A0A5K4F785_SCHMA Loading...

ATP synthase subunit epsilon, mitochondrial

AlphaFold DB , UniProt , Accession A0A5K4F785, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 76 aa.

						>A0A5K4F785_SCHMA|A0A5K4F785
MNVKLKLQKFWITALNKYPHFVYIVPLGSVCVYVSITKHLRLRALGPEEAYKYKKMYVVKRAEDVELTEDNAHLYN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.4	Low	80.4	Confident	174 Å²	174	127.4 Å²	127.4	86%	0.857	61%	0.605	S	S	*	*				0	116.1	0	-170.5	161	73	0	0	109.1	K6	M1-K6 HydrophobicContact CE-CD 4.15Å; M1-K6 HydrophobicContact CE-CG 3.88Å
2	N	80.2	Confident	80.6	Confident	131 Å²	131	125.1 Å²	125.1	70%	0.701	60%	0.597	S	S	*	*			trans	-58.4	130.7	-170.7	-111.2	-36.9	0	0	0	112.6	K4 L5 K6	N2-K4 PolarHBondContact O-N 3.07Å; N2-L5 HydrophobicContact CB-CB 4.46Å; N2-L5 WeakPolarHBondContact O-CB 3.47Å; N2-L5 PolarHBondContact O-N 3.28Å; N2-K6 PolarHBondContact O-N 2.94Å
3	V	83.7	Confident	80.8	Confident	112 Å²	112	122.5 Å²	122.5	68%	0.679	60%	0.595	S	S	*	*	H	α-helix	trans	-55.3	-39	-179.7	177.5	0	0	0	0	111.4	L5 K6 L7	V3-L5 VanDerWaalsContact C-N 3.31Å; V3-L5 PolarHBondContact O-N 3.01Å; V3-K6 PolarHBondContact O-N 3.41Å; V3-L7 PolarHBondContact O-N 3.45Å
4	K	83	Confident	80.7	Confident	171 Å²	171	115.4 Å²	115.4	74%	0.743	57%	0.565	S	S	*	*	H	α-helix	trans	-56.3	-42.5	176.3	-65.6	-172.7	178.8	-177.2	0	112.7	N2 L7 Q8	N2-K4 PolarHBondContact O-N 3.07Å; K4-L7 PolarHBondContact O-N 3.49Å; K4-Q8 WeakPolarHBondContact O-CG 3.45Å; K4-Q8 PolarHBondContact O-N 3Å
5	L	83.8	Confident	80.6	Confident	80 Å²	80	112.7 Å²	112.7	42%	0.419	55%	0.554	S	S	.	*	H	α-helix	trans	-68.8	-38.2	-179.1	-161.9	87.7	0	0	0	111.5	N2 V3 K9	N2-L5 HydrophobicContact CB-CB 4.46Å; N2-L5 WeakPolarHBondContact O-CB 3.47Å; N2-L5 PolarHBondContact O-N 3.28Å; V3-L5 VanDerWaalsContact C-N 3.31Å; V3-L5 PolarHBondContact O-N 3.01Å; L5-K9 WeakPolarHBondContact O-CG 3.25Å; L5-K9 PolarHBondContact O-N 3.46Å; L5-K9 VanDerWaalsContact O-N 3.07Å
6	K	84.1	Confident	80.7	Confident	124 Å²	124	113.9 Å²	113.9	54%	0.539	56%	0.563	S	S	.	*	H	α-helix	trans	-62.2	-44.4	174.4	-77.8	-174.1	175.7	-176.3	0	111	M1 N2 V3 K9 F10	M1-K6 HydrophobicContact CE-CD 4.15Å; M1-K6 HydrophobicContact CE-CG 3.88Å; N2-K6 PolarHBondContact O-N 2.94Å; V3-K6 PolarHBondContact O-N 3.41Å; K6-K9 PolarHBondContact O-N 3.48Å; K6-F10 WeakPolarHBondContact O-CB 3.35Å; K6-F10 PolarHBondContact O-N 3.35Å
7	L	81.5	Confident	80.9	Confident	101 Å²	101	115.6 Å²	115.6	53%	0.529	57%	0.567	S	S	.	*	H	α-helix	trans	-64.8	-45.2	-179.5	-140.6	99.4	0	0	0	111.6	V3 K4 K9 F10 W11	V3-L7 PolarHBondContact O-N 3.45Å; K4-L7 PolarHBondContact O-N 3.49Å; L7-K9 PolarHBondContact O-N 3.39Å; L7-F10 WeakPolarHBondContact O-CB 3.48Å; L7-F10 PolarHBondContact O-N 3.34Å; L7-W11 PolarHBondContact O-N 3.49Å
8	Q	83.8	Confident	80.9	Confident	120 Å²	120	115.7 Å²	115.7	56%	0.561	56%	0.561	S	S	*	*	H	α-helix	trans	-59.8	-47.1	177	-75.7	177.5	-32.7	0	0	111.8	K4 F10 W11 I12	K4-Q8 WeakPolarHBondContact O-CG 3.45Å; K4-Q8 PolarHBondContact O-N 3Å; Q8-F10 VanDerWaalsContact C-N 3.31Å; Q8-F10 PolarHBondContact O-N 3.49Å; Q8-W11 PolarHBondContact O-N 3.38Å; Q8-I12 WeakPolarHBondContact O-CD1 3.48Å; Q8-I12 VanDerWaalsContact O-CG1 3.25Å; Q8-I12 WeakPolarHBondContact O-CG1 3.42Å; Q8-I12 PolarHBondContact O-N 3Å
9	K	84.4	Confident	80.8	Confident	129 Å²	129	113.8 Å²	113.8	56%	0.561	56%	0.558	S	S	*	*	H	α-helix	trans	-60.7	-40.7	176.3	-76.7	-175.2	175.7	-172.5	0	112.1	L5 K6 L7 I12 T13	L5-K9 WeakPolarHBondContact O-CG 3.25Å; L5-K9 PolarHBondContact O-N 3.46Å; L5-K9 VanDerWaalsContact O-N 3.07Å; K6-K9 PolarHBondContact O-N 3.48Å; L7-K9 PolarHBondContact O-N 3.39Å; K9-I12 PolarHBondContact O-N 3.04Å; K9-T13 PolarHBondContact O-N 3.49Å; K9-T13 PolarHBondContact O-OG1 3.44Å
10	F	84.2	Confident	80.8	Confident	141 Å²	141	114.8 Å²	114.8	62%	0.618	56%	0.561	S	S	*	*	H	α-helix	trans	-61.1	-47.5	176.1	178.3	-95.6	0	0	0	111.8	K6 L7 Q8 T13 A14	K6-F10 WeakPolarHBondContact O-CB 3.35Å; K6-F10 PolarHBondContact O-N 3.35Å; L7-F10 WeakPolarHBondContact O-CB 3.48Å; L7-F10 PolarHBondContact O-N 3.34Å; Q8-F10 VanDerWaalsContact C-N 3.31Å; Q8-F10 PolarHBondContact O-N 3.49Å; F10-T13 PolarHBondContact O-N 3.05Å; F10-A14 WeakPolarHBondContact O-CB 3.45Å; F10-A14 PolarHBondContact O-N 3.01Å
11	W	79.3	Confident	80.7	Confident	118 Å²	118	113.4 Å²	113.4	45%	0.447	55%	0.552	S	S	.	*	H	α-helix	trans	-62.9	-42.4	177.9	-81.1	111.6	0	0	0	112.7	L7 Q8 T13 A14 L15 V25	L7-W11 PolarHBondContact O-N 3.49Å; Q8-W11 PolarHBondContact O-N 3.38Å; W11-T13 PolarHBondContact O-N 3.34Å; W11-A14 PolarHBondContact O-N 3.29Å; W11-L15 WeakPolarHBondContact O-CB 3.4Å; W11-L15 PolarHBondContact O-N 3.02Å; W11-V25 HydrophobicContact CZ3-CG2 4.36Å
12	I	83.1	Confident	81.7	Confident	100 Å²	100	108.4 Å²	108.4	51%	0.513	53%	0.532	S	S	.	.	H	α-helix	trans	-60.5	-47	176.4	-68.3	161.7	0	0	0	110.5	Q8 K9 A14 L15 N16	Q8-I12 WeakPolarHBondContact O-CD1 3.48Å; Q8-I12 VanDerWaalsContact O-CG1 3.25Å; Q8-I12 WeakPolarHBondContact O-CG1 3.42Å; Q8-I12 PolarHBondContact O-N 3Å; K9-I12 PolarHBondContact O-N 3.04Å; I12-A14 PolarHBondContact O-N 3.22Å; I12-L15 PolarHBondContact O-N 3.34Å; I12-N16 WeakPolarHBondContact O-CB 3.48Å; I12-N16 PolarHBondContact O-N 3.34Å
13	T	83.4	Confident	81.7	Confident	92 Å²	92	109.8 Å²	109.8	56%	0.564	53%	0.528	S	S	*	.	H	α-helix	trans	-64.2	-40.8	177.9	-57.7	0	0	0	0	111.9	K9 F10 W11 N16 K17	K9-T13 PolarHBondContact O-N 3.49Å; K9-T13 PolarHBondContact O-OG1 3.44Å; F10-T13 PolarHBondContact O-N 3.05Å; W11-T13 PolarHBondContact O-N 3.34Å; T13-N16 PolarHBondContact O-N 3.24Å; T13-K17 WeakPolarHBondContact O-CB 3.39Å; T13-K17 PolarHBondContact O-N 2.99Å
14	A	79.1	Confident	81.6	Confident	22 Å²	22	109.3 Å²	109.3	18%	0.182	52%	0.521	C	S	.	.	H	α-helix	trans	-64.6	-41.9	177.4	0	0	0	0	0	111.9	F10 W11 I12 K17 Y18	F10-A14 WeakPolarHBondContact O-CB 3.45Å; F10-A14 PolarHBondContact O-N 3.01Å; W11-A14 PolarHBondContact O-N 3.29Å; I12-A14 PolarHBondContact O-N 3.22Å; A14-K17 PolarHBondContact O-N 2.87Å; A14-Y18 PolarHBondContact O-N 3.21Å
15	L	79.7	Confident	81.6	Confident	76 Å²	76	104.1 Å²	104.1	40%	0.398	50%	0.504	S	S	.	.	H	α-helix	trans	-65.1	-42.9	177.6	-137.2	77.2	0	0	0	111.9	W11 I12 K17 Y18 P19 V22	W11-L15 WeakPolarHBondContact O-CB 3.4Å; W11-L15 PolarHBondContact O-N 3.02Å; I12-L15 PolarHBondContact O-N 3.34Å; L15-K17 VanDerWaalsContact C-N 3.32Å; L15-K17 PolarHBondContact O-N 3.31Å; L15-Y18 CarbonylContact O-C 3.25Å; L15-Y18 VanDerWaalsContact O-C 3.25Å; L15-Y18 PolarHBondContact O-N 2.96Å; L15-P19 WeakPolarHBondContact O-CA 3.34Å; L15-V22 HydrophobicContact CD1-CG2 3.51Å; L15-V22 HydrophobicContact CD2-CG2 3.86Å; L15-V22 HydrophobicContact CG-CG2 3.63Å
16	N	81.7	Confident	81.6	Confident	131 Å²	131	103.6 Å²	103.6	70%	0.701	51%	0.505	S	S	*	.	H	α-helix	trans	-65.9	-36.4	178.1	-77.5	-14.2	0	0	0	112	I12 T13	I12-N16 WeakPolarHBondContact O-CB 3.48Å; I12-N16 PolarHBondContact O-N 3.34Å; T13-N16 PolarHBondContact O-N 3.24Å
17	K	83.9	Confident	81.7	Confident	144 Å²	144	103.3 Å²	103.3	63%	0.626	51%	0.508	S	S	*	.	H	α-helix	trans	-77.5	-32.1	179	-168	173.4	178.9	-177.6	0	112.5	T13 A14 L15	T13-K17 WeakPolarHBondContact O-CB 3.39Å; T13-K17 PolarHBondContact O-N 2.99Å; A14-K17 PolarHBondContact O-N 2.87Å; L15-K17 VanDerWaalsContact C-N 3.32Å; L15-K17 PolarHBondContact O-N 3.31Å
18	Y	81.8	Confident	82	Confident	117 Å²	117	100.1 Å²	100.1	46%	0.459	50%	0.5	S	S	.	.			trans	-136.7	83	-177.9	-56.4	-78.6	0	0	0	110.8	A14 L15 H20 F21	A14-Y18 PolarHBondContact O-N 3.21Å; L15-Y18 CarbonylContact O-C 3.25Å; L15-Y18 VanDerWaalsContact O-C 3.25Å; L15-Y18 PolarHBondContact O-N 2.96Å; Y18-H20 PolarHBondContact O-N 3.29Å; Y18-F21 HydrophobicContact CD2-CD2 4.44Å; Y18-F21 HydrophobicContact CD2-CE2 4.2Å; Y18-F21 HydrophobicContact CG-CD2 4.03Å; Y18-F21 AromaticContact CG-CE2 4Å; Y18-F21 HydrophobicContact CG-CE2 4Å; Y18-F21 WeakPolarHBondContact O-CB 3.43Å; Y18-F21 PolarHBondContact O-N 3.23Å
19	P	78.2	Confident	82.2	Confident	79 Å²	79	97.8 Å²	97.8	51%	0.513	50%	0.497	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59	-26.4	-178.4	22.7	-33.6	0	0	0	112.6	L15 F21 V22	L15-P19 WeakPolarHBondContact O-CA 3.34Å; P19-F21 VanDerWaalsContact C-N 3.25Å; P19-F21 PolarHBondContact O-N 2.87Å; P19-V22 WeakPolarHBondContact O-CG2 3.41Å; P19-V22 PolarHBondContact O-N 2.91Å
20	H	81.5	Confident	82.5	Confident	133 Å²	133	95.7 Å²	95.7	62%	0.616	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.3	-17.7	177.5	-58.8	-68.1	0	0	0	114.6	Y18 V22 Y23 I24	Y18-H20 PolarHBondContact O-N 3.29Å; H20-V22 PolarHBondContact O-N 3.17Å; H20-Y23 PolarHBondContact O-N 3.03Å; H20-I24 PolarHBondContact O-N 2.99Å
21	F	78.6	Confident	82.8	Confident	86 Å²	86	92.8 Å²	92.8	38%	0.377	49%	0.491	S	S	.	.	H	α-helix	trans	-60.2	-28.5	175.5	-97.2	-107.2	0	0	0	112.3	Y18 P19 Y23 I24 V25	Y18-F21 HydrophobicContact CD2-CD2 4.44Å; Y18-F21 HydrophobicContact CD2-CE2 4.2Å; Y18-F21 HydrophobicContact CG-CD2 4.03Å; Y18-F21 AromaticContact CG-CE2 4Å; Y18-F21 HydrophobicContact CG-CE2 4Å; Y18-F21 WeakPolarHBondContact O-CB 3.43Å; Y18-F21 PolarHBondContact O-N 3.23Å; P19-F21 VanDerWaalsContact C-N 3.25Å; P19-F21 PolarHBondContact O-N 2.87Å; F21-Y23 PolarHBondContact O-N 2.96Å; F21-Y23 VanDerWaalsContact O-N 3.17Å; F21-I24 PolarHBondContact O-N 3.05Å; F21-V25 HydrophobicContact CB-CG2 4.5Å; F21-V25 HydrophobicContact CD1-CG2 3.89Å; F21-V25 WeakPolarHBondContact O-CB 3.46Å; F21-V25 VanDerWaalsContact O-CG2 3.28Å; F21-V25 WeakPolarHBondContact O-CG2 3.37Å; F21-V25 PolarHBondContact O-N 3.44Å
22	V	77.5	Confident	83.3	Confident	70 Å²	70	91.2 Å²	91.2	42%	0.424	49%	0.494	S	S	.	.	H	α-helix	trans	-55.9	-31.9	175.3	-178.5	0	0	0	0	111.5	L15 P19 H20 P26	L15-V22 HydrophobicContact CD1-CG2 3.51Å; L15-V22 HydrophobicContact CD2-CG2 3.86Å; L15-V22 HydrophobicContact CG-CG2 3.63Å; P19-V22 WeakPolarHBondContact O-CG2 3.41Å; P19-V22 PolarHBondContact O-N 2.91Å; H20-V22 PolarHBondContact O-N 3.17Å; V22-P26 WeakPolarHBondContact O-CD 3.39Å; V22-P26 WeakPolarHBondContact O-CG 3.5Å
23	Y	79.2	Confident	83.7	Confident	159 Å²	159	94.2 Å²	94.2	62%	0.624	50%	0.5	S	S	*	.	H	α-helix	trans	-91.3	-38.6	179.5	-56.4	-71	0	0	0	112.5	H20 F21 L27	H20-Y23 PolarHBondContact O-N 3.03Å; F21-Y23 PolarHBondContact O-N 2.96Å; F21-Y23 VanDerWaalsContact O-N 3.17Å; Y23-L27 WeakPolarHBondContact O-CD1 2.95Å; Y23-L27 WeakPolarHBondContact O-CG 3.18Å; Y23-L27 PolarHBondContact O-N 3.21Å
24	I	82.4	Confident	84	Confident	103 Å²	103	93.6 Å²	93.6	53%	0.528	50%	0.496	S	S	.	.	H	α-helix	trans	-69.9	-39.4	-176.4	-61.2	170.5	0	0	0	111.1	H20 F21 L27 G28	H20-I24 PolarHBondContact O-N 2.99Å; F21-I24 PolarHBondContact O-N 3.05Å; I24-L27 PolarHBondContact O-N 2.96Å; I24-G28 PolarHBondContact O-N 2.89Å
25	V	82	Confident	84.3	Confident	62 Å²	62	96.2 Å²	96.2	38%	0.376	51%	0.513	S	S	.	.	H	α-helix	trans	-65.2	-48.8	-175.2	171.8	0	0	0	0	112.1	W11 F21 L27 G28 S29	W11-V25 HydrophobicContact CZ3-CG2 4.36Å; F21-V25 HydrophobicContact CB-CG2 4.5Å; F21-V25 HydrophobicContact CD1-CG2 3.89Å; F21-V25 WeakPolarHBondContact O-CB 3.46Å; F21-V25 VanDerWaalsContact O-CG2 3.28Å; F21-V25 WeakPolarHBondContact O-CG2 3.37Å; F21-V25 PolarHBondContact O-N 3.44Å; V25-L27 PolarHBondContact O-N 3.46Å; V25-G28 PolarHBondContact O-N 3.34Å; V25-S29 WeakPolarHBondContact O-CB 3.28Å; V25-S29 PolarHBondContact O-N 3.4Å; V25-S29 PolarHBondContact O-OG 2.81Å
26	P	84.7	Confident	84.6	Confident	68 Å²	68	96.9 Å²	96.9	44%	0.442	52%	0.516	S	S	.	.	H	α-helix	trans	-58.8	-47.8	173.9	-25.8	35.2	0	0	0	112.4	V22 G28 S29 V30	V22-P26 WeakPolarHBondContact O-CD 3.39Å; V22-P26 WeakPolarHBondContact O-CG 3.5Å; P26-G28 PolarHBondContact O-N 3.47Å; P26-S29 WeakPolarHBondContact CA-OG 3.4Å; P26-S29 PolarHBondContact O-N 3.5Å; P26-S29 PolarHBondContact O-OG 3.32Å; P26-V30 WeakPolarHBondContact O-CG2 3.36Å; P26-V30 PolarHBondContact O-N 3Å
27	L	86.9	Confident	84.8	Confident	118 Å²	118	93.2 Å²	93.2	62%	0.618	50%	0.499	S	S	*	.	H	α-helix	trans	-59	-46.4	178.9	-73.9	171.3	0	0	0	111.8	Y23 I24 V25 S29 V30 C31	Y23-L27 WeakPolarHBondContact O-CD1 2.95Å; Y23-L27 WeakPolarHBondContact O-CG 3.18Å; Y23-L27 PolarHBondContact O-N 3.21Å; I24-L27 PolarHBondContact O-N 2.96Å; V25-L27 PolarHBondContact O-N 3.46Å; L27-S29 PolarHBondContact O-N 3.41Å; L27-V30 PolarHBondContact O-N 3.43Å; L27-C31 PolarHBondContact O-N 3.45Å; L27-C31 PolarHBondContact O-SG 2.7Å; L27-C31 VanDerWaalsContact O-SG 3.32Å
28	G	86.7	Confident	84.7	Confident	34 Å²	34	93.1 Å²	93.1	35%	0.351	50%	0.498	S	S	.	.	H	α-helix	trans	-61	-43.3	176	0	0	0	0	0	112.2	I24 V25 P26 V30 C31 V32	I24-G28 PolarHBondContact O-N 2.89Å; V25-G28 PolarHBondContact O-N 3.34Å; P26-G28 PolarHBondContact O-N 3.47Å; G28-V30 PolarHBondContact O-N 2.98Å; G28-C31 PolarHBondContact O-N 3.18Å; G28-V32 VanDerWaalsContact O-CG2 3.31Å; G28-V32 WeakPolarHBondContact O-CG2 3.3Å; G28-V32 PolarHBondContact O-N 3.5Å
29	S	88.7	Confident	84.7	Confident	71 Å²	71	91.9 Å²	91.9	50%	0.497	50%	0.497	S	S	.	.	H	α-helix	trans	-62.8	-40.8	178.4	74.7	0	0	0	0	112.4	V25 P26 L27 Y33	V25-S29 WeakPolarHBondContact O-CB 3.28Å; V25-S29 PolarHBondContact O-N 3.4Å; V25-S29 PolarHBondContact O-OG 2.81Å; P26-S29 WeakPolarHBondContact CA-OG 3.4Å; P26-S29 PolarHBondContact O-N 3.5Å; P26-S29 PolarHBondContact O-OG 3.32Å; L27-S29 PolarHBondContact O-N 3.41Å; S29-Y33 VanDerWaalsContact O-CB 3.29Å; S29-Y33 WeakPolarHBondContact O-CB 3.41Å; S29-Y33 PolarHBondContact O-N 3.43Å
30	V	90	Very high	84.7	Confident	86 Å²	86	92.9 Å²	92.9	52%	0.521	50%	0.497	S	S	.	.	H	α-helix	trans	-66	-46.1	176.7	172.3	0	0	0	0	110.4	P26 L27 G28 V32 Y33 V34	P26-V30 WeakPolarHBondContact O-CG2 3.36Å; P26-V30 PolarHBondContact O-N 3Å; L27-V30 PolarHBondContact O-N 3.43Å; G28-V30 PolarHBondContact O-N 2.98Å; V30-V32 PolarHBondContact O-N 2.89Å; V30-Y33 PolarHBondContact O-N 2.87Å; V30-V34 HydrophobicContact CG1-CG2 4.4Å; V30-V34 VanDerWaalsContact O-CG2 3.32Å; V30-V34 WeakPolarHBondContact O-CG2 3.31Å; V30-V34 PolarHBondContact O-N 3.43Å
31	C	90.2	Very high	84.5	Confident	80 Å²	80	95.2 Å²	95.2	54%	0.541	50%	0.501	S	S	.	.	H	α-helix	trans	-59.9	-44.2	177.8	-72.1	0	0	0	0	112.4	L27 G28 V34 S35	L27-C31 PolarHBondContact O-N 3.45Å; L27-C31 PolarHBondContact O-SG 2.7Å; L27-C31 VanDerWaalsContact O-SG 3.32Å; G28-C31 PolarHBondContact O-N 3.18Å; C31-V34 PolarHBondContact O-N 3.35Å; C31-S35 WeakPolarHBondContact O-CB 3.31Å; C31-S35 PolarHBondContact O-N 2.81Å; C31-S35 PolarHBondContact O-OG 3.47Å
32	V	90.9	Very high	84.1	Confident	85 Å²	85	94.7 Å²	94.7	52%	0.515	50%	0.501	S	S	.	.	H	α-helix	trans	-65.3	-44.3	177.2	171.9	0	0	0	0	110.5	G28 V30 V34 S35 I36	G28-V32 VanDerWaalsContact O-CG2 3.31Å; G28-V32 WeakPolarHBondContact O-CG2 3.3Å; G28-V32 PolarHBondContact O-N 3.5Å; V30-V32 PolarHBondContact O-N 2.89Å; V32-V34 PolarHBondContact O-N 2.77Å; V32-S35 PolarHBondContact O-N 3.38Å; V32-I36 HydrophobicContact CG1-CD1 3.61Å; V32-I36 HydrophobicContact CG1-CG1 4.27Å; V32-I36 VanDerWaalsContact O-CG1 3.3Å; V32-I36 WeakPolarHBondContact O-CG1 3.38Å; V32-I36 PolarHBondContact O-N 3.45Å
33	Y	91.3	Very high	83.7	Confident	162 Å²	162	99.8 Å²	99.8	64%	0.635	51%	0.513	S	S	*	.	H	α-helix	trans	-59.9	-45.8	177	-179.5	-99.2	0	0	0	112.3	S29 V30 S35 I36 T37	S29-Y33 VanDerWaalsContact O-CB 3.29Å; S29-Y33 WeakPolarHBondContact O-CB 3.41Å; S29-Y33 PolarHBondContact O-N 3.43Å; V30-Y33 PolarHBondContact O-N 2.87Å; Y33-S35 VanDerWaalsContact C-N 3.31Å; Y33-S35 PolarHBondContact O-N 2.92Å; Y33-I36 PolarHBondContact O-N 3.26Å; Y33-T37 HydrophobicContact CD1-CG2 4.18Å; Y33-T37 HydrophobicContact CD2-CG2 4.33Å; Y33-T37 HydrophobicContact CE1-CG2 3.77Å; Y33-T37 HydrophobicContact CE2-CG2 3.93Å; Y33-T37 HydrophobicContact CG-CG2 4.44Å; Y33-T37 WeakPolarHBondContact O-CB 3.29Å; Y33-T37 VanDerWaalsContact O-CG2 3.3Å; Y33-T37 WeakPolarHBondContact O-CG2 3.33Å; Y33-T37 PolarHBondContact O-N 2.97Å; Y33-T37 PolarHBondContact O-OG1 3.2Å
34	V	88.9	Confident	83.3	Confident	80 Å²	80	96.4 Å²	96.4	49%	0.485	52%	0.518	S	S	.	.	H	α-helix	trans	-62.2	-40.3	176	171.9	0	0	0	0	111.2	V30 C31 V32 T37 K38	V30-V34 HydrophobicContact CG1-CG2 4.4Å; V30-V34 VanDerWaalsContact O-CG2 3.32Å; V30-V34 WeakPolarHBondContact O-CG2 3.31Å; V30-V34 PolarHBondContact O-N 3.43Å; C31-V34 PolarHBondContact O-N 3.35Å; V32-V34 PolarHBondContact O-N 2.77Å; V34-T37 VanDerWaalsContact CA-OG1 3.31Å; V34-T37 WeakPolarHBondContact CA-OG1 3.42Å; V34-T37 PolarHBondContact O-OG1 2.87Å; V34-K38 WeakPolarHBondContact O-CB 3.25Å; V34-K38 PolarHBondContact O-N 2.92Å
35	S	86.9	Confident	82.5	Confident	76 Å²	76	95 Å²	95	53%	0.531	51%	0.511	S	S	.	.	H	α-helix	trans	-66.3	-44.1	178.7	-59.2	0	0	0	0	111.9	C31 V32 Y33 H39	C31-S35 WeakPolarHBondContact O-CB 3.31Å; C31-S35 PolarHBondContact O-N 2.81Å; C31-S35 PolarHBondContact O-OG 3.47Å; V32-S35 PolarHBondContact O-N 3.38Å; Y33-S35 VanDerWaalsContact C-N 3.31Å; Y33-S35 PolarHBondContact O-N 2.92Å; S35-H39 VanDerWaalsContact O-CB 3.28Å; S35-H39 WeakPolarHBondContact O-CB 3.32Å; S35-H39 PolarHBondContact O-N 2.98Å
36	I	85.6	Confident	81.5	Confident	91 Å²	91	93 Å²	93	47%	0.467	50%	0.503	S	S	.	.	H	α-helix	trans	-65.6	-47.9	177.3	-68.4	170	0	0	0	110.5	V32 Y33 K38 H39 L40	V32-I36 HydrophobicContact CG1-CD1 3.61Å; V32-I36 HydrophobicContact CG1-CG1 4.27Å; V32-I36 VanDerWaalsContact O-CG1 3.3Å; V32-I36 WeakPolarHBondContact O-CG1 3.38Å; V32-I36 PolarHBondContact O-N 3.45Å; Y33-I36 PolarHBondContact O-N 3.26Å; I36-K38 VanDerWaalsContact C-N 3.35Å; I36-K38 PolarHBondContact O-N 3.21Å; I36-H39 PolarHBondContact O-N 2.93Å; I36-L40 HydrophobicContact CG2-CD1 3.79Å; I36-L40 HydrophobicContact CG2-CG 4.19Å; I36-L40 WeakPolarHBondContact O-CB 3.28Å; I36-L40 WeakPolarHBondContact O-CG 3.21Å; I36-L40 PolarHBondContact O-N 3.49Å
37	T	86	Confident	80.3	Confident	54 Å²	54	94.3 Å²	94.3	33%	0.331	51%	0.512	S	S	.	.	H	α-helix	trans	-62.6	-41.6	179.7	49.5	0	0	0	0	111.7	Y33 V34 L40 R41	Y33-T37 HydrophobicContact CD1-CG2 4.18Å; Y33-T37 HydrophobicContact CD2-CG2 4.33Å; Y33-T37 HydrophobicContact CE1-CG2 3.77Å; Y33-T37 HydrophobicContact CE2-CG2 3.93Å; Y33-T37 HydrophobicContact CG-CG2 4.44Å; Y33-T37 WeakPolarHBondContact O-CB 3.29Å; Y33-T37 VanDerWaalsContact O-CG2 3.3Å; Y33-T37 WeakPolarHBondContact O-CG2 3.33Å; Y33-T37 PolarHBondContact O-N 2.97Å; Y33-T37 PolarHBondContact O-OG1 3.2Å; V34-T37 VanDerWaalsContact CA-OG1 3.31Å; V34-T37 WeakPolarHBondContact CA-OG1 3.42Å; V34-T37 PolarHBondContact O-OG1 2.87Å; T37-L40 PolarHBondContact O-N 2.87Å; T37-R41 VanDerWaalsContact O-CB 3.25Å; T37-R41 WeakPolarHBondContact O-CB 3.34Å; T37-R41 PolarHBondContact O-N 2.81Å
38	K	81.3	Confident	78.8	Confident	141 Å²	141	96.9 Å²	96.9	61%	0.613	52%	0.521	S	S	*	.	H	α-helix	trans	-61.3	-45.6	172.7	-175.8	177	179.6	178.3	0	111.6	V34 I36 R41 L42	V34-K38 WeakPolarHBondContact O-CB 3.25Å; V34-K38 PolarHBondContact O-N 2.92Å; I36-K38 VanDerWaalsContact C-N 3.35Å; I36-K38 PolarHBondContact O-N 3.21Å; K38-R41 PolarHBondContact O-N 2.82Å; K38-L42 HydrophobicContact CG-CD1 4.17Å; K38-L42 WeakPolarHBondContact O-CB 3.07Å; K38-L42 VanDerWaalsContact O-CG 3.3Å; K38-L42 WeakPolarHBondContact O-CG 3.3Å; K38-L42 PolarHBondContact O-N 3.17Å
39	H	81.6	Confident	77.5	Confident	92 Å²	92	100 Å²	100	43%	0.426	53%	0.526	S	S	.	.	H	α-helix	trans	-64	-43.6	179.1	-174.9	66.8	0	0	0	112.6	S35 I36 L42 R43	S35-H39 VanDerWaalsContact O-CB 3.28Å; S35-H39 WeakPolarHBondContact O-CB 3.32Å; S35-H39 PolarHBondContact O-N 2.98Å; I36-H39 PolarHBondContact O-N 2.93Å; H39-L42 PolarHBondContact O-N 3.26Å; H39-R43 VanDerWaalsContact NE2-CZ 3.34Å; H39-R43 PolarHBondContact NE2-NE 3.4Å; H39-R43 WeakPolarHBondContact O-CG 3.24Å; H39-R43 PolarHBondContact O-N 2.88Å
40	L	78	Confident	75.8	Confident	100 Å²	100	98.5 Å²	98.5	52%	0.524	52%	0.518	S	S	.	.	H	α-helix	trans	-65.8	-40.2	175.8	-71	176.8	0	0	0	111.5	I36 T37 R43 A44	I36-L40 HydrophobicContact CG2-CD1 3.79Å; I36-L40 HydrophobicContact CG2-CG 4.19Å; I36-L40 WeakPolarHBondContact O-CB 3.28Å; I36-L40 WeakPolarHBondContact O-CG 3.21Å; I36-L40 PolarHBondContact O-N 3.49Å; T37-L40 PolarHBondContact O-N 2.87Å; L40-R43 PolarHBondContact O-N 3.21Å; L40-A44 WeakPolarHBondContact O-CB 3.36Å; L40-A44 PolarHBondContact O-N 2.89Å
41	R	78.3	Confident	74.2	Confident	182 Å²	182	100.9 Å²	100.9	69%	0.687	52%	0.519	S	S	*	.	H	α-helix	trans	-61.5	-46.5	174.1	-173	175.3	179.3	173.9	-0.8	111.1	T37 K38 R43 A44 L45	T37-R41 VanDerWaalsContact O-CB 3.25Å; T37-R41 WeakPolarHBondContact O-CB 3.34Å; T37-R41 PolarHBondContact O-N 2.81Å; K38-R41 PolarHBondContact O-N 2.82Å; R41-R43 VanDerWaalsContact C-N 3.3Å; R41-R43 PolarHBondContact O-N 3.38Å; R41-A44 PolarHBondContact O-N 3.36Å; R41-L45 HydrophobicContact CG-CD1 3.9Å; R41-L45 HydrophobicContact CG-CG 4.35Å; R41-L45 WeakPolarHBondContact O-CB 3.2Å; R41-L45 WeakPolarHBondContact O-CG 3.41Å; R41-L45 PolarHBondContact O-N 3.22Å
42	L	68.7	Low	72.6	Confident	74 Å²	74	100.1 Å²	100.1	39%	0.387	51%	0.506	S	S	.	.	H	α-helix	trans	-62	-35.6	175.6	-72.5	170.6	0	0	0	112.8	K38 H39 A50	K38-L42 HydrophobicContact CG-CD1 4.17Å; K38-L42 WeakPolarHBondContact O-CB 3.07Å; K38-L42 VanDerWaalsContact O-CG 3.3Å; K38-L42 WeakPolarHBondContact O-CG 3.3Å; K38-L42 PolarHBondContact O-N 3.17Å; H39-L42 PolarHBondContact O-N 3.26Å; L42-A50 HydrophobicContact CD2-CB 4.33Å
43	R	69.8	Low	70.7	Confident	177 Å²	177	101.3 Å²	101.3	67%	0.668	50%	0.502	S	S	*	.	H	α-helix	trans	-69.4	-40.2	172.8	-79	-173.1	168.2	177.9	-0.9	112.6	H39 L40 R41 G46	H39-R43 VanDerWaalsContact NE2-CZ 3.34Å; H39-R43 PolarHBondContact NE2-NE 3.4Å; H39-R43 WeakPolarHBondContact O-CG 3.24Å; H39-R43 PolarHBondContact O-N 2.88Å; L40-R43 PolarHBondContact O-N 3.21Å; R41-R43 VanDerWaalsContact C-N 3.3Å; R41-R43 PolarHBondContact O-N 3.38Å; R43-G46 PolarHBondContact O-N 2.93Å
44	A	71.2	Confident	68.6	Low	89 Å²	89	100 Å²	100	74%	0.736	50%	0.5	S	S	*	.	H	α-helix	trans	-69.2	-36	179.6	0	0	0	0	0	112.4	L40 R41 G46	L40-A44 WeakPolarHBondContact O-CB 3.36Å; L40-A44 PolarHBondContact O-N 2.89Å; R41-A44 PolarHBondContact O-N 3.36Å; A44-G46 PolarHBondContact O-N 3.2Å
45	L	65.2	Low	66.6	Low	73 Å²	73	104.3 Å²	104.3	38%	0.382	51%	0.512	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68.4	-7.8	173.2	-68.7	169.6	0	0	0	113	R41 E49	R41-L45 HydrophobicContact CG-CD1 3.9Å; R41-L45 HydrophobicContact CG-CG 4.35Å; R41-L45 WeakPolarHBondContact O-CB 3.2Å; R41-L45 WeakPolarHBondContact O-CG 3.41Å; R41-L45 PolarHBondContact O-N 3.22Å; L45-E49 HydrophobicContact CB-CB 4.01Å; L45-E49 WeakPolarHBondContact CB-OE2 3.48Å; L45-E49 VanDerWaalsContact CD1-OE2 3.24Å; L45-E49 WeakPolarHBondContact CD1-OE2 3.3Å; L45-E49 WeakPolarHBondContact CD2-OE2 3.49Å; L45-E49 WeakPolarHBondContact CG-OE2 3.47Å
46	G	60	Low	64.9	Low	21 Å²	21	102.9 Å²	102.9	22%	0.216	50%	0.497	C	S	.	.	H	α-helix	trans	72.9	168.5	179.8	0	0	0	0	0	113.3	R43 A44 E48 A50	R43-G46 PolarHBondContact O-N 2.93Å; A44-G46 PolarHBondContact O-N 3.2Å; G46-E48 PolarHBondContact O-N 3.3Å; G46-A50 PolarHBondContact O-N 3.24Å
47	P	59.4	Low	63.1	Low	95 Å²	95	108.2 Å²	108.2	62%	0.617	51%	0.513	S	S	*	.	H	α-helix	trans	-62.3	-24.7	178	26.3	-33.9	0	0	0	112.5	Y51	P47-Y51 HydrophobicContact CB-CD2 4.12Å; P47-Y51 HydrophobicContact CB-CE2 4.43Å; P47-Y51 WeakPolarHBondContact O-CB 3.43Å; P47-Y51 VanDerWaalsContact O-CD2 3.28Å; P47-Y51 WeakPolarHBondContact O-CD2 3.08Å; P47-Y51 PolarHBondContact O-N 3.17Å
48	E	57.2	Low	61.5	Low	172 Å²	172	111.1 Å²	111.1	80%	0.804	53%	0.531	S	S	*	.	H	α-helix	trans	-64.5	-46.4	-177.1	-65.8	-161.1	165.5	0	0	112.5	G46 K52	G46-E48 PolarHBondContact O-N 3.3Å; E48-K52 WeakPolarHBondContact O-CA 3.28Å; E48-K52 VanDerWaalsContact O-CB 3.29Å; E48-K52 WeakPolarHBondContact O-CB 3.28Å; E48-K52 PolarHBondContact O-N 3.13Å
49	E	58.2	Low	59.9	Low	99 Å²	99	108.4 Å²	108.4	46%	0.463	53%	0.526	S	S	.	.	H	α-helix	trans	-78.3	-41.3	174.7	-92.2	-162.8	173.6	0	0	113	L45 Y51 K52	L45-E49 HydrophobicContact CB-CB 4.01Å; L45-E49 WeakPolarHBondContact CB-OE2 3.48Å; L45-E49 VanDerWaalsContact CD1-OE2 3.24Å; L45-E49 WeakPolarHBondContact CD1-OE2 3.3Å; L45-E49 WeakPolarHBondContact CD2-OE2 3.49Å; L45-E49 WeakPolarHBondContact CG-OE2 3.47Å; E49-Y51 PolarHBondContact O-N 3.33Å; E49-Y51 VanDerWaalsContact O-N 3.13Å; E49-K52 PolarHBondContact O-N 2.93Å
50	A	53.8	Low	58.4	Low	40 Å²	40	110.3 Å²	110.3	33%	0.331	53%	0.533	S	S	.	.	H	α-helix	trans	-59.8	-28.2	-178.7	0	0	0	0	0	112.5	L42 G46	L42-A50 HydrophobicContact CD2-CB 4.33Å; G46-A50 PolarHBondContact O-N 3.24Å
51	Y	56.3	Low	57.5	Low	136 Å²	136	114.3 Å²	114.3	53%	0.533	54%	0.541	S	S	.	.	H	α-helix	trans	-111.9	0.9	176.5	-63	-78.1	0	0	0	114.7	P47 E49 Y53 K54 K55	P47-Y51 HydrophobicContact CB-CD2 4.12Å; P47-Y51 HydrophobicContact CB-CE2 4.43Å; P47-Y51 WeakPolarHBondContact O-CB 3.43Å; P47-Y51 VanDerWaalsContact O-CD2 3.28Å; P47-Y51 WeakPolarHBondContact O-CD2 3.08Å; P47-Y51 PolarHBondContact O-N 3.17Å; E49-Y51 PolarHBondContact O-N 3.33Å; E49-Y51 VanDerWaalsContact O-N 3.13Å; Y51-Y53 PolarHBondContact O-N 3.12Å; Y51-Y53 VanDerWaalsContact O-N 3.15Å; Y51-K54 HydrophobicContact CD1-CB 4.02Å; Y51-K54 HydrophobicContact CD1-CD 3.84Å; Y51-K54 HydrophobicContact CE1-CD 4.12Å; Y51-K54 PolarHBondContact O-N 3.06Å; Y51-K55 PolarHBondContact O-N 3.45Å
52	K	55.9	Low	56.6	Low	63 Å²	63	109.2 Å²	109.2	27%	0.274	54%	0.538	S	S	.	.	H	α-helix	trans	-50.6	-41.7	174.6	-163.2	173	177.6	-177.1	0	110.5	E48 E49 M56 D70 N71	E48-K52 WeakPolarHBondContact O-CA 3.28Å; E48-K52 VanDerWaalsContact O-CB 3.29Å; E48-K52 WeakPolarHBondContact O-CB 3.28Å; E48-K52 PolarHBondContact O-N 3.13Å; E49-K52 PolarHBondContact O-N 2.93Å; K52-M56 HydrophobicContact CG-CE 4.39Å; K52-M56 PolarHBondContact O-N 2.92Å; K52-D70 PolarHBondContact NZ-O 3.27Å; K52-N71 WeakPolarHBondContact CE-OD1 3.42Å
53	Y	50.4	Low	56.3	Low	110 Å²	110	113.7 Å²	113.7	43%	0.431	56%	0.557	S	S	.	*	H	α-helix	trans	-78.4	-32.6	177.4	-58.9	-84	0	0	0	114.7	Y51 K55 M56 Y57 L74	Y51-Y53 PolarHBondContact O-N 3.12Å; Y51-Y53 VanDerWaalsContact O-N 3.15Å; Y53-K55 PolarHBondContact O-N 3.09Å; Y53-M56 HydrophobicContact CD1-CE 3.42Å; Y53-M56 VanDerWaalsContact CD1-CE 3.42Å; Y53-M56 HydrophobicContact CE1-CE 3.69Å; Y53-M56 HydrophobicContact CG-CE 4.1Å; Y53-M56 PolarHBondContact O-N 2.96Å; Y53-M56 VanDerWaalsContact O-N 3.1Å; Y53-Y57 WeakPolarHBondContact O-CD2 3.39Å; Y53-Y57 PolarHBondContact O-N 3.21Å; Y53-L74 HydrophobicContact CE1-CD2 3.65Å; Y53-L74 WeakPolarHBondContact OH-CD2 3.16Å
54	K	48.8	Very low	55.9	Low	136 Å²	136	108.9 Å²	108.9	59%	0.591	54%	0.544	S	S	*	.	H	α-helix	trans	-66.7	-30.2	175.9	-153.2	-177.5	-175.5	-170.6	0	110.9	Y51 V58	Y51-K54 HydrophobicContact CD1-CB 4.02Å; Y51-K54 HydrophobicContact CD1-CD 3.84Å; Y51-K54 HydrophobicContact CE1-CD 4.12Å; Y51-K54 PolarHBondContact O-N 3.06Å; K54-V58 WeakPolarHBondContact O-CG2 3.29Å; K54-V58 PolarHBondContact O-N 3.43Å
55	K	46.8	Very low	55.3	Low	169 Å²	169	106.5 Å²	106.5	74%	0.735	52%	0.52	S	S	*	.	H	α-helix	trans	-68.4	-41.2	168.1	-76.7	-172.8	177.2	179.1	0	112.4	Y51 Y53 V58 V59	Y51-K55 PolarHBondContact O-N 3.45Å; Y53-K55 PolarHBondContact O-N 3.09Å; K55-V58 PolarHBondContact O-N 3.09Å; K55-V59 PolarHBondContact O-N 3.05Å
56	M	50.1	Low	55.2	Low	47 Å²	47	111 Å²	111	23%	0.232	54%	0.539	C	S	.	.	H	α-helix	trans	-65.4	-40	177.6	-76	-168.1	-87.2	0	0	113.7	K52 Y53 V58 V59 L74	K52-M56 HydrophobicContact CG-CE 4.39Å; K52-M56 PolarHBondContact O-N 2.92Å; Y53-M56 HydrophobicContact CD1-CE 3.42Å; Y53-M56 VanDerWaalsContact CD1-CE 3.42Å; Y53-M56 HydrophobicContact CE1-CE 3.69Å; Y53-M56 HydrophobicContact CG-CE 4.1Å; Y53-M56 PolarHBondContact O-N 2.96Å; Y53-M56 VanDerWaalsContact O-N 3.1Å; M56-V58 PolarHBondContact O-N 3.04Å; M56-V59 CarbonylContact O-C 3.48Å; M56-V59 PolarHBondContact O-N 3Å; M56-V59 VanDerWaalsContact O-O 3.12Å; M56-L74 HydrophobicContact CE-CD1 3.41Å; M56-L74 VanDerWaalsContact CE-CD1 3.41Å; M56-L74 HydrophobicContact SD-CD1 3.87Å
57	Y	48.4	Very low	55.4	Low	203 Å²	203	115.9 Å²	115.9	80%	0.796	56%	0.56	S	S	*	*	H	α-helix	trans	-76.1	-20	178.9	-71.1	-69.5	0	0	0	114.2	Y53	Y53-Y57 WeakPolarHBondContact O-CD2 3.39Å; Y53-Y57 PolarHBondContact O-N 3.21Å
58	V	52.7	Low	55.9	Low	115 Å²	115	114.2 Å²	114.2	70%	0.697	55%	0.548	S	S	*	.	H	α-helix	trans	-81.7	-26.4	175.7	175.3	0	0	0	0	111	K54 K55 M56	K54-V58 WeakPolarHBondContact O-CG2 3.29Å; K54-V58 PolarHBondContact O-N 3.43Å; K55-V58 PolarHBondContact O-N 3.09Å; M56-V58 PolarHBondContact O-N 3.04Å
59	V	47.7	Very low	56.7	Low	84 Å²	84	115.1 Å²	115.1	51%	0.509	55%	0.552	S	S	.	*	S	Bend	trans	-140.5	109	-174.1	-174.2	0	0	0	0	109.8	K55 M56	K55-V59 PolarHBondContact O-N 3.05Å; M56-V59 CarbonylContact O-C 3.48Å; M56-V59 PolarHBondContact O-N 3Å; M56-V59 VanDerWaalsContact O-O 3.12Å
60	K	50	Low	57.1	Low	132 Å²	132	116 Å²	116	57%	0.574	56%	0.56	S	S	*	*			trans	104.9	128.3	151.7	-76.6	167.4	169.3	-156.3	0	118.5	D64 V65	K60-D64 HydrophobicContact CB-CB 3.75Å; K60-D64 HydrophobicContact CD-CB 3.51Å; K60-D64 HydrophobicContact CG-CB 3.52Å; K60-V65 HydrophobicContact CB-CG2 4.23Å
61	R	57.5	Low	57.6	Low	184 Å²	184	115.7 Å²	115.7	69%	0.694	55%	0.553	S	S	*	*			trans	-54.4	152.2	164.2	-73.2	178.1	-81.1	-161.2	-4	108.1	E63 D64	R61-E63 PolarHBondContact O-N 3.15Å; R61-D64 PolarHBondContact O-N 3.09Å
62	A	59.9	Low	58.2	Low	75 Å²	75	111.4 Å²	111.4	62%	0.62	55%	0.546	S	S	*	.	G	3₁₀ helix	trans	-51.1	-25.4	179.8	0	0	0	0	0	113.6	D64 Y75	A62-D64 PolarHBondContact O-N 3.27Å; A62-Y75 HydrophobicContact CB-CE1 4.42Å
63	E	62.4	Low	58.7	Low	168 Å²	168	113.7 Å²	113.7	79%	0.785	56%	0.557	S	S	*	*	G	3₁₀ helix	trans	-68.1	-24.2	177.4	-60.6	171.2	-157.3	0	0	114.6	R61	R61-E63 PolarHBondContact O-N 3.15Å
64	D	61.5	Low	59.1	Low	75 Å²	75	110.5 Å²	110.5	40%	0.401	55%	0.547	S	S	.	.	G	3₁₀ helix	trans	-103.9	4.8	-173.9	-47.3	-64	0	0	0	113.7	K60 R61 A62	K60-D64 HydrophobicContact CB-CB 3.75Å; K60-D64 HydrophobicContact CD-CB 3.51Å; K60-D64 HydrophobicContact CG-CB 3.52Å; R61-D64 PolarHBondContact O-N 3.09Å; A62-D64 PolarHBondContact O-N 3.27Å
65	V	59.2	Low	59.6	Low	39 Å²	39	109.3 Å²	109.3	24%	0.236	54%	0.54	C	S	.	.			trans	-95.6	113	-179.8	-177.4	0	0	0	0	109	K60 L67	K60-V65 HydrophobicContact CB-CG2 4.23Å; V65-L67 PolarHBondContact O-N 3.32Å
66	E	63.9	Low	60	Low	167 Å²	167	111 Å²	111	78%	0.78	56%	0.557	S	S	*	*			trans	-63.6	121.5	169.4	-71.3	178.5	179	0	0	109.5	T68	E66-T68 PolarHBondContact O-N 3.1Å; E66-T68 VanDerWaalsContact O-N 3.07Å
67	L	64.1	Low	60.5	Low	125 Å²	125	114.2 Å²	114.2	65%	0.654	57%	0.573	S	S	*	*			trans	-70.6	100.9	173.5	-78.5	164.7	0	0	0	108.9	V65 Y75	V65-L67 PolarHBondContact O-N 3.32Å; L67-Y75 HydrophobicContact CD2-CD2 3.58Å; L67-Y75 HydrophobicContact CD2-CE2 4.01Å; L67-Y75 HydrophobicContact CD2-CG 4.33Å
68	T	70	Confident	61.1	Low	60 Å²	60	109.5 Å²	109.5	37%	0.368	56%	0.561	S	S	.	*			trans	-94.1	159.5	168.6	57.7	0	0	0	0	110.6	E66 D70 N71 A72	E66-T68 PolarHBondContact O-N 3.1Å; E66-T68 VanDerWaalsContact O-N 3.07Å; T68-D70 PolarHBondContact O-N 3.07Å; T68-D70 VanDerWaalsContact O-N 3.12Å; T68-N71 PolarHBondContact O-N 3.48Å; T68-N71 PolarHBondContact OG1-ND2 2.92Å; T68-A72 PolarHBondContact O-N 3.38Å; T68-A72 VanDerWaalsContact O-N 3.09Å
69	E	73.1	Confident	61.6	Low	190 Å²	190	109.2 Å²	109.2	89%	0.888	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.4	-34.7	173.6	-70.4	-175.4	171	0	0	111.7	N71	E69-N71 VanDerWaalsContact C-N 3.29Å; E69-N71 PolarHBondContact O-N 3.3Å
70	D	67.7	Low	62.4	Low	119 Å²	119	110.7 Å²	110.7	64%	0.636	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72	-14.2	178.8	-62.6	-31.7	0	0	0	115.1	K52 T68 H73	K52-D70 PolarHBondContact NZ-O 3.27Å; T68-D70 PolarHBondContact O-N 3.07Å; T68-D70 VanDerWaalsContact O-N 3.12Å; D70-H73 PolarHBondContact O-CE1 2.92Å; D70-H73 PolarHBondContact O-ND1 3.49Å
71	N	63.3	Low	63.2	Low	33 Å²	33	109.4 Å²	109.4	18%	0.176	56%	0.555	C	S	.	*	T	Hydrogen-bonded Turn	trans	-119.9	-10	-174.9	-67.2	-19.9	0	0	0	113.5	K52 T68 E69 H73 L74	K52-N71 WeakPolarHBondContact CE-OD1 3.42Å; T68-N71 PolarHBondContact O-N 3.48Å; T68-N71 PolarHBondContact OG1-ND2 2.92Å; E69-N71 VanDerWaalsContact C-N 3.29Å; E69-N71 PolarHBondContact O-N 3.3Å; N71-H73 VanDerWaalsContact C-N 3.26Å; N71-H73 PolarHBondContact O-N 3.47Å; N71-L74 HydrophobicContact CB-CD1 4.2Å; N71-L74 VanDerWaalsContact O-CB 3.28Å; N71-L74 WeakPolarHBondContact O-CB 3.4Å; N71-L74 WeakPolarHBondContact O-CG 3.12Å; N71-L74 PolarHBondContact O-N 2.91Å; N71-L74 VanDerWaalsContact O-N 3.09Å
72	A	68.5	Low	63.5	Low	46 Å²	46	104.4 Å²	104.4	38%	0.38	55%	0.546	S	S	.	.	G	3₁₀ helix	trans	-58.6	-33.7	-176.5	0	0	0	0	0	113.8	T68 L74 Y75	T68-A72 PolarHBondContact O-N 3.38Å; T68-A72 VanDerWaalsContact O-N 3.09Å; A72-L74 PolarHBondContact O-N 3.45Å; A72-L74 VanDerWaalsContact O-N 3.09Å; A72-Y75 PolarHBondContact O-N 3.39Å
73	H	66.7	Low	63.8	Low	110 Å²	110	106.5 Å²	106.5	51%	0.509	54%	0.541	S	S	.	.	G	3₁₀ helix	trans	-68	-5.1	179	66.6	-88.3	0	0	0	114.5	D70 N71	D70-H73 PolarHBondContact O-CE1 2.92Å; D70-H73 PolarHBondContact O-ND1 3.49Å; N71-H73 VanDerWaalsContact C-N 3.26Å; N71-H73 PolarHBondContact O-N 3.47Å
74	L	58	Low	63.9	Low	43 Å²	43	101.8 Å²	101.8	23%	0.225	52%	0.522	C	S	.	.	G	3₁₀ helix	trans	-93.9	-15.2	-176.8	-58.7	172.4	0	0	0	113.5	Y53 M56 N71 A72	Y53-L74 HydrophobicContact CE1-CD2 3.65Å; Y53-L74 WeakPolarHBondContact OH-CD2 3.16Å; M56-L74 HydrophobicContact CE-CD1 3.41Å; M56-L74 VanDerWaalsContact CE-CD1 3.41Å; M56-L74 HydrophobicContact SD-CD1 3.87Å; N71-L74 HydrophobicContact CB-CD1 4.2Å; N71-L74 VanDerWaalsContact O-CB 3.28Å; N71-L74 WeakPolarHBondContact O-CB 3.4Å; N71-L74 WeakPolarHBondContact O-CG 3.12Å; N71-L74 PolarHBondContact O-N 2.91Å; N71-L74 VanDerWaalsContact O-N 3.09Å; A72-L74 PolarHBondContact O-N 3.45Å; A72-L74 VanDerWaalsContact O-N 3.09Å
75	Y	59.8	Low	64.1	Low	111 Å²	111	104 Å²	104	44%	0.435	53%	0.532	S	S	.	.			trans	-112.6	5.9	-177.6	-67.9	-83.7	0	0	0	113.5	A62 L67 A72	A62-Y75 HydrophobicContact CB-CE1 4.42Å; L67-Y75 HydrophobicContact CD2-CD2 3.58Å; L67-Y75 HydrophobicContact CD2-CE2 4.01Å; L67-Y75 HydrophobicContact CD2-CG 4.33Å; A72-Y75 PolarHBondContact O-N 3.39Å
76	N	55.2	Low	64.6	Low	205 Å²	205	109.9 Å²	109.9	100%	1.096	56%	0.559	S	S	*	*			trans	-105.4	0	169	-76	-22.2	0	0	0	110.2

Retrieved 76 of 76 residues in 23.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).