolarHBondContact O-N 2.9Å
46	T	50.7	Low	49.4	Very low	130 Å²	130	144.8 Å²	144.8	80%	0.798	72%	0.723	S	S	*	*			trans	38.9	55.4	134.3	57	0	0	0	0	116.2
47	M	50.4	Low	48.7	Very low	175 Å²	175	143.4 Å²	143.4	86%	0.862	73%	0.726	S	S	*	*			trans	-139.8	55	163.8	-70.5	-160.2	-167.3	0	0	109.7	F45 P49	F45-M47 VanDerWaalsContact C-N 3.34Å; F45-M47 PolarHBondContact O-N 2.9Å; M47-P49 VanDerWaalsContact O-CD 3.25Å; M47-P49 WeakPolarHBondContact O-CD 3.43Å
48	R	45.3	Very low	48.1	Very low	199 Å²	199	145.6 Å²	145.6	75%	0.751	73%	0.73	S	S	*	*			trans	-64.2	117.8	139.9	-155.8	179.3	-163.8	-140.3	11.7	103.6	N50	R48-N50 WeakPolarHBondContact CD-OD1 3.35Å; R48-N50 PolarHBondContact NH1-OD1 3.03Å; R48-N50 PolarHBondContact O-N 3.39Å
49	P	47.8	Very low	47.7	Very low	102 Å²	102	147.8 Å²	147.8	66%	0.662	74%	0.735	S	S	*	*			trans	-69.9	74	155.3	31.4	-29.2	0	0	0	104.8	M47 F51	M47-P49 VanDerWaalsContact O-CD 3.25Å; M47-P49 WeakPolarHBondContact O-CD 3.43Å; P49-F51 HydrophobicContact CB-CD2 4.43Å; P49-F51 HydrophobicContact CB-CE2 4.42Å; P49-F51 PolarHBondContact O-N 3.43Å
50	N	45.1	Very low	47.5	Very low	78 Å²	78	148.7 Å²	148.7	42%	0.417	75%	0.75	S	S	.	*			trans	-59.2	101	148.5	-108.1	5.8	0	0	0	102.5	R48 M52	R48-N50 WeakPolarHBondContact CD-OD1 3.35Å; R48-N50 PolarHBondContact NH1-OD1 3.03Å; R48-N50 PolarHBondContact O-N 3.39Å; N50-M52 HydrophobicContact CB-CB 4.17Å; N50-M52 HydrophobicContact CB-CG 4.43Å; N50-M52 PolarHBondContact O-N 3.14Å
51	F	46.2	Very low	47.7	Very low	205 Å²	205	152.4 Å²	152.4	90%	0.899	76%	0.759	S	S	*	*	S	Bend	trans	-60.1	61.6	160.8	-82	-92.8	0	0	0	108.7	P49	P49-F51 HydrophobicContact CB-CD2 4.43Å; P49-F51 HydrophobicContact CB-CE2 4.42Å; P49-F51 PolarHBondContact O-N 3.43Å
52	M	45	Very low	47.9	Very low	156 Å²	156	151.8 Å²	151.8	77%	0.768	75%	0.752	S	S	*	*			trans	-134	23	-178	-77.8	-170.9	133.8	0	0	110.8	N50	N50-M52 HydrophobicContact CB-CB 4.17Å; N50-M52 HydrophobicContact CB-CG 4.43Å; N50-M52 PolarHBondContact O-N 3.14Å
53	Q	49	Very low	48.3	Very low	190 Å²	190	152 Å²	152	89%	0.888	77%	0.765	S	S	*	*	S	Bend	trans	-139.2	35.6	-179.9	-134.2	178.1	59.8	0	0	113.8
54	M	43.6	Very low	48.5	Very low	182 Å²	182	146.7 Å²	146.7	90%	0.897	75%	0.749	S	S	*	*	S	Bend	trans	-136.9	119.7	160	-112.2	160.3	-179.7	0	0	108
55	S	49.5	Very low	48.5	Very low	79 Å²	79	142.8 Å²	142.8	55%	0.552	75%	0.753	S	S	*	*			trans	82.8	64.9	-179.8	73	0	0	0	0	118.3	V57	S55-V57 VanDerWaalsContact CA-N 3.33Å; S55-V57 PolarHBondContact O-N 3.31Å
56	D	48.9	Very low	48.4	Very low	155 Å²	155	150.6 Å²	150.6	83%	0.829	78%	0.779	S	S	*	*	S	Bend		-64.2	47.5	127.7	-76.6	-43.1	0	0	0	110.2
57	V	48	Very low	48.3	Very low	115 Å²	115	151.6 Å²	151.6	70%	0.697	78%	0.778	S	S	*	*			trans	-141.5	36	178.5	-166.4	0	0	0	0	108.2	S55	S55-V57 VanDerWaalsContact CA-N 3.33Å; S55-V57 PolarHBondContact O-N 3.31Å
58	F	48.3	Very low	48.2	Very low	185 Å²	185	150.4 Å²	150.4	81%	0.811	77%	0.773	S	S	*	*			trans	-147.9	48	153.9	-77.2	-77.6	0	0	0	107.7	S60	F58-S60 VanDerWaalsContact C-N 3.26Å; F58-S60 PolarHBondContact O-N 3.12Å; F58-S60 VanDerWaalsContact O-N 3.09Å
59	L	51.2	Low	48.4	Very low	129 Å²	129	147.7 Å²	147.7	68%	0.675	78%	0.775	S	S	*	*			trans	-57.4	105.3	142.2	-61.7	170.5	0	0	0	102.4	E61	L59-E61 PolarHBondContact O-N 3.38Å
60	S	47.1	Very low	48.4	Very low	124 Å²	124	150.4 Å²	150.4	87%	0.867	78%	0.781	S	S	*	*				30.2	36.5	86.3	-69.2	0	0	0	0	112.8	F58 E62	F58-S60 VanDerWaalsContact C-N 3.26Å; F58-S60 PolarHBondContact O-N 3.12Å; F58-S60 VanDerWaalsContact O-N 3.09Å; S60-E62 VanDerWaalsContact C-N 3.27Å; S60-E62 PolarHBondContact O-N 3.27Å
61	E	52.5	Low	48.6	Very low	165 Å²	165	154.9 Å²	154.9	77%	0.771	80%	0.804	S	S	*	*			trans	-70.6	98.8	146.1	-74.6	-168.6	135.4	0	0	105.4	L59	L59-E61 PolarHBondContact O-N 3.38Å
62	E	53.4	Low	48.8	Very low	140 Å²	140	151.5 Å²	151.5	65%	0.654	80%	0.798	S	S	*	*			trans	61	95.8	140.5	-67.3	-179.1	115.3	0	0	114.5	S60 S64	S60-E62 VanDerWaalsContact C-N 3.27Å; S60-E62 PolarHBondContact O-N 3.27Å; E62-S64 PolarHBondContact O-N 3.44Å
63	D	52.8	Low	49	Very low	185 Å²	185	151.2 Å²	151.2	99%	0.989	80%	0.8	S	S	*	*	S	Bend		13.7	38.2	68.6	-137.3	10.7	0	0	0	116.6
64	S	52	Low	49	Very low	77 Å²	77	148.2 Å²	148.2	54%	0.538	79%	0.793	S	S	.	*			trans	-142.3	46.6	164.8	-170.2	0	0	0	0	110	E62 R66	E62-S64 PolarHBondContact O-N 3.44Å; S64-R66 VanDerWaalsContact C-N 3.3Å; S64-R66 PolarHBondContact O-N 3.14Å
65	G	47.3	Very low	49.5	Very low	84 Å²	84	145.4 Å²	145.4	87%	0.866	78%	0.784	S	S	*	*			trans	-87	70.4	162.1	0	0	0	0	0	110
66	R	43	Very low	49.5	Very low	307 Å²	307	151.5 Å²	151.5	100%	1.158	81%	0.805	S	S	*	*			trans	-147.1	0	171.3	-146.1	178.8	178.9	159.2	1.2	111.4	S64	S64-R66 VanDerWaalsContact C-N 3.3Å; S64-R66 PolarHBondContact O-N 3.14Å

Retrieved 66 of 66 residues in 14 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).