A0A5K4F7A1_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession A0A5K4F7A1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 75 aa.

						>A0A5K4F7A1_SCHMA|A0A5K4F7A1
MYGIKHQVIGLLINNLILFAHIFCLNLANMSKMLDHMVYYRLVRLFNVHKLLYSDICCCYYPQQPWRQIGSLSQL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.8	Low	82.4	Confident	207 Å²	207	121.5 Å²	121.5	100%	1.02	62%	0.621	S	S	*	*				0	-28.9	0	-87.1	178.5	144.7	0	0	115
2	Y	68.6	Low	83.3	Confident	205 Å²	205	119.8 Å²	119.8	80%	0.804	61%	0.613	S	S	*	*	H	α-helix	trans	-64.4	-38.7	-178.4	-98.9	-90.1	0	0	0	114.8	I4 K5 H6	Y2-I4 PolarHBondContact O-N 3.06Å; Y2-K5 PolarHBondContact O-N 3.48Å; Y2-H6 PolarHBondContact O-N 3.3Å
3	G	75.8	Confident	84	Confident	54 Å²	54	117.3 Å²	117.3	56%	0.557	60%	0.6	S	S	*	*	H	α-helix	trans	-63	-38.4	-177.5	0	0	0	0	0	114.6	K5 H6 Q7	G3-K5 PolarHBondContact O-N 3.38Å; G3-H6 PolarHBondContact O-N 3.5Å; G3-Q7 WeakPolarHBondContact O-CB 3.5Å; G3-Q7 PolarHBondContact O-N 2.92Å
4	I	82.9	Confident	84.5	Confident	117 Å²	117	115.8 Å²	115.8	60%	0.6	59%	0.594	S	S	*	*	H	α-helix	trans	-65.9	-42.5	-178.5	-59.6	171.9	0	0	0	110.7	Y2 H6 Q7 V8	Y2-I4 PolarHBondContact O-N 3.06Å; I4-H6 VanDerWaalsContact C-N 3.35Å; I4-H6 PolarHBondContact O-N 3.43Å; I4-Q7 PolarHBondContact O-N 3.49Å; I4-V8 HydrophobicContact CG2-CG2 4.37Å; I4-V8 VanDerWaalsContact O-CG2 3.31Å; I4-V8 WeakPolarHBondContact O-CG2 3.43Å; I4-V8 PolarHBondContact O-N 3.42Å
5	K	83.5	Confident	85	Confident	151 Å²	151	113.7 Å²	113.7	66%	0.657	59%	0.585	S	S	*	*	H	α-helix	trans	-60.4	-45.2	178.2	-71	-173.4	175.9	-174.7	0	111.4	Y2 G3 Q7 V8 I9	Y2-K5 PolarHBondContact O-N 3.48Å; G3-K5 PolarHBondContact O-N 3.38Å; K5-Q7 VanDerWaalsContact C-N 3.34Å; K5-Q7 PolarHBondContact O-N 3.41Å; K5-V8 PolarHBondContact O-N 3.4Å; K5-I9 WeakPolarHBondContact O-CD1 3.31Å; K5-I9 VanDerWaalsContact O-CG1 3.23Å; K5-I9 WeakPolarHBondContact O-CG1 3.23Å; K5-I9 PolarHBondContact O-N 2.98Å
6	H	83.2	Confident	85.5	Confident	145 Å²	145	114 Å²	114	67%	0.671	59%	0.587	S	S	*	*	H	α-helix	trans	-64.2	-40	179.3	-125.1	-84.9	0	0	0	112.2	Y2 G3 I4 I9 G10	Y2-H6 PolarHBondContact O-N 3.3Å; G3-H6 PolarHBondContact O-N 3.5Å; I4-H6 VanDerWaalsContact C-N 3.35Å; I4-H6 PolarHBondContact O-N 3.43Å; H6-I9 PolarHBondContact O-N 3.41Å; H6-G10 PolarHBondContact O-N 3.03Å
7	Q	88.2	Confident	85.9	Confident	150 Å²	150	113.2 Å²	113.2	70%	0.701	58%	0.583	S	S	*	*	H	α-helix	trans	-66.2	-41	177.7	-166.2	176.6	-16.6	0	0	112	G3 I4 K5 G10 L11	G3-Q7 WeakPolarHBondContact O-CB 3.5Å; G3-Q7 PolarHBondContact O-N 2.92Å; I4-Q7 PolarHBondContact O-N 3.49Å; K5-Q7 VanDerWaalsContact C-N 3.34Å; K5-Q7 PolarHBondContact O-N 3.41Å; Q7-G10 PolarHBondContact O-N 3.45Å; Q7-L11 PolarHBondContact O-N 2.99Å
8	V	90.5	Very high	86.3	Confident	78 Å²	78	112.6 Å²	112.6	47%	0.473	58%	0.58	S	S	.	*	H	α-helix	trans	-64.2	-44.2	175	172.9	0	0	0	0	111.2	I4 K5 G10 L11 L12	I4-V8 HydrophobicContact CG2-CG2 4.37Å; I4-V8 VanDerWaalsContact O-CG2 3.31Å; I4-V8 WeakPolarHBondContact O-CG2 3.43Å; I4-V8 PolarHBondContact O-N 3.42Å; K5-V8 PolarHBondContact O-N 3.4Å; V8-G10 PolarHBondContact O-N 2.99Å; V8-L11 PolarHBondContact O-N 3.26Å; V8-L12 HydrophobicContact CG1-CD1 4.06Å; V8-L12 WeakPolarHBondContact O-CG 3.34Å; V8-L12 PolarHBondContact O-N 3.43Å
9	I	91.1	Very high	86.6	Confident	89 Å²	89	114.3 Å²	114.3	46%	0.456	58%	0.583	S	S	.	*	H	α-helix	trans	-61.3	-45	176.6	-67.2	163	0	0	0	110.6	K5 H6 L11 L12 I13	K5-I9 WeakPolarHBondContact O-CD1 3.31Å; K5-I9 VanDerWaalsContact O-CG1 3.23Å; K5-I9 WeakPolarHBondContact O-CG1 3.23Å; K5-I9 PolarHBondContact O-N 2.98Å; H6-I9 PolarHBondContact O-N 3.41Å; I9-L11 VanDerWaalsContact C-N 3.33Å; I9-L11 PolarHBondContact O-N 3.44Å; I9-L12 PolarHBondContact O-N 3.37Å; I9-I13 HydrophobicContact CG2-CD1 3.81Å; I9-I13 HydrophobicContact CG2-CG1 4.46Å; I9-I13 WeakPolarHBondContact O-CG1 3.45Å; I9-I13 PolarHBondContact O-N 3.5Å
10	G	90.6	Very high	86.7	Confident	30 Å²	30	111.1 Å²	111.1	31%	0.309	58%	0.575	S	S	.	*	H	α-helix	trans	-59.9	-41.7	176.5	0	0	0	0	0	112.9	H6 Q7 V8 I13 N14	H6-G10 PolarHBondContact O-N 3.03Å; Q7-G10 PolarHBondContact O-N 3.45Å; V8-G10 PolarHBondContact O-N 2.99Å; G10-I13 PolarHBondContact O-N 3.29Å; G10-N14 PolarHBondContact O-N 2.97Å; G10-N14 PolarHBondContact O-ND2 2.96Å
11	L	92.7	Very high	86.9	Confident	111 Å²	111	112.2 Å²	112.2	58%	0.581	58%	0.577	S	S	*	*	H	α-helix	trans	-64.1	-42.4	176.5	-157.2	96.1	0	0	0	111.9	Q7 V8 I9 N14 N15	Q7-L11 PolarHBondContact O-N 2.99Å; V8-L11 PolarHBondContact O-N 3.26Å; I9-L11 VanDerWaalsContact C-N 3.33Å; I9-L11 PolarHBondContact O-N 3.44Å; L11-N14 PolarHBondContact O-N 3.31Å; L11-N15 WeakPolarHBondContact O-CB 3.39Å; L11-N15 VanDerWaalsContact O-CG 3.26Å; L11-N15 PolarHBondContact O-N 3.23Å
12	L	92.4	Very high	88.3	Confident	100 Å²	100	107 Å²	107	52%	0.524	55%	0.553	S	S	.	*	H	α-helix	trans	-62.6	-44.8	177.5	-75.5	167.4	0	0	0	111.8	V8 I9 N15 L16	V8-L12 HydrophobicContact CG1-CD1 4.06Å; V8-L12 WeakPolarHBondContact O-CG 3.34Å; V8-L12 PolarHBondContact O-N 3.43Å; I9-L12 PolarHBondContact O-N 3.37Å; L12-N15 PolarHBondContact O-N 2.97Å; L12-L16 WeakPolarHBondContact O-CG 3.34Å; L12-L16 PolarHBondContact O-N 3.43Å
13	I	92.7	Very high	89.3	Confident	88 Å²	88	103.2 Å²	103.2	45%	0.451	54%	0.54	S	S	.	.	H	α-helix	trans	-61.8	-46.2	177.3	-67.3	167.5	0	0	0	110.4	I9 G10 N15 L16 I17	I9-I13 HydrophobicContact CG2-CD1 3.81Å; I9-I13 HydrophobicContact CG2-CG1 4.46Å; I9-I13 WeakPolarHBondContact O-CG1 3.45Å; I9-I13 PolarHBondContact O-N 3.5Å; G10-I13 PolarHBondContact O-N 3.29Å; I13-N15 VanDerWaalsContact C-N 3.34Å; I13-N15 PolarHBondContact O-N 2.98Å; I13-L16 PolarHBondContact O-N 3.35Å; I13-I17 HydrophobicContact CG2-CD1 3.83Å; I13-I17 HydrophobicContact CG2-CG1 4.49Å; I13-I17 WeakPolarHBondContact O-CG1 3.37Å; I13-I17 PolarHBondContact O-N 2.95Å
14	N	91.6	Very high	89.7	Confident	96 Å²	96	104.4 Å²	104.4	51%	0.513	54%	0.539	S	S	.	.	H	α-helix	trans	-61.7	-42	178.1	-74.5	-16.8	0	0	0	112.1	G10 L11 L16 I17 L18	G10-N14 PolarHBondContact O-N 2.97Å; G10-N14 PolarHBondContact O-ND2 2.96Å; L11-N14 PolarHBondContact O-N 3.31Å; N14-L16 VanDerWaalsContact C-N 3.34Å; N14-L16 PolarHBondContact O-N 3.48Å; N14-I17 PolarHBondContact O-N 2.93Å; N14-L18 WeakPolarHBondContact O-CG 3.34Å; N14-L18 PolarHBondContact O-N 3.39Å
15	N	91	Very high	89.9	Confident	85 Å²	85	104.2 Å²	104.2	46%	0.455	54%	0.539	S	S	.	.	H	α-helix	trans	-64.5	-38.5	176.8	-73.2	-12.4	0	0	0	112.2	L11 L12 I13 L18 F19	L11-N15 WeakPolarHBondContact O-CB 3.39Å; L11-N15 VanDerWaalsContact O-CG 3.26Å; L11-N15 PolarHBondContact O-N 3.23Å; L12-N15 PolarHBondContact O-N 2.97Å; I13-N15 VanDerWaalsContact C-N 3.34Å; I13-N15 PolarHBondContact O-N 2.98Å; N15-L18 PolarHBondContact O-N 3.41Å; N15-F19 WeakPolarHBondContact O-CB 3.45Å; N15-F19 PolarHBondContact O-N 2.98Å
16	L	92.6	Very high	90.1	Very high	118 Å²	118	101.4 Å²	101.4	62%	0.618	53%	0.531	S	S	*	.	H	α-helix	trans	-64.2	-42.7	174.7	-76.9	165.5	0	0	0	111.8	L12 I13 N14 F19 A20	L12-L16 WeakPolarHBondContact O-CG 3.34Å; L12-L16 PolarHBondContact O-N 3.43Å; I13-L16 PolarHBondContact O-N 3.35Å; N14-L16 VanDerWaalsContact C-N 3.34Å; N14-L16 PolarHBondContact O-N 3.48Å; L16-F19 PolarHBondContact O-N 3.49Å; L16-A20 WeakPolarHBondContact O-CB 3.37Å; L16-A20 PolarHBondContact O-N 3.34Å
17	I	93.9	Very high	90.1	Very high	101 Å²	101	99.7 Å²	99.7	52%	0.518	53%	0.526	S	S	.	.	H	α-helix	trans	-63.2	-45.9	176.6	-67.5	165.6	0	0	0	110.5	I13 N14 F19 A20 H21	I13-I17 HydrophobicContact CG2-CD1 3.83Å; I13-I17 HydrophobicContact CG2-CG1 4.49Å; I13-I17 WeakPolarHBondContact O-CG1 3.37Å; I13-I17 PolarHBondContact O-N 2.95Å; N14-I17 PolarHBondContact O-N 2.93Å; I17-F19 VanDerWaalsContact C-N 3.34Å; I17-F19 PolarHBondContact O-N 2.9Å; I17-A20 PolarHBondContact O-N 2.94Å; I17-H21 WeakPolarHBondContact O-CB 3.43Å; I17-H21 PolarHBondContact O-N 3.38Å
18	L	91.8	Very high	90	Very high	102 Å²	102	94.7 Å²	94.7	53%	0.534	51%	0.51	S	S	.	.	H	α-helix	trans	-60.3	-44.2	177	-73.6	170.7	0	0	0	111.6	N14 N15 H21 I22	N14-L18 WeakPolarHBondContact O-CG 3.34Å; N14-L18 PolarHBondContact O-N 3.39Å; N15-L18 PolarHBondContact O-N 3.41Å; L18-H21 PolarHBondContact O-N 2.93Å; L18-I22 VanDerWaalsContact O-CG1 3.26Å; L18-I22 WeakPolarHBondContact O-CG1 3.45Å; L18-I22 PolarHBondContact O-N 3.32Å
19	F	91.9	Very high	89.9	Confident	144 Å²	144	95.3 Å²	95.3	63%	0.632	51%	0.511	S	S	*	.	H	α-helix	trans	-61.4	-47.3	177.2	-178.1	-98.6	0	0	0	111.8	N15 L16 I17 H21 I22 F23	N15-F19 WeakPolarHBondContact O-CB 3.45Å; N15-F19 PolarHBondContact O-N 2.98Å; L16-F19 PolarHBondContact O-N 3.49Å; I17-F19 VanDerWaalsContact C-N 3.34Å; I17-F19 PolarHBondContact O-N 2.9Å; F19-H21 VanDerWaalsContact C-N 3.32Å; F19-H21 PolarHBondContact O-N 3.46Å; F19-I22 PolarHBondContact O-N 3.43Å; F19-F23 WeakPolarHBondContact O-CB 3.47Å; F19-F23 PolarHBondContact O-N 3.33Å
20	A	89.9	Confident	89.4	Confident	51 Å²	51	96.6 Å²	96.6	42%	0.421	52%	0.516	S	S	.	.	H	α-helix	trans	-60.8	-41.9	177.1	0	0	0	0	0	111.8	L16 I17 F23 C24	L16-A20 WeakPolarHBondContact O-CB 3.37Å; L16-A20 PolarHBondContact O-N 3.34Å; I17-A20 PolarHBondContact O-N 2.94Å; A20-F23 PolarHBondContact O-N 3.46Å; A20-C24 WeakPolarHBondContact O-CB 3.37Å; A20-C24 PolarHBondContact O-N 3.37Å; A20-C24 PolarHBondContact O-SG 2.93Å; A20-C24 VanDerWaalsContact O-SG 3.32Å
21	H	90.4	Very high	89.1	Confident	134 Å²	134	97.9 Å²	97.9	62%	0.62	52%	0.521	S	S	*	.	H	α-helix	trans	-65.2	-44.7	179.3	-167.1	-111.3	0	0	0	112.3	I17 L18 F19 F23 C24 L25	I17-H21 WeakPolarHBondContact O-CB 3.43Å; I17-H21 PolarHBondContact O-N 3.38Å; L18-H21 PolarHBondContact O-N 2.93Å; F19-H21 VanDerWaalsContact C-N 3.32Å; F19-H21 PolarHBondContact O-N 3.46Å; H21-F23 VanDerWaalsContact C-N 3.34Å; H21-F23 PolarHBondContact O-N 2.97Å; H21-C24 PolarHBondContact O-N 2.95Å; H21-L25 WeakPolarHBondContact O-CB 3.37Å; H21-L25 PolarHBondContact O-N 3.33Å
22	I	89	Confident	88.6	Confident	99 Å²	99	99.6 Å²	99.6	51%	0.508	52%	0.523	S	S	.	.	H	α-helix	trans	-62.4	-42.8	175.7	-67.1	165.7	0	0	0	110.6	L18 F19 L25 N26	L18-I22 VanDerWaalsContact O-CG1 3.26Å; L18-I22 WeakPolarHBondContact O-CG1 3.45Å; L18-I22 PolarHBondContact O-N 3.32Å; F19-I22 PolarHBondContact O-N 3.43Å; I22-L25 PolarHBondContact O-N 3.37Å; I22-N26 WeakPolarHBondContact O-CB 3.26Å; I22-N26 PolarHBondContact O-N 3.47Å; I22-N26 PolarHBondContact O-ND2 2.95Å
23	F	88.9	Confident	88.1	Confident	125 Å²	125	99.4 Å²	99.4	55%	0.548	52%	0.521	S	S	.	.	H	α-helix	trans	-61.6	-47.4	178	-176.3	-99.6	0	0	0	111.9	F19 A20 H21 L25 N26 L27	F19-F23 WeakPolarHBondContact O-CB 3.47Å; F19-F23 PolarHBondContact O-N 3.33Å; A20-F23 PolarHBondContact O-N 3.46Å; H21-F23 VanDerWaalsContact C-N 3.34Å; H21-F23 PolarHBondContact O-N 2.97Å; F23-L25 PolarHBondContact O-N 3.37Å; F23-N26 PolarHBondContact O-N 3.38Å; F23-L27 PolarHBondContact O-N 2.94Å
24	C	85.6	Confident	87.6	Confident	78 Å²	78	100 Å²	100	53%	0.527	53%	0.525	S	S	.	.	H	α-helix	trans	-61.8	-42	176.9	-73	0	0	0	0	112.4	A20 H21 L27 A28	A20-C24 WeakPolarHBondContact O-CB 3.37Å; A20-C24 PolarHBondContact O-N 3.37Å; A20-C24 PolarHBondContact O-SG 2.93Å; A20-C24 VanDerWaalsContact O-SG 3.32Å; H21-C24 PolarHBondContact O-N 2.95Å; C24-L27 PolarHBondContact O-N 2.94Å; C24-A28 WeakPolarHBondContact O-CB 3.47Å; C24-A28 PolarHBondContact O-N 3.39Å
25	L	87.2	Confident	87.2	Confident	113 Å²	113	100.5 Å²	100.5	59%	0.592	53%	0.527	S	S	*	.	H	α-helix	trans	-64	-42.8	178.2	-171.9	68.7	0	0	0	111.6	H21 I22 F23 A28 N29	H21-L25 WeakPolarHBondContact O-CB 3.37Å; H21-L25 PolarHBondContact O-N 3.33Å; I22-L25 PolarHBondContact O-N 3.37Å; F23-L25 PolarHBondContact O-N 3.37Å; L25-A28 PolarHBondContact O-N 3.35Å; L25-N29 WeakPolarHBondContact O-CB 3.45Å; L25-N29 PolarHBondContact O-N 2.98Å
26	N	87.1	Confident	86.7	Confident	92 Å²	92	102.7 Å²	102.7	49%	0.492	53%	0.534	S	S	.	.	H	α-helix	trans	-62.8	-43.8	175.4	-76.8	-26.6	0	0	0	111.3	I22 F23 A28 N29 M30	I22-N26 WeakPolarHBondContact O-CB 3.26Å; I22-N26 PolarHBondContact O-N 3.47Å; I22-N26 PolarHBondContact O-ND2 2.95Å; F23-N26 PolarHBondContact O-N 3.38Å; N26-A28 VanDerWaalsContact C-N 3.34Å; N26-A28 PolarHBondContact O-N 2.92Å; N26-N29 PolarHBondContact O-N 3.46Å; N26-M30 WeakPolarHBondContact O-CB 3.47Å; N26-M30 VanDerWaalsContact O-CG 3.23Å; N26-M30 WeakPolarHBondContact O-CG 3.23Å; N26-M30 PolarHBondContact O-N 3.35Å
27	L	83.3	Confident	86.2	Confident	110 Å²	110	101.7 Å²	101.7	58%	0.576	53%	0.528	S	S	*	.	H	α-helix	trans	-60.6	-43.9	177	-169.7	69.6	0	0	0	111.7	F23 C24 N29 M30 S31	F23-L27 PolarHBondContact O-N 2.94Å; C24-L27 PolarHBondContact O-N 2.94Å; L27-N29 VanDerWaalsContact C-N 3.33Å; L27-N29 PolarHBondContact O-N 3.35Å; L27-M30 PolarHBondContact O-N 2.95Å; L27-S31 PolarHBondContact O-N 3.2Å; L27-S31 PolarHBondContact O-OG 3.42Å
28	A	86.4	Confident	85.6	Confident	44 Å²	44	100.4 Å²	100.4	36%	0.364	53%	0.525	S	S	.	.	H	α-helix	trans	-66.6	-32.3	177	0	0	0	0	0	113	C24 L25 N26 S31 K32	C24-A28 WeakPolarHBondContact O-CB 3.47Å; C24-A28 PolarHBondContact O-N 3.39Å; L25-A28 PolarHBondContact O-N 3.35Å; N26-A28 VanDerWaalsContact C-N 3.34Å; N26-A28 PolarHBondContact O-N 2.92Å; A28-S31 WeakPolarHBondContact CA-OG 3.45Å; A28-S31 PolarHBondContact O-OG 2.92Å; A28-K32 WeakPolarHBondContact O-CG 3.35Å; A28-K32 PolarHBondContact O-N 3.36Å
29	N	87.3	Confident	85.1	Confident	92 Å²	92	102.9 Å²	102.9	49%	0.492	53%	0.528	S	S	.	.	H	α-helix	trans	-72.8	-40.8	175.4	-165.7	46.2	0	0	0	111.4	L25 N26 L27 K32 M33	L25-N29 WeakPolarHBondContact O-CB 3.45Å; L25-N29 PolarHBondContact O-N 2.98Å; N26-N29 PolarHBondContact O-N 3.46Å; L27-N29 VanDerWaalsContact C-N 3.33Å; L27-N29 PolarHBondContact O-N 3.35Å; N29-K32 PolarHBondContact O-N 2.9Å; N29-M33 WeakPolarHBondContact O-CB 3.35Å; N29-M33 PolarHBondContact O-N 3.47Å
30	M	81.3	Confident	84.4	Confident	116 Å²	116	103.4 Å²	103.4	57%	0.571	53%	0.527	S	S	*	.	H	α-helix	trans	-64.8	-39.4	175.7	-68.2	-60.1	-70.2	0	0	111.8	N26 L27 M33 L34	N26-M30 WeakPolarHBondContact O-CB 3.47Å; N26-M30 VanDerWaalsContact O-CG 3.23Å; N26-M30 WeakPolarHBondContact O-CG 3.23Å; N26-M30 PolarHBondContact O-N 3.35Å; L27-M30 PolarHBondContact O-N 2.95Å; M30-M33 PolarHBondContact O-N 3.21Å; M30-L34 WeakPolarHBondContact O-CB 3.46Å; M30-L34 PolarHBondContact O-N 3.38Å
31	S	84.3	Confident	83.9	Confident	57 Å²	57	109.4 Å²	109.4	40%	0.399	54%	0.538	S	S	.	.	H	α-helix	trans	-64	-46.4	175.8	65.9	0	0	0	0	111.5	L27 A28 M33 L34 D35	L27-S31 PolarHBondContact O-N 3.2Å; L27-S31 PolarHBondContact O-OG 3.42Å; A28-S31 WeakPolarHBondContact CA-OG 3.45Å; A28-S31 PolarHBondContact O-OG 2.92Å; S31-M33 VanDerWaalsContact C-N 3.3Å; S31-M33 PolarHBondContact O-N 3.44Å; S31-L34 WeakPolarHBondContact O-CB 3.41Å; S31-L34 PolarHBondContact O-N 3.44Å; S31-L34 VanDerWaalsContact O-N 3.12Å; S31-D35 PolarHBondContact O-N 2.88Å
32	K	83	Confident	83.5	Confident	147 Å²	147	107.1 Å²	107.1	64%	0.639	53%	0.53	S	S	*	.	H	α-helix	trans	-58.9	-40.8	174.5	-75.5	178.1	-179	179.4	0	112.5	A28 N29 L34 D35 H36	A28-K32 WeakPolarHBondContact O-CG 3.35Å; A28-K32 PolarHBondContact O-N 3.36Å; N29-K32 PolarHBondContact O-N 2.9Å; K32-L34 VanDerWaalsContact C-N 3.33Å; K32-D35 PolarHBondContact O-N 3.34Å; K32-H36 WeakPolarHBondContact O-CB 3.49Å; K32-H36 PolarHBondContact O-N 3.12Å
33	M	81.8	Confident	83	Confident	96 Å²	96	104.7 Å²	104.7	47%	0.473	52%	0.52	S	S	.	.	H	α-helix	trans	-64.5	-40.7	176.9	-168.8	-174.2	-62.6	0	0	111.2	N29 M30 S31 H36 M37	N29-M33 WeakPolarHBondContact O-CB 3.35Å; N29-M33 PolarHBondContact O-N 3.47Å; M30-M33 PolarHBondContact O-N 3.21Å; S31-M33 VanDerWaalsContact C-N 3.3Å; S31-M33 PolarHBondContact O-N 3.44Å; M33-H36 PolarHBondContact O-N 2.93Å; M33-M37 WeakPolarHBondContact O-CG 3.45Å; M33-M37 PolarHBondContact O-N 3.26Å
34	L	82.2	Confident	82.5	Confident	101 Å²	101	106.9 Å²	106.9	53%	0.529	53%	0.525	S	S	.	.	H	α-helix	trans	-64.6	-46.5	176.3	-172.8	65.2	0	0	0	111.4	M30 S31 K32 H36 M37 V38	M30-L34 WeakPolarHBondContact O-CB 3.46Å; M30-L34 PolarHBondContact O-N 3.38Å; S31-L34 WeakPolarHBondContact O-CB 3.41Å; S31-L34 PolarHBondContact O-N 3.44Å; S31-L34 VanDerWaalsContact O-N 3.12Å; K32-L34 VanDerWaalsContact C-N 3.33Å; L34-H36 VanDerWaalsContact C-N 3.3Å; L34-H36 PolarHBondContact O-N 2.98Å; L34-M37 PolarHBondContact O-N 2.99Å; L34-M37 VanDerWaalsContact O-N 3.13Å; L34-V38 WeakPolarHBondContact O-CG2 3.4Å; L34-V38 PolarHBondContact O-N 3.47Å
35	D	82.7	Confident	82.2	Confident	106 Å²	106	108.8 Å²	108.8	57%	0.567	53%	0.529	S	S	*	.	H	α-helix	trans	-57.5	-44.4	176.4	-70.8	-27.8	0	0	0	111.1	S31 K32 M37 V38 Y39	S31-D35 PolarHBondContact O-N 2.88Å; K32-D35 PolarHBondContact O-N 3.34Å; D35-M37 PolarHBondContact O-N 3.47Å; D35-V38 PolarHBondContact O-N 3.46Å; D35-Y39 WeakPolarHBondContact O-CB 3.39Å; D35-Y39 PolarHBondContact O-N 2.87Å
36	H	81.3	Confident	81.7	Confident	130 Å²	130	110.2 Å²	110.2	60%	0.602	53%	0.531	S	S	*	.	H	α-helix	trans	-63.7	-40.4	177	-169.2	-100.3	0	0	0	112.2	K32 M33 L34 Y40	K32-H36 WeakPolarHBondContact O-CB 3.49Å; K32-H36 PolarHBondContact O-N 3.12Å; M33-H36 PolarHBondContact O-N 2.93Å; L34-H36 VanDerWaalsContact C-N 3.3Å; L34-H36 PolarHBondContact O-N 2.98Å; H36-Y40 WeakPolarHBondContact O-CB 3.37Å; H36-Y40 PolarHBondContact O-N 2.94Å
37	M	80.6	Confident	81.3	Confident	98 Å²	98	110.7 Å²	110.7	48%	0.483	53%	0.533	S	S	.	.	H	α-helix	trans	-66.1	-41.2	175.7	-75.5	-151.1	-72.8	0	0	112.6	M33 L34 D35 R41	M33-M37 WeakPolarHBondContact O-CG 3.45Å; M33-M37 PolarHBondContact O-N 3.26Å; L34-M37 PolarHBondContact O-N 2.99Å; L34-M37 VanDerWaalsContact O-N 3.13Å; D35-M37 PolarHBondContact O-N 3.47Å; M37-R41 WeakPolarHBondContact O-CB 3.4Å; M37-R41 VanDerWaalsContact O-CG 3.32Å; M37-R41 WeakPolarHBondContact O-CG 3.37Å; M37-R41 PolarHBondContact O-N 3.17Å
38	V	82.2	Confident	81.1	Confident	74 Å²	74	109.4 Å²	109.4	45%	0.448	53%	0.53	S	S	.	.	H	α-helix	trans	-65.3	-46.6	176.7	173.2	0	0	0	0	110.2	L34 D35 Y40 R41 L42	L34-V38 WeakPolarHBondContact O-CG2 3.4Å; L34-V38 PolarHBondContact O-N 3.47Å; D35-V38 PolarHBondContact O-N 3.46Å; V38-Y40 PolarHBondContact O-N 2.92Å; V38-R41 PolarHBondContact O-N 2.89Å; V38-L42 HydrophobicContact CG1-CD1 4.03Å; V38-L42 HydrophobicContact CG1-CG 4.44Å; V38-L42 WeakPolarHBondContact O-CG 3.39Å; V38-L42 PolarHBondContact O-N 3.13Å
39	Y	80.8	Confident	80.3	Confident	154 Å²	154	113.1 Å²	113.1	60%	0.604	54%	0.539	S	S	*	.	H	α-helix	trans	-57.9	-49	176.3	178.8	-100.4	0	0	0	111.9	D35 R41 L42 V43	D35-Y39 WeakPolarHBondContact O-CB 3.39Å; D35-Y39 PolarHBondContact O-N 2.87Å; Y39-R41 VanDerWaalsContact C-N 3.33Å; Y39-R41 PolarHBondContact O-N 3.49Å; Y39-L42 PolarHBondContact O-N 2.89Å; Y39-V43 HydrophobicContact CD1-CG2 4.15Å; Y39-V43 HydrophobicContact CD2-CG2 4.39Å; Y39-V43 HydrophobicContact CE1-CG2 3.7Å; Y39-V43 HydrophobicContact CE2-CG2 3.96Å; Y39-V43 HydrophobicContact CG-CG2 4.48Å; Y39-V43 WeakPolarHBondContact O-CG2 3.42Å; Y39-V43 PolarHBondContact O-N 3.39Å
40	Y	76.9	Confident	79.6	Confident	155 Å²	155	116.3 Å²	116.3	61%	0.608	55%	0.549	S	S	*	.	H	α-helix	trans	-61.2	-40.6	178.5	-175	-98.4	0	0	0	112.4	H36 V38 V43 R44	H36-Y40 WeakPolarHBondContact O-CB 3.37Å; H36-Y40 PolarHBondContact O-N 2.94Å; V38-Y40 PolarHBondContact O-N 2.92Å; Y40-V43 PolarHBondContact O-N 3.02Å; Y40-R44 WeakPolarHBondContact O-CB 3.32Å; Y40-R44 PolarHBondContact O-N 2.97Å
41	R	80.3	Confident	79.2	Confident	176 Å²	176	116 Å²	116	66%	0.664	55%	0.549	S	S	*	.	H	α-helix	trans	-62	-44.2	174.5	-77.8	179.6	-180	-154.2	1.7	111.8	M37 V38 Y39 R44 L45	M37-R41 WeakPolarHBondContact O-CB 3.4Å; M37-R41 VanDerWaalsContact O-CG 3.32Å; M37-R41 WeakPolarHBondContact O-CG 3.37Å; M37-R41 PolarHBondContact O-N 3.17Å; V38-R41 PolarHBondContact O-N 2.89Å; Y39-R41 VanDerWaalsContact C-N 3.33Å; Y39-R41 PolarHBondContact O-N 3.49Å; R41-R44 PolarHBondContact O-N 2.88Å; R41-L45 WeakPolarHBondContact O-CG 3.45Å; R41-L45 PolarHBondContact O-N 3.34Å
42	L	81.1	Confident	78.5	Confident	86 Å²	86	117.8 Å²	117.8	45%	0.45	55%	0.553	S	S	.	*	H	α-helix	trans	-63.2	-49	177.4	-71.6	172.4	0	0	0	111.3	V38 Y39 R44 L45 F46	V38-L42 HydrophobicContact CG1-CD1 4.03Å; V38-L42 HydrophobicContact CG1-CG 4.44Å; V38-L42 WeakPolarHBondContact O-CG 3.39Å; V38-L42 PolarHBondContact O-N 3.13Å; Y39-L42 PolarHBondContact O-N 2.89Å; L42-R44 VanDerWaalsContact C-N 3.27Å; L42-R44 PolarHBondContact O-N 3.49Å; L42-L45 WeakPolarHBondContact O-CB 3.42Å; L42-L45 PolarHBondContact O-N 2.88Å; L42-L45 VanDerWaalsContact O-N 3.1Å; L42-F46 VanDerWaalsContact O-CD2 3.24Å; L42-F46 WeakPolarHBondContact O-CD2 3.33Å; L42-F46 PolarHBondContact O-N 2.86Å
43	V	78.7	Confident	77.5	Confident	49 Å²	49	117.9 Å²	117.9	30%	0.297	55%	0.551	S	S	.	*	H	α-helix	trans	-57.9	-41.5	177.2	172.1	0	0	0	0	111.3	Y39 Y40 F46 N47	Y39-V43 HydrophobicContact CD1-CG2 4.15Å; Y39-V43 HydrophobicContact CD2-CG2 4.39Å; Y39-V43 HydrophobicContact CE1-CG2 3.7Å; Y39-V43 HydrophobicContact CE2-CG2 3.96Å; Y39-V43 HydrophobicContact CG-CG2 4.48Å; Y39-V43 WeakPolarHBondContact O-CG2 3.42Å; Y39-V43 PolarHBondContact O-N 3.39Å; Y40-V43 PolarHBondContact O-N 3.02Å; V43-F46 PolarHBondContact O-N 3.1Å; V43-N47 WeakPolarHBondContact O-CB 3.24Å; V43-N47 PolarHBondContact O-N 3.31Å
44	R	78.9	Confident	76.8	Confident	171 Å²	171	116.4 Å²	116.4	65%	0.645	55%	0.55	S	S	*	.	H	α-helix	trans	-63.6	-43.9	175.9	-170	179.2	-178.9	-135.9	0.7	111.9	Y40 R41 L42 F46 N47 V48	Y40-R44 WeakPolarHBondContact O-CB 3.32Å; Y40-R44 PolarHBondContact O-N 2.97Å; R41-R44 PolarHBondContact O-N 2.88Å; L42-R44 VanDerWaalsContact C-N 3.27Å; L42-R44 PolarHBondContact O-N 3.49Å; R44-F46 VanDerWaalsContact C-N 3.35Å; R44-N47 PolarHBondContact O-N 3.4Å; R44-V48 WeakPolarHBondContact O-CG2 3.46Å; R44-V48 PolarHBondContact O-N 3.31Å
45	L	78.8	Confident	75.8	Confident	117 Å²	117	115.5 Å²	115.5	61%	0.613	55%	0.546	S	S	*	.	H	α-helix	trans	-59.9	-44.8	174.6	-77.6	163.1	0	0	0	111.4	R41 L42 N47 V48 H49	R41-L45 WeakPolarHBondContact O-CG 3.45Å; R41-L45 PolarHBondContact O-N 3.34Å; L42-L45 WeakPolarHBondContact O-CB 3.42Å; L42-L45 PolarHBondContact O-N 2.88Å; L42-L45 VanDerWaalsContact O-N 3.1Å; L45-N47 PolarHBondContact O-N 2.95Å; L45-V48 PolarHBondContact O-N 3.34Å; L45-H49 WeakPolarHBondContact O-CB 3.41Å; L45-H49 PolarHBondContact O-N 3.48Å
46	F	77.5	Confident	74.8	Confident	143 Å²	143	114.1 Å²	114.1	63%	0.627	54%	0.538	S	S	*	.	H	α-helix	trans	-60.9	-43.3	175.3	-87.8	-74.9	0	0	0	112.3	L42 V43 R44 H49 K50	L42-F46 VanDerWaalsContact O-CD2 3.24Å; L42-F46 WeakPolarHBondContact O-CD2 3.33Å; L42-F46 PolarHBondContact O-N 2.86Å; V43-F46 PolarHBondContact O-N 3.1Å; R44-F46 VanDerWaalsContact C-N 3.35Å; F46-H49 PolarHBondContact O-N 2.96Å; F46-K50 WeakPolarHBondContact O-CB 3.35Å; F46-K50 PolarHBondContact O-N 2.92Å
47	N	78.4	Confident	73.6	Confident	102 Å²	102	109.9 Å²	109.9	55%	0.545	52%	0.522	S	S	.	.	H	α-helix	trans	-66.2	-41.1	177.9	-78.9	-13	0	0	0	112.3	V43 R44 L45 H49 K50 L51	V43-N47 WeakPolarHBondContact O-CB 3.24Å; V43-N47 PolarHBondContact O-N 3.31Å; R44-N47 PolarHBondContact O-N 3.4Å; L45-N47 PolarHBondContact O-N 2.95Å; N47-H49 VanDerWaalsContact C-N 3.35Å; N47-K50 PolarHBondContact O-N 3.43Å; N47-L51 WeakPolarHBondContact O-CB 3.39Å; N47-L51 PolarHBondContact O-N 3.09Å
48	V	77.8	Confident	72.4	Confident	84 Å²	84	109.5 Å²	109.5	51%	0.509	53%	0.528	S	S	.	.	H	α-helix	trans	-63.9	-42.6	174.1	171.3	0	0	0	0	110.5	R44 L45 K50 L51 L52	R44-V48 WeakPolarHBondContact O-CG2 3.46Å; R44-V48 PolarHBondContact O-N 3.31Å; L45-V48 PolarHBondContact O-N 3.34Å; V48-K50 VanDerWaalsContact C-N 3.35Å; V48-K50 PolarHBondContact O-N 2.87Å; V48-L51 PolarHBondContact O-N 2.85Å; V48-L52 WeakPolarHBondContact O-CB 3.5Å; V48-L52 PolarHBondContact O-N 3.31Å
49	H	71.3	Confident	71.1	Confident	121 Å²	121	110.8 Å²	110.8	56%	0.56	54%	0.539	S	S	*	.	H	α-helix	trans	-61.9	-42.8	176.8	-174.4	71.7	0	0	0	111.8	L45 F46 N47 L52 Y53	L45-H49 WeakPolarHBondContact O-CB 3.41Å; L45-H49 PolarHBondContact O-N 3.48Å; F46-H49 PolarHBondContact O-N 2.96Å; N47-H49 VanDerWaalsContact C-N 3.35Å; H49-L52 PolarHBondContact O-N 3.38Å; H49-Y53 WeakPolarHBondContact O-CB 3.4Å; H49-Y53 PolarHBondContact O-N 2.86Å
50	K	71	Confident	69.8	Low	159 Å²	159	112.2 Å²	112.2	69%	0.691	55%	0.545	S	S	*	.	H	α-helix	trans	-64.2	-41.4	176.2	-171.5	178.8	179.1	-179.5	0	112.1	F46 N47 V48 S54	F46-K50 WeakPolarHBondContact O-CB 3.35Å; F46-K50 PolarHBondContact O-N 2.92Å; N47-K50 PolarHBondContact O-N 3.43Å; V48-K50 VanDerWaalsContact C-N 3.35Å; V48-K50 PolarHBondContact O-N 2.87Å; K50-S54 WeakPolarHBondContact O-CB 3.35Å; K50-S54 PolarHBondContact O-N 3.38Å
51	L	74.7	Confident	68.2	Low	109 Å²	109	113.5 Å²	113.5	57%	0.571	55%	0.55	S	S	*	.	H	α-helix	trans	-64.1	-49.1	175.9	-171.9	71.6	0	0	0	110.7	N47 V48 Y53 S54 D55	N47-L51 WeakPolarHBondContact O-CB 3.39Å; N47-L51 PolarHBondContact O-N 3.09Å; V48-L51 PolarHBondContact O-N 2.85Å; L51-Y53 VanDerWaalsContact C-N 3.32Å; L51-Y53 PolarHBondContact O-N 2.93Å; L51-S54 CarbonylContact O-C 3.58Å; L51-S54 WeakPolarHBondContact O-CA 3.45Å; L51-S54 WeakPolarHBondContact O-CB 3.38Å; L51-S54 PolarHBondContact O-N 2.82Å; L51-S54 VanDerWaalsContact O-N 3.09Å; L51-D55 PolarHBondContact O-N 2.81Å
52	L	69.2	Low	66.6	Low	95 Å²	95	109.7 Å²	109.7	50%	0.497	55%	0.548	S	S	.	.	H	α-helix	trans	-59.7	-42.6	177.8	-174.1	69.1	0	0	0	111.5	V48 H49 S54 D55 I56	V48-L52 WeakPolarHBondContact O-CB 3.5Å; V48-L52 PolarHBondContact O-N 3.31Å; H49-L52 PolarHBondContact O-N 3.38Å; L52-S54 VanDerWaalsContact C-N 3.35Å; L52-D55 PolarHBondContact O-N 3.38Å; L52-I56 HydrophobicContact CD1-CD1 4.22Å; L52-I56 HydrophobicContact CD1-CG1 4.44Å; L52-I56 HydrophobicContact CD2-CD1 4.34Å; L52-I56 HydrophobicContact CG-CD1 3.8Å; L52-I56 HydrophobicContact CG-CG1 4.37Å; L52-I56 VanDerWaalsContact O-CB 3.31Å; L52-I56 WeakPolarHBondContact O-CB 3.33Å; L52-I56 WeakPolarHBondContact O-CG1 3.34Å; L52-I56 PolarHBondContact O-N 2.86Å
53	Y	61.8	Low	65.1	Low	149 Å²	149	112.8 Å²	112.8	58%	0.584	56%	0.56	S	S	*	*	H	α-helix	trans	-64.6	-40	175.5	-168.3	-93.6	0	0	0	111.6	H49 L51 C57	H49-Y53 WeakPolarHBondContact O-CB 3.4Å; H49-Y53 PolarHBondContact O-N 2.86Å; L51-Y53 VanDerWaalsContact C-N 3.32Å; L51-Y53 PolarHBondContact O-N 2.93Å; Y53-C57 WeakPolarHBondContact CE1-SG 3.48Å; Y53-C57 VanDerWaalsContact O-CB 3.27Å; Y53-C57 WeakPolarHBondContact O-CB 3.37Å; Y53-C57 PolarHBondContact O-N 3.32Å; Y53-C57 PolarHBondContact O-SG 2.83Å; Y53-C57 VanDerWaalsContact O-SG 3.32Å
54	S	66.4	Low	63.7	Low	65 Å²	65	116.2 Å²	116.2	46%	0.455	57%	0.573	S	S	.	*	H	α-helix	trans	-63.9	-42.8	174.5	-168.8	0	0	0	0	112.2	K50 L51 L52 C57 C58	K50-S54 WeakPolarHBondContact O-CB 3.35Å; K50-S54 PolarHBondContact O-N 3.38Å; L51-S54 CarbonylContact O-C 3.58Å; L51-S54 WeakPolarHBondContact O-CA 3.45Å; L51-S54 WeakPolarHBondContact O-CB 3.38Å; L51-S54 PolarHBondContact O-N 2.82Å; L51-S54 VanDerWaalsContact O-N 3.09Å; L52-S54 VanDerWaalsContact C-N 3.35Å; S54-C57 PolarHBondContact O-N 3.42Å; S54-C58 WeakPolarHBondContact O-CB 3.4Å; S54-C58 PolarHBondContact O-N 3.31Å
55	D	62.1	Low	62.4	Low	83 Å²	83	112 Å²	112	44%	0.444	57%	0.567	S	S	.	*	H	α-helix	trans	-67.4	-44.2	177.7	-75.2	-30.7	0	0	0	111.2	L51 L52 C58 C59	L51-D55 PolarHBondContact O-N 2.81Å; L52-D55 PolarHBondContact O-N 3.38Å; D55-C58 PolarHBondContact O-N 3.38Å; D55-C59 WeakPolarHBondContact O-CB 3.27Å; D55-C59 PolarHBondContact O-N 2.91Å; D55-C59 PolarHBondContact O-SG 3.24Å
56	I	61.5	Low	61	Low	76 Å²	76	114.5 Å²	114.5	39%	0.39	57%	0.569	S	S	.	*	H	α-helix	trans	-61.2	-46.8	174	-69.7	171	0	0	0	109.7	L52 C58 C59 Y60	L52-I56 HydrophobicContact CD1-CD1 4.22Å; L52-I56 HydrophobicContact CD1-CG1 4.44Å; L52-I56 HydrophobicContact CD2-CD1 4.34Å; L52-I56 HydrophobicContact CG-CD1 3.8Å; L52-I56 HydrophobicContact CG-CG1 4.37Å; L52-I56 VanDerWaalsContact O-CB 3.31Å; L52-I56 WeakPolarHBondContact O-CB 3.33Å; L52-I56 WeakPolarHBondContact O-CG1 3.34Å; L52-I56 PolarHBondContact O-N 2.86Å; I56-C58 VanDerWaalsContact C-N 3.32Å; I56-C58 PolarHBondContact O-N 2.82Å; I56-C59 PolarHBondContact O-N 2.89Å; I56-Y60 HydrophobicContact CG2-CD2 3.49Å; I56-Y60 VanDerWaalsContact CG2-CD2 3.49Å; I56-Y60 HydrophobicContact CG2-CE2 3.86Å; I56-Y60 HydrophobicContact CG2-CG 4.46Å; I56-Y60 VanDerWaalsContact O-CB 3.3Å; I56-Y60 WeakPolarHBondContact O-CB 3.3Å; I56-Y60 WeakPolarHBondContact O-CD2 3.16Å; I56-Y60 PolarHBondContact O-N 3.18Å
57	C	55.3	Low	59.4	Low	41 Å²	41	117 Å²	117	28%	0.277	57%	0.574	S	S	.	*	H	α-helix	trans	-61.3	-39.5	175.9	-77.1	0	0	0	0	112.1	Y53 S54 Y61	Y53-C57 WeakPolarHBondContact CE1-SG 3.48Å; Y53-C57 VanDerWaalsContact O-CB 3.27Å; Y53-C57 WeakPolarHBondContact O-CB 3.37Å; Y53-C57 PolarHBondContact O-N 3.32Å; Y53-C57 PolarHBondContact O-SG 2.83Å; Y53-C57 VanDerWaalsContact O-SG 3.32Å; S54-C57 PolarHBondContact O-N 3.42Å; C57-Y61 WeakPolarHBondContact O-CB 3.38Å; C57-Y61 WeakPolarHBondContact O-CD2 3.31Å; C57-Y61 PolarHBondContact O-N 3.46Å
58	C	55.7	Low	57.9	Low	91 Å²	91	119.3 Å²	119.3	62%	0.615	58%	0.582	S	S	*	*	H	α-helix	trans	-66.1	-36.2	174.1	-93	0	0	0	0	113.1	S54 D55 I56 Y61	S54-C58 WeakPolarHBondContact O-CB 3.4Å; S54-C58 PolarHBondContact O-N 3.31Å; D55-C58 PolarHBondContact O-N 3.38Å; I56-C58 VanDerWaalsContact C-N 3.32Å; I56-C58 PolarHBondContact O-N 2.82Å; C58-Y61 CarbonylContact O-C 3.47Å; C58-Y61 VanDerWaalsContact O-O 3.14Å
59	C	55.1	Low	56.7	Low	100 Å²	100	120.5 Å²	120.5	68%	0.676	58%	0.584	S	S	*	*	H	α-helix	trans	-79.9	-33.5	178.9	-70.9	0	0	0	0	113.2	D55 I56	D55-C59 WeakPolarHBondContact O-CB 3.27Å; D55-C59 PolarHBondContact O-N 2.91Å; D55-C59 PolarHBondContact O-SG 3.24Å; I56-C59 PolarHBondContact O-N 2.89Å
60	Y	53.1	Low	55.5	Low	185 Å²	185	117 Å²	117	73%	0.725	58%	0.58	S	S	*	*	H	α-helix	trans	-85.4	-22.7	178.4	-88.9	-90.7	0	0	0	113.5	I56 P62	I56-Y60 HydrophobicContact CG2-CD2 3.49Å; I56-Y60 VanDerWaalsContact CG2-CD2 3.49Å; I56-Y60 HydrophobicContact CG2-CE2 3.86Å; I56-Y60 HydrophobicContact CG2-CG 4.46Å; I56-Y60 VanDerWaalsContact O-CB 3.3Å; I56-Y60 WeakPolarHBondContact O-CB 3.3Å; I56-Y60 WeakPolarHBondContact O-CD2 3.16Å; I56-Y60 PolarHBondContact O-N 3.18Å; Y60-P62 WeakPolarHBondContact O-CD 3.02Å
61	Y	43.6	Very low	54.4	Low	182 Å²	182	113.1 Å²	113.1	71%	0.714	57%	0.573	S	S	*	*	S	Bend	trans	-102	71.5	160	-70.8	-89.7	0	0	0	108.5	C57 C58 Q63	C57-Y61 WeakPolarHBondContact O-CB 3.38Å; C57-Y61 WeakPolarHBondContact O-CD2 3.31Å; C57-Y61 PolarHBondContact O-N 3.46Å; C58-Y61 CarbonylContact O-C 3.47Å; C58-Y61 VanDerWaalsContact O-O 3.14Å; Y61-Q63 PolarHBondContact O-N 2.77Å
62	P	46.3	Very low	53.1	Low	95 Å²	95	114.3 Å²	114.3	62%	0.617	58%	0.58	S	S	*	*			trans	-54.2	132.8	163.5	27.9	-32	0	0	0	106.2	Y60 Q64	Y60-P62 WeakPolarHBondContact O-CD 3.02Å; P62-Q64 PolarHBondContact O-N 3.2Å
63	Q	49.3	Very low	52.1	Low	152 Å²	152	114.4 Å²	114.4	71%	0.71	59%	0.588	S	S	*	*			trans	-34.8	109.1	-176.7	-65.8	179.7	-1.8	0	0	110.7	Y61	Y61-Q63 PolarHBondContact O-N 2.77Å
64	Q	50.7	Low	51.5	Low	120 Å²	120	115.4 Å²	115.4	56%	0.561	60%	0.598	S	S	*	*			trans	-12.1	118.5	165	-77.8	179.7	18.7	0	0	114.3	P62 W66 R67	P62-Q64 PolarHBondContact O-N 3.2Å; Q64-W66 VanDerWaalsContact CB-CD1 3.42Å; Q64-W66 HydrophobicContact CB-CG 4.2Å; Q64-W66 VanDerWaalsContact CB-NE1 3.26Å; Q64-W66 HydrophobicContact CG-CZ2 4.42Å; Q64-W66 VanDerWaalsContact CG-NE1 3.32Å; Q64-W66 PolarHBondContact O-N 3.4Å; Q64-R67 PolarHBondContact O-N 3.17Å
65	P	50	Low	50.6	Low	82 Å²	82	122.8 Å²	122.8	53%	0.532	63%	0.631	S	S	.	*	T	Hydrogen-bonded Turn	trans	-60.6	-13.3	-176.8	21.1	-31	0	0	0	114.1	R67 Q68 I69	P65-R67 PolarHBondContact O-N 2.95Å; P65-Q68 PolarHBondContact O-N 3.45Å; P65-I69 PolarHBondContact O-N 3.41Å
66	W	49.3	Very low	50	Low	171 Å²	171	124.8 Å²	124.8	65%	0.648	64%	0.641	S	S	*	*	H	α-helix	trans	-62.8	-20.2	176.4	3.1	105.6	0	0	0	114	Q64 Q68 I69	Q64-W66 VanDerWaalsContact CB-CD1 3.42Å; Q64-W66 HydrophobicContact CB-CG 4.2Å; Q64-W66 VanDerWaalsContact CB-NE1 3.26Å; Q64-W66 HydrophobicContact CG-CZ2 4.42Å; Q64-W66 VanDerWaalsContact CG-NE1 3.32Å; Q64-W66 PolarHBondContact O-N 3.4Å; W66-Q68 PolarHBondContact O-N 3.39Å; W66-I69 PolarHBondContact O-N 3.23Å
67	R	44.6	Very low	49.4	Very low	196 Å²	196	127.3 Å²	127.3	74%	0.74	65%	0.654	S	S	*	*	H	α-helix	trans	-68.1	-22.1	172	-94.3	-149	-100.8	-131	-0.4	113.8	Q64 P65	Q64-R67 PolarHBondContact O-N 3.17Å; P65-R67 PolarHBondContact O-N 2.95Å
68	Q	48	Very low	49.1	Very low	149 Å²	149	132.1 Å²	132.1	70%	0.696	68%	0.675	S	S	*	*	H	α-helix	trans	-91.5	-23	175.2	-72	-175.2	-33.7	0	0	113	P65 W66 G70 S71	P65-Q68 PolarHBondContact O-N 3.45Å; W66-Q68 PolarHBondContact O-N 3.39Å; Q68-G70 VanDerWaalsContact C-N 3.27Å; Q68-G70 PolarHBondContact O-N 3.47Å; Q68-S71 PolarHBondContact O-N 3.47Å; Q68-S71 PolarHBondContact O-OG 3.29Å
69	I	52.1	Low	48.7	Very low	109 Å²	109	134.5 Å²	134.5	56%	0.559	68%	0.678	S	S	*	*	H	α-helix	trans	-66.7	-33.4	176.3	-56.5	174	0	0	0	110.6	P65 W66 S71 L72	P65-I69 PolarHBondContact O-N 3.41Å; W66-I69 PolarHBondContact O-N 3.23Å; I69-S71 PolarHBondContact O-N 3.24Å; I69-L72 PolarHBondContact O-N 3.19Å
70	G	46.7	Very low	48.3	Very low	47 Å²	47	136.7 Å²	136.7	49%	0.485	68%	0.678	S	S	.	*	H	α-helix	trans	-64.8	-16.8	178.7	0	0	0	0	0	115.7	Q68 S73	Q68-G70 VanDerWaalsContact C-N 3.27Å; Q68-G70 PolarHBondContact O-N 3.47Å; G70-S73 PolarHBondContact O-OG 3.03Å
71	S	47.5	Very low	48	Very low	78 Å²	78	133.5 Å²	133.5	55%	0.545	68%	0.675	S	S	.	*	H	α-helix	trans	-95.5	-15.9	176.3	75.2	0	0	0	0	113.9	Q68 I69	Q68-S71 PolarHBondContact O-N 3.47Å; Q68-S71 PolarHBondContact O-OG 3.29Å; I69-S71 PolarHBondContact O-N 3.24Å
72	L	46.5	Very low	48.3	Very low	135 Å²	135	130 Å²	130	71%	0.707	67%	0.673	S	S	*	*	H	α-helix	trans	-85.2	-13.5	176.5	-79.3	167	0	0	0	112.7	I69 Q74	I69-L72 PolarHBondContact O-N 3.19Å; L72-Q74 VanDerWaalsContact C-N 3.28Å; L72-Q74 PolarHBondContact O-N 3.36Å
73	S	48.3	Very low	48.5	Very low	96 Å²	96	132.7 Å²	132.7	67%	0.671	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.9	9.8	174.6	56.8	0	0	0	0	114.1	G70	G70-S73 PolarHBondContact O-OG 3.03Å
74	Q	50.3	Low	48.4	Very low	171 Å²	171	131.1 Å²	131.1	80%	0.799	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-125.8	6.8	178.2	-70.8	-165.3	-32.2	0	0	114.8	L72	L72-Q74 VanDerWaalsContact C-N 3.28Å; L72-Q74 PolarHBondContact O-N 3.36Å
75	L	47	Very low	48.2	Very low	219 Å²	219	132.1 Å²	132.1	100%	1.147	68%	0.684	S	S	*	*			trans	-132.2	0	172.3	-76.5	166.8	0	0	0	109.3

Retrieved 75 of 75 residues in 79 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).