A0A5K4F7A8_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A5K4F7A8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 78 aa.

						>A0A5K4F7A8_SCHMA|A0A5K4F7A8
MFNNEEMVSSSSSYLPLWAWYYLYITGIIFLCTLCILCYLQKWLCFKIIIRKQWCNKNAIDMDTNLIEYTNNNHNIMQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.5	Very low	53.9	Low	239 Å²	239	150.6 Å²	150.6	100%	1.177	81%	0.806	S	S	*	*				0	68.9	0	-166.8	171.5	-172.3	0	0	106
2	F	46.1	Very low	54.3	Low	185 Å²	185	144.4 Å²	144.4	81%	0.811	78%	0.783	S	S	*	*				66.5	91.5	59.4	-98.2	-80.1	0	0	0	114.6
3	N	54.7	Low	54.9	Low	118 Å²	118	141.8 Å²	141.8	63%	0.631	78%	0.782	S	S	*	*			trans	81.2	149.4	140.8	-65	9.1	0	0	0	122.8
4	N	61.1	Low	55.9	Low	147 Å²	147	146.1 Å²	146.1	79%	0.786	78%	0.783	S	S	*	*			trans	95.7	74.1	172.7	-53.8	-6.2	0	0	0	112.4
5	E	54.7	Low	56.9	Low	168 Å²	168	142.5 Å²	142.5	79%	0.785	76%	0.763	S	S	*	*				43	114.2	64.5	-70.1	-176.1	146.8	0	0	111.8
6	E	53.7	Low	58.5	Low	175 Å²	175	137.8 Å²	137.8	82%	0.818	74%	0.742	S	S	*	*			trans	69.1	68	156.4	-54	-176.3	166.5	0	0	118.2	V8	E6-V8 VanDerWaalsContact C-N 3.32Å
7	M	53.4	Low	60	Low	190 Å²	190	138.8 Å²	138.8	94%	0.936	75%	0.746	S	S	*	*			trans	-95.9	68.7	145.7	-72.2	-171	176.5	0	0	109.4	S9	M7-S9 PolarHBondContact O-N 3.18Å
8	V	57.6	Low	61.6	Low	131 Å²	131	141.3 Å²	141.3	79%	0.794	74%	0.743	S	S	*	*			trans	-68.1	81.7	151.9	177.4	0	0	0	0	105.3	E6 S10	E6-V8 VanDerWaalsContact C-N 3.32Å; V8-S10 VanDerWaalsContact C-N 3.28Å; V8-S10 PolarHBondContact O-N 3.32Å
9	S	53.5	Low	63	Low	98 Å²	98	134.9 Å²	134.9	69%	0.685	71%	0.713	S	S	*	*			trans	-65.4	96.2	169.8	56.4	0	0	0	0	106.7	M7 S11	M7-S9 PolarHBondContact O-N 3.18Å; S9-S11 PolarHBondContact O-N 3.31Å
10	S	56.7	Low	64.2	Low	106 Å²	106	135.9 Å²	135.9	74%	0.741	71%	0.707	S	S	*	*			trans	-53.9	90.4	158.5	50.6	0	0	0	0	107.2	V8 S12	V8-S10 VanDerWaalsContact C-N 3.28Å; V8-S10 PolarHBondContact O-N 3.32Å; S10-S12 PolarHBondContact O-N 3.46Å
11	S	56.5	Low	65.4	Low	100 Å²	100	136.6 Å²	136.6	70%	0.699	70%	0.701	S	S	*	*			trans	-64	87.9	168.2	31.1	0	0	0	0	106.4	S9 S13	S9-S11 PolarHBondContact O-N 3.31Å; S11-S13 PolarHBondContact O-N 2.98Å
12	S	58.2	Low	67.6	Low	76 Å²	76	132.9 Å²	132.9	53%	0.531	68%	0.675	S	S	.	*			trans	-55	99.2	159.9	40.1	0	0	0	0	106.1	S10 Y14	S10-S12 PolarHBondContact O-N 3.46Å; S12-Y14 WeakPolarHBondContact O-CD2 3.43Å; S12-Y14 PolarHBondContact O-N 2.76Å; S12-Y14 WeakPolarHBondContact OG-CE2 3.34Å
13	S	62.6	Low	69.7	Low	110 Å²	110	128.9 Å²	128.9	77%	0.769	66%	0.662	S	S	*	*			trans	-62.1	88.7	173.4	-60.9	0	0	0	0	107.4	S11 L15	S11-S13 PolarHBondContact O-N 2.98Å; S13-L15 PolarHBondContact O-N 3.38Å
14	Y	68.9	Low	71.5	Confident	203 Å²	203	130.9 Å²	130.9	80%	0.796	66%	0.662	S	S	*	*			trans	-59.8	102.9	171.9	-75.1	-85.6	0	0	0	107	S12 P16	S12-Y14 WeakPolarHBondContact O-CD2 3.43Å; S12-Y14 PolarHBondContact O-N 2.76Å; S12-Y14 WeakPolarHBondContact OG-CE2 3.34Å; Y14-P16 VanDerWaalsContact O-CD 3.26Å; Y14-P16 WeakPolarHBondContact O-CD 3.45Å; Y14-P16 VanDerWaalsContact O-N 3.14Å
15	L	70.4	Confident	73.1	Confident	91 Å²	91	126.7 Å²	126.7	48%	0.476	64%	0.639	S	S	.	*			trans	-59.2	119.1	172.4	-84.4	160.5	0	0	0	107.1	S13 L17 A19 W20	S13-L15 PolarHBondContact O-N 3.38Å; L15-L17 PolarHBondContact O-N 3.42Å; L15-A19 HydrophobicContact CD2-CB 4.17Å; L15-W20 HydrophobicContact CD1-CZ2 4.22Å; L15-W20 PolarHBondContact O-NE1 3.3Å
16	P	83.2	Confident	75	Confident	67 Å²	67	122.2 Å²	122.2	44%	0.435	62%	0.623	S	S	.	*			trans	-55.1	142.8	178.2	21.2	-34.6	0	0	0	110.4	Y14 W18 A19	Y14-P16 VanDerWaalsContact O-CD 3.26Å; Y14-P16 WeakPolarHBondContact O-CD 3.45Å; Y14-P16 VanDerWaalsContact O-N 3.14Å; P16-W18 HydrophobicContact CB-CG 4.32Å; P16-W18 PolarHBondContact O-N 2.92Å; P16-A19 HydrophobicContact CG-CB 4.37Å; P16-A19 VanDerWaalsContact O-CB 3.28Å; P16-A19 WeakPolarHBondContact O-CB 3.49Å; P16-A19 PolarHBondContact O-N 3.22Å
17	L	83.9	Confident	76.9	Confident	155 Å²	155	115.3 Å²	115.3	81%	0.812	60%	0.599	S	S	*	*	H	α-helix	trans	-51.9	-31.9	-174	-72.7	169.8	0	0	0	113.6	L15 A19 W20 Y21	L15-L17 PolarHBondContact O-N 3.42Å; L17-A19 PolarHBondContact O-N 3.34Å; L17-W20 PolarHBondContact O-N 3.05Å; L17-Y21 PolarHBondContact O-N 3.02Å
18	W	87.9	Confident	78.9	Confident	184 Å²	184	109.8 Å²	109.8	70%	0.697	57%	0.573	S	S	*	*	H	α-helix	trans	-59.6	-31.1	175.6	69.6	-7	0	0	0	113.2	P16 Y21 Y22	P16-W18 HydrophobicContact CB-CG 4.32Å; P16-W18 PolarHBondContact O-N 2.92Å; W18-Y21 PolarHBondContact O-N 2.98Å; W18-Y22 VanDerWaalsContact O-CD2 3.24Å; W18-Y22 WeakPolarHBondContact O-CD2 3.3Å; W18-Y22 PolarHBondContact O-N 3.08Å
19	A	87.8	Confident	80.7	Confident	21 Å²	21	108.2 Å²	108.2	17%	0.174	56%	0.558	C	S	.	*	H	α-helix	trans	-77.3	-36.5	-175.2	0	0	0	0	0	109.5	L15 P16 L17 Y22 L23	L15-A19 HydrophobicContact CD2-CB 4.17Å; P16-A19 HydrophobicContact CG-CB 4.37Å; P16-A19 VanDerWaalsContact O-CB 3.28Å; P16-A19 WeakPolarHBondContact O-CB 3.49Å; P16-A19 PolarHBondContact O-N 3.22Å; L17-A19 PolarHBondContact O-N 3.34Å; A19-Y22 PolarHBondContact O-N 3.49Å; A19-L23 WeakPolarHBondContact O-CB 2.95Å; A19-L23 WeakPolarHBondContact O-CG 3.46Å; A19-L23 PolarHBondContact O-N 3.43Å
20	W	87.4	Confident	82.6	Confident	153 Å²	153	109.6 Å²	109.6	58%	0.58	55%	0.553	S	S	*	*	H	α-helix	trans	-61.6	-43.7	169.6	-71.6	103.2	0	0	0	111.9	L15 L17 L23 Y24	L15-W20 HydrophobicContact CD1-CZ2 4.22Å; L15-W20 PolarHBondContact O-NE1 3.3Å; L17-W20 PolarHBondContact O-N 3.05Å; W20-L23 PolarHBondContact O-N 3.04Å; W20-Y24 WeakPolarHBondContact O-CB 3.47Å; W20-Y24 PolarHBondContact O-N 3.02Å
21	Y	90.6	Very high	84.4	Confident	152 Å²	152	109.9 Å²	109.9	60%	0.596	55%	0.545	S	S	*	.	H	α-helix	trans	-63.4	-44.5	176.2	-175.7	-106	0	0	0	112.2	L17 W18 Y24 I25	L17-Y21 PolarHBondContact O-N 3.02Å; W18-Y21 PolarHBondContact O-N 2.98Å; Y21-Y24 PolarHBondContact O-N 2.93Å; Y21-I25 HydrophobicContact CD1-CD1 3.71Å; Y21-I25 HydrophobicContact CE1-CD1 3.19Å; Y21-I25 HydrophobicContact CE1-CG1 4.34Å; Y21-I25 HydrophobicContact CE2-CD1 4.13Å; Y21-I25 HydrophobicContact CG-CD1 4.38Å; Y21-I25 VanDerWaalsContact CZ-CD1 3.43Å; Y21-I25 WeakPolarHBondContact O-CG1 3.41Å; Y21-I25 PolarHBondContact O-N 3.41Å
22	Y	91.3	Very high	86.2	Confident	160 Å²	160	108.4 Å²	108.4	63%	0.627	53%	0.534	S	S	*	.	H	α-helix	trans	-61.8	-44.1	174.1	-91.7	-75.3	0	0	0	112.7	W18 A19 Y24 I25 T26	W18-Y22 VanDerWaalsContact O-CD2 3.24Å; W18-Y22 WeakPolarHBondContact O-CD2 3.3Å; W18-Y22 PolarHBondContact O-N 3.08Å; A19-Y22 PolarHBondContact O-N 3.49Å; Y22-Y24 VanDerWaalsContact C-N 3.3Å; Y22-Y24 PolarHBondContact O-N 3.34Å; Y22-I25 PolarHBondContact O-N 3.49Å; Y22-T26 WeakPolarHBondContact O-CB 3.42Å; Y22-T26 VanDerWaalsContact O-CG2 3.3Å; Y22-T26 WeakPolarHBondContact O-CG2 3.27Å; Y22-T26 PolarHBondContact O-N 2.92Å; Y22-T26 PolarHBondContact O-OG1 3.49Å
23	L	90.4	Very high	88	Confident	101 Å²	101	107.7 Å²	107.7	53%	0.529	53%	0.527	S	S	.	.	H	α-helix	trans	-61.5	-39.8	176.2	-78.4	171.8	0	0	0	111.8	A19 W20 T26 G27	A19-L23 WeakPolarHBondContact O-CB 2.95Å; A19-L23 WeakPolarHBondContact O-CG 3.46Å; A19-L23 PolarHBondContact O-N 3.43Å; W20-L23 PolarHBondContact O-N 3.04Å; L23-T26 VanDerWaalsContact CA-OG1 3.32Å; L23-T26 WeakPolarHBondContact CA-OG1 3.37Å; L23-T26 PolarHBondContact O-OG1 2.78Å; L23-G27 PolarHBondContact O-N 3.2Å
24	Y	92.2	Very high	89.5	Confident	161 Å²	161	105.9 Å²	105.9	63%	0.631	51%	0.508	S	S	*	.	H	α-helix	trans	-64.4	-48.2	177.4	-176.8	-104	0	0	0	112.2	W20 Y21 Y22 G27 I28	W20-Y24 WeakPolarHBondContact O-CB 3.47Å; W20-Y24 PolarHBondContact O-N 3.02Å; Y21-Y24 PolarHBondContact O-N 2.93Å; Y22-Y24 VanDerWaalsContact C-N 3.3Å; Y22-Y24 PolarHBondContact O-N 3.34Å; Y24-G27 PolarHBondContact O-N 2.96Å; Y24-I28 HydrophobicContact CD1-CD1 3.8Å; Y24-I28 HydrophobicContact CE1-CD1 3.28Å; Y24-I28 HydrophobicContact CE1-CG1 4.43Å; Y24-I28 HydrophobicContact CE2-CD1 4.27Å; Y24-I28 HydrophobicContact CG-CD1 4.48Å; Y24-I28 WeakPolarHBondContact O-CG1 3.41Å; Y24-I28 PolarHBondContact O-N 3.43Å
25	I	94.3	Very high	90.6	Very high	58 Å²	58	100.4 Å²	100.4	30%	0.297	50%	0.498	S	S	.	.	H	α-helix	trans	-62.4	-47.8	177.9	-69.3	172.7	0	0	0	111.1	Y21 Y22 G27 I28 I29	Y21-I25 HydrophobicContact CD1-CD1 3.71Å; Y21-I25 HydrophobicContact CE1-CD1 3.19Å; Y21-I25 HydrophobicContact CE1-CG1 4.34Å; Y21-I25 HydrophobicContact CE2-CD1 4.13Å; Y21-I25 HydrophobicContact CG-CD1 4.38Å; Y21-I25 VanDerWaalsContact CZ-CD1 3.43Å; Y21-I25 WeakPolarHBondContact O-CG1 3.41Å; Y21-I25 PolarHBondContact O-N 3.41Å; Y22-I25 PolarHBondContact O-N 3.49Å; I25-G27 VanDerWaalsContact C-N 3.28Å; I25-G27 PolarHBondContact O-N 3.43Å; I25-I28 PolarHBondContact O-N 3.47Å; I25-I29 HydrophobicContact CG2-CD1 3.68Å; I25-I29 HydrophobicContact CG2-CG1 4.31Å; I25-I29 WeakPolarHBondContact O-CG1 3.49Å; I25-I29 PolarHBondContact O-N 3.37Å
26	T	93.8	Very high	91.7	Very high	74 Å²	74	101.1 Å²	101.1	45%	0.454	50%	0.502	S	S	.	.	H	α-helix	trans	-62.5	-37.6	-179.9	50.2	0	0	0	0	111.5	Y22 L23 I29 F30	Y22-T26 WeakPolarHBondContact O-CB 3.42Å; Y22-T26 VanDerWaalsContact O-CG2 3.3Å; Y22-T26 WeakPolarHBondContact O-CG2 3.27Å; Y22-T26 PolarHBondContact O-N 2.92Å; Y22-T26 PolarHBondContact O-OG1 3.49Å; L23-T26 VanDerWaalsContact CA-OG1 3.32Å; L23-T26 WeakPolarHBondContact CA-OG1 3.37Å; L23-T26 PolarHBondContact O-OG1 2.78Å; T26-I29 PolarHBondContact O-N 2.99Å; T26-F30 WeakPolarHBondContact O-CB 3.33Å; T26-F30 PolarHBondContact O-N 3.3Å
27	G	93.9	Very high	92.2	Very high	31 Å²	31	103 Å²	103	32%	0.32	51%	0.507	S	S	.	.	H	α-helix	trans	-60.7	-45.1	172.1	0	0	0	0	0	113.2	L23 Y24 I25 F30 L31	L23-G27 PolarHBondContact O-N 3.2Å; Y24-G27 PolarHBondContact O-N 2.96Å; I25-G27 VanDerWaalsContact C-N 3.28Å; I25-G27 PolarHBondContact O-N 3.43Å; G27-F30 PolarHBondContact O-N 3.19Å; G27-L31 WeakPolarHBondContact O-CG 3.43Å; G27-L31 PolarHBondContact O-N 2.99Å
28	I	94.9	Very high	92.5	Very high	74 Å²	74	99.1 Å²	99.1	38%	0.379	49%	0.492	S	S	.	.	H	α-helix	trans	-62.5	-47.7	176.1	-69.7	169.6	0	0	0	110.9	Y24 I25 F30 L31 C32	Y24-I28 HydrophobicContact CD1-CD1 3.8Å; Y24-I28 HydrophobicContact CE1-CD1 3.28Å; Y24-I28 HydrophobicContact CE1-CG1 4.43Å; Y24-I28 HydrophobicContact CE2-CD1 4.27Å; Y24-I28 HydrophobicContact CG-CD1 4.48Å; Y24-I28 WeakPolarHBondContact O-CG1 3.41Å; Y24-I28 PolarHBondContact O-N 3.43Å; I25-I28 PolarHBondContact O-N 3.47Å; I28-F30 VanDerWaalsContact C-N 3.28Å; I28-F30 PolarHBondContact O-N 3.07Å; I28-L31 PolarHBondContact O-N 3.35Å; I28-C32 PolarHBondContact O-N 3.37Å; I28-C32 PolarHBondContact O-SG 2.98Å; I28-C32 VanDerWaalsContact O-SG 3.39Å
29	I	95.4	Very high	92.6	Very high	97 Å²	97	98.5 Å²	98.5	50%	0.497	49%	0.491	S	S	.	.	H	α-helix	trans	-58.7	-44.8	178.7	-67.3	169.5	0	0	0	109.9	I25 T26 L31 C32 T33	I25-I29 HydrophobicContact CG2-CD1 3.68Å; I25-I29 HydrophobicContact CG2-CG1 4.31Å; I25-I29 WeakPolarHBondContact O-CG1 3.49Å; I25-I29 PolarHBondContact O-N 3.37Å; T26-I29 PolarHBondContact O-N 2.99Å; I29-L31 PolarHBondContact O-N 3.4Å; I29-C32 WeakPolarHBondContact O-CB 3.44Å; I29-C32 PolarHBondContact O-N 3.46Å; I29-T33 HydrophobicContact CG2-CG2 4.44Å; I29-T33 WeakPolarHBondContact O-CG2 3.47Å; I29-T33 PolarHBondContact O-N 2.99Å; I29-T33 PolarHBondContact O-OG1 3.26Å
30	F	94.6	Very high	92.7	Very high	128 Å²	128	101.1 Å²	101.1	56%	0.561	50%	0.502	S	S	*	.	H	α-helix	trans	-59.7	-48.2	177.7	-175.3	-104.4	0	0	0	111.9	T26 G27 I28 C32 T33 L34	T26-F30 WeakPolarHBondContact O-CB 3.33Å; T26-F30 PolarHBondContact O-N 3.3Å; G27-F30 PolarHBondContact O-N 3.19Å; I28-F30 VanDerWaalsContact C-N 3.28Å; I28-F30 PolarHBondContact O-N 3.07Å; F30-C32 VanDerWaalsContact C-N 3.34Å; F30-C32 PolarHBondContact O-N 2.88Å; F30-T33 WeakPolarHBondContact CA-OG1 3.37Å; F30-T33 PolarHBondContact O-N 3.39Å; F30-T33 PolarHBondContact O-OG1 3.16Å; F30-L34 HydrophobicContact CD1-CD1 3.89Å; F30-L34 HydrophobicContact CD1-CG 4.4Å; F30-L34 HydrophobicContact CE1-CD1 3.42Å; F30-L34 VanDerWaalsContact CE1-CD1 3.42Å; F30-L34 HydrophobicContact CE1-CG 4.09Å; F30-L34 HydrophobicContact CZ-CD1 3.92Å; F30-L34 HydrophobicContact CZ-CD2 4.32Å; F30-L34 HydrophobicContact CZ-CG 4.22Å; F30-L34 WeakPolarHBondContact O-CG 3.37Å; F30-L34 PolarHBondContact O-N 3.37Å
31	L	94	Very high	92.8	Very high	112 Å²	112	99.5 Å²	99.5	59%	0.586	50%	0.501	S	S	*	.	H	α-helix	trans	-59.4	-42.7	175.3	-71.2	171.8	0	0	0	112.2	G27 I28 I29 T33 L34 C35	G27-L31 WeakPolarHBondContact O-CG 3.43Å; G27-L31 PolarHBondContact O-N 2.99Å; I28-L31 PolarHBondContact O-N 3.35Å; I29-L31 PolarHBondContact O-N 3.4Å; L31-T33 PolarHBondContact O-N 3.15Å; L31-L34 PolarHBondContact O-N 2.97Å; L31-C35 PolarHBondContact O-N 2.96Å; L31-C35 PolarHBondContact O-SG 2.93Å; L31-C35 VanDerWaalsContact O-SG 3.38Å
32	C	95.1	Very high	92.6	Very high	69 Å²	69	99.7 Å²	99.7	47%	0.466	51%	0.505	S	S	.	.	H	α-helix	trans	-60.6	-43.8	175	-72.7	0	0	0	0	112	I28 I29 F30 L34 C35 I36	I28-C32 PolarHBondContact O-N 3.37Å; I28-C32 PolarHBondContact O-SG 2.98Å; I28-C32 VanDerWaalsContact O-SG 3.39Å; I29-C32 WeakPolarHBondContact O-CB 3.44Å; I29-C32 PolarHBondContact O-N 3.46Å; F30-C32 VanDerWaalsContact C-N 3.34Å; F30-C32 PolarHBondContact O-N 2.88Å; C32-L34 PolarHBondContact O-N 3.39Å; C32-C35 WeakPolarHBondContact O-CB 3.45Å; C32-C35 PolarHBondContact O-N 3.33Å; C32-I36 WeakPolarHBondContact O-CG1 3.49Å; C32-I36 PolarHBondContact O-N 3.25Å
33	T	94.5	Very high	92.4	Very high	61 Å²	61	98.2 Å²	98.2	37%	0.374	50%	0.498	S	S	.	.	H	α-helix	trans	-63.3	-40.9	177.4	59.5	0	0	0	0	112.2	I29 F30 L31 C35 I36 L37	I29-T33 HydrophobicContact CG2-CG2 4.44Å; I29-T33 WeakPolarHBondContact O-CG2 3.47Å; I29-T33 PolarHBondContact O-N 2.99Å; I29-T33 PolarHBondContact O-OG1 3.26Å; F30-T33 WeakPolarHBondContact CA-OG1 3.37Å; F30-T33 PolarHBondContact O-N 3.39Å; F30-T33 PolarHBondContact O-OG1 3.16Å; L31-T33 PolarHBondContact O-N 3.15Å; T33-C35 VanDerWaalsContact C-N 3.34Å; T33-C35 PolarHBondContact O-N 2.92Å; T33-I36 PolarHBondContact O-N 3.37Å; T33-L37 WeakPolarHBondContact O-CG 3.47Å; T33-L37 PolarHBondContact O-N 3.5Å
34	L	94.1	Very high	92.2	Very high	72 Å²	72	97.6 Å²	97.6	38%	0.377	50%	0.495	S	S	.	.	H	α-helix	trans	-62.3	-40.6	175.2	-70.9	-179.6	0	0	0	112	F30 L31 C32 L37 C38	F30-L34 HydrophobicContact CD1-CD1 3.89Å; F30-L34 HydrophobicContact CD1-CG 4.4Å; F30-L34 HydrophobicContact CE1-CD1 3.42Å; F30-L34 VanDerWaalsContact CE1-CD1 3.42Å; F30-L34 HydrophobicContact CE1-CG 4.09Å; F30-L34 HydrophobicContact CZ-CD1 3.92Å; F30-L34 HydrophobicContact CZ-CD2 4.32Å; F30-L34 HydrophobicContact CZ-CG 4.22Å; F30-L34 WeakPolarHBondContact O-CG 3.37Å; F30-L34 PolarHBondContact O-N 3.37Å; L31-L34 PolarHBondContact O-N 2.97Å; C32-L34 PolarHBondContact O-N 3.39Å; L34-L37 PolarHBondContact O-N 3.38Å; L34-C38 WeakPolarHBondContact O-CB 3.35Å; L34-C38 PolarHBondContact O-N 3.4Å; L34-C38 PolarHBondContact O-SG 3.02Å
35	C	93.7	Very high	91.9	Very high	88 Å²	88	92.6 Å²	92.6	60%	0.595	48%	0.483	S	S	*	.	H	α-helix	trans	-62	-43.7	175.6	-73.6	0	0	0	0	112.3	L31 C32 T33 C38 Y39	L31-C35 PolarHBondContact O-N 2.96Å; L31-C35 PolarHBondContact O-SG 2.93Å; L31-C35 VanDerWaalsContact O-SG 3.38Å; C32-C35 WeakPolarHBondContact O-CB 3.45Å; C32-C35 PolarHBondContact O-N 3.33Å; T33-C35 VanDerWaalsContact C-N 3.34Å; T33-C35 PolarHBondContact O-N 2.92Å; C35-C38 PolarHBondContact O-N 3.14Å; C35-Y39 PolarHBondContact O-N 3.43Å
36	I	93.4	Very high	91.5	Very high	106 Å²	106	95.9 Å²	95.9	54%	0.544	50%	0.495	S	S	.	.	H	α-helix	trans	-64.1	-44.7	177.4	-65.4	164.9	0	0	0	110.5	C32 T33 C38 Y39 L40	C32-I36 WeakPolarHBondContact O-CG1 3.49Å; C32-I36 PolarHBondContact O-N 3.25Å; T33-I36 PolarHBondContact O-N 3.37Å; I36-C38 PolarHBondContact O-N 3.34Å; I36-Y39 WeakPolarHBondContact O-CB 3.48Å; I36-Y39 PolarHBondContact O-N 2.92Å; I36-L40 HydrophobicContact CG2-CD1 4.21Å; I36-L40 WeakPolarHBondContact O-CG 3.49Å; I36-L40 PolarHBondContact O-N 3.39Å
37	L	92.6	Very high	91.1	Very high	106 Å²	106	96.8 Å²	96.8	56%	0.555	49%	0.493	S	S	*	.	H	α-helix	trans	-61.1	-42.6	176.5	-72.2	172.5	0	0	0	111.9	T33 L34 Y39 L40 Q41	T33-L37 WeakPolarHBondContact O-CG 3.47Å; T33-L37 PolarHBondContact O-N 3.5Å; L34-L37 PolarHBondContact O-N 3.38Å; L37-Y39 VanDerWaalsContact C-N 3.3Å; L37-Y39 PolarHBondContact O-N 3.45Å; L37-L40 PolarHBondContact O-N 3.19Å; L37-Q41 WeakPolarHBondContact O-CB 3.46Å; L37-Q41 PolarHBondContact O-N 3.16Å
38	C	91.5	Very high	90.6	Very high	74 Å²	74	99.7 Å²	99.7	50%	0.5	50%	0.5	S	S	.	.	H	α-helix	trans	-60.5	-40.4	174.7	-72.4	0	0	0	0	112.1	L34 C35 I36 Q41 K42	L34-C38 WeakPolarHBondContact O-CB 3.35Å; L34-C38 PolarHBondContact O-N 3.4Å; L34-C38 PolarHBondContact O-SG 3.02Å; C35-C38 PolarHBondContact O-N 3.14Å; I36-C38 PolarHBondContact O-N 3.34Å; C38-Q41 PolarHBondContact O-N 2.94Å; C38-K42 WeakPolarHBondContact O-CG 3.48Å; C38-K42 PolarHBondContact O-N 3Å
39	Y	90.2	Very high	90	Very high	170 Å²	170	100.4 Å²	100.4	67%	0.667	50%	0.504	S	S	*	.	H	α-helix	trans	-66.1	-45.1	177.5	-173.2	-97.1	0	0	0	111.9	C35 I36 L37 Q41 K42 W43	C35-Y39 PolarHBondContact O-N 3.43Å; I36-Y39 WeakPolarHBondContact O-CB 3.48Å; I36-Y39 PolarHBondContact O-N 2.92Å; L37-Y39 VanDerWaalsContact C-N 3.3Å; L37-Y39 PolarHBondContact O-N 3.45Å; Y39-Q41 VanDerWaalsContact C-N 3.34Å; Y39-Q41 PolarHBondContact O-N 3.47Å; Y39-K42 PolarHBondContact O-N 3.25Å; Y39-W43 WeakPolarHBondContact O-CB 3.37Å; Y39-W43 PolarHBondContact O-N 3.02Å
40	L	89.8	Confident	89.2	Confident	77 Å²	77	99.7 Å²	99.7	40%	0.403	50%	0.5	S	S	.	.	H	α-helix	trans	-60.8	-42.1	175.3	-72.4	172.5	0	0	0	111.8	I36 L37 W43 L44	I36-L40 HydrophobicContact CG2-CD1 4.21Å; I36-L40 WeakPolarHBondContact O-CG 3.49Å; I36-L40 PolarHBondContact O-N 3.39Å; L37-L40 PolarHBondContact O-N 3.19Å; L40-W43 HydrophobicContact CD2-CE3 4.49Å; L40-W43 WeakPolarHBondContact O-CB 3.44Å; L40-W43 PolarHBondContact O-N 2.95Å; L40-L44 WeakPolarHBondContact O-CG 3.34Å; L40-L44 PolarHBondContact O-N 3.28Å
41	Q	89.1	Confident	88.5	Confident	118 Å²	118	102.9 Å²	102.9	55%	0.551	51%	0.508	S	S	*	.	H	α-helix	trans	-62.5	-44.9	176.9	-172.9	66.4	4.1	0	0	111.6	L37 C38 Y39 W43 L44 C45	L37-Q41 WeakPolarHBondContact O-CB 3.46Å; L37-Q41 PolarHBondContact O-N 3.16Å; C38-Q41 PolarHBondContact O-N 2.94Å; Y39-Q41 VanDerWaalsContact C-N 3.34Å; Y39-Q41 PolarHBondContact O-N 3.47Å; Q41-W43 VanDerWaalsContact C-N 3.3Å; Q41-W43 PolarHBondContact O-N 3.45Å; Q41-L44 PolarHBondContact O-N 3.41Å; Q41-C45 WeakPolarHBondContact O-CB 3.48Å; Q41-C45 PolarHBondContact O-N 3.43Å; Q41-C45 PolarHBondContact O-SG 3.22Å
42	K	86.3	Confident	87.7	Confident	157 Å²	157	104.6 Å²	104.6	68%	0.683	51%	0.511	S	S	*	.	H	α-helix	trans	-60.8	-40.4	174.5	-74.8	-179.7	179.2	-177.5	0	111.7	C38 Y39 C45 F46	C38-K42 WeakPolarHBondContact O-CG 3.48Å; C38-K42 PolarHBondContact O-N 3Å; Y39-K42 PolarHBondContact O-N 3.25Å; K42-C45 PolarHBondContact O-N 2.92Å; K42-F46 WeakPolarHBondContact O-CB 3.4Å; K42-F46 PolarHBondContact O-N 3.39Å
43	W	86.7	Confident	86.9	Confident	129 Å²	129	107.6 Å²	107.6	49%	0.489	52%	0.518	S	S	.	.	H	α-helix	trans	-65.2	-42	177.7	-171.3	56.6	0	0	0	112.7	Y39 L40 Q41 F46 K47	Y39-W43 WeakPolarHBondContact O-CB 3.37Å; Y39-W43 PolarHBondContact O-N 3.02Å; L40-W43 HydrophobicContact CD2-CE3 4.49Å; L40-W43 WeakPolarHBondContact O-CB 3.44Å; L40-W43 PolarHBondContact O-N 2.95Å; Q41-W43 VanDerWaalsContact C-N 3.3Å; Q41-W43 PolarHBondContact O-N 3.45Å; W43-F46 PolarHBondContact O-N 3.05Å; W43-K47 VanDerWaalsContact CE2-CE 3.48Å; W43-K47 PolarHBondContact O-N 3.41Å
44	L	86.8	Confident	86.3	Confident	87 Å²	87	112.9 Å²	112.9	46%	0.455	53%	0.531	S	S	.	.	H	α-helix	trans	-63	-46.2	173.5	-72.1	170.1	0	0	0	111.5	L40 Q41 F46 K47 I48	L40-L44 WeakPolarHBondContact O-CG 3.34Å; L40-L44 PolarHBondContact O-N 3.28Å; Q41-L44 PolarHBondContact O-N 3.41Å; L44-F46 VanDerWaalsContact C-N 3.33Å; L44-F46 PolarHBondContact O-N 3.02Å; L44-K47 PolarHBondContact O-N 3.29Å; L44-I48 WeakPolarHBondContact O-CG1 3.33Å; L44-I48 PolarHBondContact O-N 3.34Å
45	C	85.7	Confident	85.4	Confident	57 Å²	57	113.2 Å²	113.2	39%	0.385	54%	0.539	S	S	.	.	H	α-helix	trans	-58.1	-44.2	175	-76.1	0	0	0	0	111.9	Q41 K42 K47 I48 I49	Q41-C45 WeakPolarHBondContact O-CB 3.48Å; Q41-C45 PolarHBondContact O-N 3.43Å; Q41-C45 PolarHBondContact O-SG 3.22Å; K42-C45 PolarHBondContact O-N 2.92Å; C45-K47 PolarHBondContact O-N 3.45Å; C45-I48 PolarHBondContact O-N 2.89Å; C45-I48 VanDerWaalsContact O-N 3.16Å; C45-I49 WeakPolarHBondContact O-CG1 3.48Å; C45-I49 PolarHBondContact O-N 2.92Å
46	F	86.5	Confident	84.8	Confident	126 Å²	126	114 Å²	114	55%	0.553	54%	0.537	S	S	*	.	H	α-helix	trans	-62	-43.2	178	-169.1	-106.7	0	0	0	111.9	K42 W43 L44 I48 I49 I50	K42-F46 WeakPolarHBondContact O-CB 3.4Å; K42-F46 PolarHBondContact O-N 3.39Å; W43-F46 PolarHBondContact O-N 3.05Å; L44-F46 VanDerWaalsContact C-N 3.33Å; L44-F46 PolarHBondContact O-N 3.02Å; F46-I48 VanDerWaalsContact C-N 3.3Å; F46-I48 PolarHBondContact O-N 3.39Å; F46-I49 PolarHBondContact O-N 3.47Å; F46-I50 HydrophobicContact CD1-CD1 3.67Å; F46-I50 HydrophobicContact CD1-CG1 4.49Å; F46-I50 HydrophobicContact CE1-CD1 3.25Å; F46-I50 HydrophobicContact CE1-CG1 4.25Å; F46-I50 HydrophobicContact CG-CD1 4.5Å; F46-I50 HydrophobicContact CZ-CD1 3.75Å; F46-I50 HydrophobicContact CZ-CG1 4.41Å; F46-I50 PolarHBondContact O-N 3.33Å
47	K	84.3	Confident	84.2	Confident	93 Å²	93	115.2 Å²	115.2	40%	0.404	54%	0.539	S	S	.	.	H	α-helix	trans	-59.8	-38.7	173.6	-78.2	-177.9	172.2	177.9	0	112.6	W43 L44 C45 R51	W43-K47 VanDerWaalsContact CE2-CE 3.48Å; W43-K47 PolarHBondContact O-N 3.41Å; L44-K47 PolarHBondContact O-N 3.29Å; C45-K47 PolarHBondContact O-N 3.45Å; K47-R51 WeakPolarHBondContact O-CG 3.48Å; K47-R51 PolarHBondContact O-N 3.4Å; K47-R51 VanDerWaalsContact O-N 3.14Å
48	I	83.6	Confident	83.4	Confident	92 Å²	92	112.6 Å²	112.6	47%	0.472	53%	0.525	S	S	.	.	H	α-helix	trans	-68.3	-42.8	177.7	-66.8	164.6	0	0	0	110.9	L44 C45 F46 R51 K52	L44-I48 WeakPolarHBondContact O-CG1 3.33Å; L44-I48 PolarHBondContact O-N 3.34Å; C45-I48 PolarHBondContact O-N 2.89Å; C45-I48 VanDerWaalsContact O-N 3.16Å; F46-I48 VanDerWaalsContact C-N 3.3Å; F46-I48 PolarHBondContact O-N 3.39Å; I48-R51 PolarHBondContact O-N 2.93Å; I48-K52 HydrophobicContact CG2-CD 4.35Å; I48-K52 HydrophobicContact CG2-CG 4.49Å; I48-K52 WeakPolarHBondContact O-CG 3.49Å; I48-K52 PolarHBondContact O-N 2.91Å
49	I	82	Confident	82.7	Confident	89 Å²	89	111.3 Å²	111.3	46%	0.456	52%	0.519	S	S	.	.	H	α-helix	trans	-62.3	-46.2	179.2	-67.3	165.3	0	0	0	110.7	C45 F46 R51 K52 Q53	C45-I49 WeakPolarHBondContact O-CG1 3.48Å; C45-I49 PolarHBondContact O-N 2.92Å; F46-I49 PolarHBondContact O-N 3.47Å; I49-R51 PolarHBondContact O-N 3.38Å; I49-K52 PolarHBondContact O-N 3.2Å; I49-Q53 PolarHBondContact O-N 3.3Å
50	I	79.4	Confident	82.1	Confident	83 Å²	83	107.3 Å²	107.3	43%	0.426	51%	0.509	S	S	.	.	H	α-helix	trans	-60.6	-45.6	177.3	-69.1	174.2	0	0	0	110.8	F46 K52 Q53 W54	F46-I50 HydrophobicContact CD1-CD1 3.67Å; F46-I50 HydrophobicContact CD1-CG1 4.49Å; F46-I50 HydrophobicContact CE1-CD1 3.25Å; F46-I50 HydrophobicContact CE1-CG1 4.25Å; F46-I50 HydrophobicContact CG-CD1 4.5Å; F46-I50 HydrophobicContact CZ-CD1 3.75Å; F46-I50 HydrophobicContact CZ-CG1 4.41Å; F46-I50 PolarHBondContact O-N 3.33Å; I50-K52 VanDerWaalsContact C-N 3.31Å; I50-K52 PolarHBondContact O-N 3.48Å; I50-Q53 PolarHBondContact O-N 2.94Å; I50-W54 PolarHBondContact O-N 3.19Å
51	R	78.8	Confident	81.5	Confident	194 Å²	194	107.3 Å²	107.3	73%	0.732	51%	0.509	S	S	*	.	H	α-helix	trans	-60.2	-41.1	176.6	-78.9	-174.8	175.7	165.9	-1.8	112.1	K47 I48 I49 W54 C55	K47-R51 WeakPolarHBondContact O-CG 3.48Å; K47-R51 PolarHBondContact O-N 3.4Å; K47-R51 VanDerWaalsContact O-N 3.14Å; I48-R51 PolarHBondContact O-N 2.93Å; I49-R51 PolarHBondContact O-N 3.38Å; R51-W54 PolarHBondContact O-N 3.02Å; R51-C55 PolarHBondContact O-N 2.98Å; R51-C55 PolarHBondContact O-SG 2.98Å; R51-C55 VanDerWaalsContact O-SG 3.37Å
52	K	78.6	Confident	80.9	Confident	149 Å²	149	108.2 Å²	108.2	65%	0.648	52%	0.515	S	S	*	.	H	α-helix	trans	-62.7	-43.7	175.9	-77.3	-175.7	176.6	-173.6	0	112.2	I48 I49 I50 W54 C55 N56	I48-K52 HydrophobicContact CG2-CD 4.35Å; I48-K52 HydrophobicContact CG2-CG 4.49Å; I48-K52 WeakPolarHBondContact O-CG 3.49Å; I48-K52 PolarHBondContact O-N 2.91Å; I49-K52 PolarHBondContact O-N 3.2Å; I50-K52 VanDerWaalsContact C-N 3.31Å; I50-K52 PolarHBondContact O-N 3.48Å; K52-W54 VanDerWaalsContact C-N 3.33Å; K52-W54 PolarHBondContact O-N 3.45Å; K52-C55 PolarHBondContact O-N 2.95Å; K52-N56 WeakPolarHBondContact O-CB 3.36Å; K52-N56 PolarHBondContact O-N 3.25Å
53	Q	77.6	Confident	80.6	Confident	132 Å²	132	105.4 Å²	105.4	62%	0.617	51%	0.507	S	S	*	.	H	α-helix	trans	-63.3	-40.3	176.5	-73.5	-176.5	-15.6	0	0	111.9	I49 I50 N56 K57	I49-Q53 PolarHBondContact O-N 3.3Å; I50-Q53 PolarHBondContact O-N 2.94Å; Q53-N56 PolarHBondContact O-N 3.5Å; Q53-K57 PolarHBondContact O-N 3.38Å
54	W	80.8	Confident	80.3	Confident	171 Å²	171	102.9 Å²	102.9	65%	0.648	51%	0.506	S	S	*	.	H	α-helix	trans	-65.5	-44.3	177.6	-164.4	71.1	0	0	0	112.2	I50 R51 K52 N56 K57 N58	I50-W54 PolarHBondContact O-N 3.19Å; R51-W54 PolarHBondContact O-N 3.02Å; K52-W54 VanDerWaalsContact C-N 3.33Å; K52-W54 PolarHBondContact O-N 3.45Å; W54-N56 VanDerWaalsContact C-N 3.35Å; W54-N56 PolarHBondContact O-N 3.17Å; W54-K57 PolarHBondContact O-N 3.02Å; W54-N58 WeakPolarHBondContact CH2-ND2 3.32Å; W54-N58 WeakPolarHBondContact CZ2-ND2 3.33Å; W54-N58 WeakPolarHBondContact CZ3-ND2 3.39Å; W54-N58 VanDerWaalsContact O-CG 3.3Å; W54-N58 PolarHBondContact O-N 3.27Å; W54-N58 PolarHBondContact O-OD1 3.47Å
55	C	75.8	Confident	79.9	Confident	79 Å²	79	102.5 Å²	102.5	53%	0.534	51%	0.505	S	S	.	.	H	α-helix	trans	-62.4	-40.8	174.1	-67.8	0	0	0	0	112.4	R51 K52 K57 N58 A59	R51-C55 PolarHBondContact O-N 2.98Å; R51-C55 PolarHBondContact O-SG 2.98Å; R51-C55 VanDerWaalsContact O-SG 3.37Å; K52-C55 PolarHBondContact O-N 2.95Å; C55-K57 VanDerWaalsContact C-N 3.35Å; C55-N58 PolarHBondContact O-N 3.49Å; C55-A59 PolarHBondContact O-N 3.32Å
56	N	81.8	Confident	79.5	Confident	104 Å²	104	105.1 Å²	105.1	56%	0.556	51%	0.514	S	S	*	.	H	α-helix	trans	-64.3	-41.3	178.7	-165.1	32.2	0	0	0	111.4	K52 Q53 W54 A59 I60	K52-N56 WeakPolarHBondContact O-CB 3.36Å; K52-N56 PolarHBondContact O-N 3.25Å; Q53-N56 PolarHBondContact O-N 3.5Å; W54-N56 VanDerWaalsContact C-N 3.35Å; W54-N56 PolarHBondContact O-N 3.17Å; N56-A59 PolarHBondContact O-N 3.4Å; N56-I60 WeakPolarHBondContact O-CD1 3.3Å; N56-I60 VanDerWaalsContact O-CG1 3.27Å; N56-I60 WeakPolarHBondContact O-CG1 3.39Å; N56-I60 PolarHBondContact O-N 2.68Å; N56-I60 VanDerWaalsContact O-N 3.15Å
57	K	80.4	Confident	79.2	Confident	133 Å²	133	104 Å²	104	58%	0.578	51%	0.513	S	S	*	.	H	α-helix	trans	-62.8	-45.8	175.6	-170.6	175.7	179.4	-179.3	0	111.8	Q53 W54 C55 A59 I60 D61	Q53-K57 PolarHBondContact O-N 3.38Å; W54-K57 PolarHBondContact O-N 3.02Å; C55-K57 VanDerWaalsContact C-N 3.35Å; K57-A59 VanDerWaalsContact C-N 3.31Å; K57-A59 PolarHBondContact O-N 2.91Å; K57-I60 PolarHBondContact O-N 2.89Å; K57-D61 PolarHBondContact O-N 3.01Å
58	N	75.8	Confident	78.9	Confident	51 Å²	51	104.9 Å²	104.9	27%	0.273	52%	0.519	S	S	.	.	H	α-helix	trans	-64.4	-34.7	179.3	-67.8	-1.1	0	0	0	112.7	W54 C55 M62	W54-N58 WeakPolarHBondContact CH2-ND2 3.32Å; W54-N58 WeakPolarHBondContact CZ2-ND2 3.33Å; W54-N58 WeakPolarHBondContact CZ3-ND2 3.39Å; W54-N58 VanDerWaalsContact O-CG 3.3Å; W54-N58 PolarHBondContact O-N 3.27Å; W54-N58 PolarHBondContact O-OD1 3.47Å; C55-N58 PolarHBondContact O-N 3.49Å; N58-M62 WeakPolarHBondContact O-CG 3.35Å; N58-M62 PolarHBondContact O-N 3.46Å
59	A	76.1	Confident	78.5	Confident	46 Å²	46	108 Å²	108	38%	0.38	53%	0.526	S	S	.	.	H	α-helix	trans	-64.8	-46.2	175.1	0	0	0	0	0	111.4	C55 N56 K57 D61 M62 D63	C55-A59 PolarHBondContact O-N 3.32Å; N56-A59 PolarHBondContact O-N 3.4Å; K57-A59 VanDerWaalsContact C-N 3.31Å; K57-A59 PolarHBondContact O-N 2.91Å; A59-D61 VanDerWaalsContact C-N 3.33Å; A59-D61 PolarHBondContact O-N 3.38Å; A59-M62 PolarHBondContact O-N 3.43Å; A59-D63 PolarHBondContact O-N 3.38Å
60	I	77.8	Confident	78.4	Confident	87 Å²	87	107.8 Å²	107.8	45%	0.446	53%	0.529	S	S	.	.	H	α-helix	trans	-62.2	-40.9	177.2	-63.9	163	0	0	0	111.2	N56 K57 M62 D63 T64	N56-I60 WeakPolarHBondContact O-CD1 3.3Å; N56-I60 VanDerWaalsContact O-CG1 3.27Å; N56-I60 WeakPolarHBondContact O-CG1 3.39Å; N56-I60 PolarHBondContact O-N 2.68Å; N56-I60 VanDerWaalsContact O-N 3.15Å; K57-I60 PolarHBondContact O-N 2.89Å; I60-M62 VanDerWaalsContact C-N 3.34Å; I60-M62 PolarHBondContact O-N 3.24Å; I60-D63 PolarHBondContact O-N 2.85Å; I60-T64 WeakPolarHBondContact O-CB 3.41Å; I60-T64 PolarHBondContact O-N 2.9Å; I60-T64 PolarHBondContact O-OG1 3.05Å
61	D	78.5	Confident	78.3	Confident	76 Å²	76	108.2 Å²	108.2	41%	0.406	53%	0.532	S	S	.	.	H	α-helix	trans	-64.4	-38.1	177	-71.4	-21.1	0	0	0	111.4	K57 A59 N65	K57-D61 PolarHBondContact O-N 3.01Å; A59-D61 VanDerWaalsContact C-N 3.33Å; A59-D61 PolarHBondContact O-N 3.38Å; D61-N65 VanDerWaalsContact O-CG 3.31Å; D61-N65 PolarHBondContact O-N 2.78Å; D61-N65 VanDerWaalsContact O-N 3.16Å; D61-N65 PolarHBondContact O-ND2 3.37Å
62	M	75.9	Confident	78.2	Confident	137 Å²	137	102.9 Å²	102.9	68%	0.675	52%	0.518	S	S	*	.	H	α-helix	trans	-66.6	-43.7	174.2	-72	-162.3	-155.6	0	0	112.6	N58 A59 I60 T64 N65 L66	N58-M62 WeakPolarHBondContact O-CG 3.35Å; N58-M62 PolarHBondContact O-N 3.46Å; A59-M62 PolarHBondContact O-N 3.43Å; I60-M62 VanDerWaalsContact C-N 3.34Å; I60-M62 PolarHBondContact O-N 3.24Å; M62-T64 VanDerWaalsContact C-N 3.33Å; M62-T64 PolarHBondContact O-N 3.18Å; M62-N65 PolarHBondContact O-N 2.93Å; M62-L66 PolarHBondContact O-N 3.41Å
63	D	79.4	Confident	77.8	Confident	98 Å²	98	100.5 Å²	100.5	52%	0.524	51%	0.512	S	S	.	.	H	α-helix	trans	-63.3	-40.5	178.8	-71.7	-22.8	0	0	0	111.5	A59 I60 L66 I67	A59-D63 PolarHBondContact O-N 3.38Å; I60-D63 PolarHBondContact O-N 2.85Å; D63-L66 PolarHBondContact O-N 3.04Å; D63-I67 VanDerWaalsContact O-CG1 3.3Å; D63-I67 WeakPolarHBondContact O-CG1 3.26Å; D63-I67 PolarHBondContact O-N 2.94Å
64	T	81.6	Confident	77.6	Confident	76 Å²	76	99.6 Å²	99.6	47%	0.466	51%	0.508	S	S	.	.	H	α-helix	trans	-63.7	-46	178.2	-53.5	0	0	0	0	111.3	I60 M62 L66 I67 E68	I60-T64 WeakPolarHBondContact O-CB 3.41Å; I60-T64 PolarHBondContact O-N 2.9Å; I60-T64 PolarHBondContact O-OG1 3.05Å; M62-T64 VanDerWaalsContact C-N 3.33Å; M62-T64 PolarHBondContact O-N 3.18Å; T64-L66 VanDerWaalsContact C-N 3.32Å; T64-L66 PolarHBondContact O-N 3.36Å; T64-I67 PolarHBondContact O-N 3.39Å; T64-E68 PolarHBondContact O-N 2.78Å
65	N	77.2	Confident	76.8	Confident	80 Å²	80	96.6 Å²	96.6	43%	0.428	50%	0.504	S	S	.	.	H	α-helix	trans	-59.4	-44.5	175.6	-74	-43.9	0	0	0	111	D61 M62 I67 E68 Y69	D61-N65 VanDerWaalsContact O-CG 3.31Å; D61-N65 PolarHBondContact O-N 2.78Å; D61-N65 VanDerWaalsContact O-N 3.16Å; D61-N65 PolarHBondContact O-ND2 3.37Å; M62-N65 PolarHBondContact O-N 2.93Å; N65-I67 VanDerWaalsContact C-N 3.34Å; N65-I67 PolarHBondContact O-N 2.88Å; N65-E68 PolarHBondContact O-N 2.83Å; N65-Y69 HydrophobicContact CB-CD2 4.43Å; N65-Y69 HydrophobicContact CB-CE2 4.2Å; N65-Y69 WeakPolarHBondContact O-CD2 3.28Å; N65-Y69 PolarHBondContact O-N 3.4Å
66	L	78.5	Confident	76.3	Confident	111 Å²	111	99.3 Å²	99.3	58%	0.581	51%	0.512	S	S	*	.	H	α-helix	trans	-62.1	-39.8	179.9	-167.3	71.9	0	0	0	112.5	M62 D63 T64 Y69 T70	M62-L66 PolarHBondContact O-N 3.41Å; D63-L66 PolarHBondContact O-N 3.04Å; T64-L66 VanDerWaalsContact C-N 3.32Å; T64-L66 PolarHBondContact O-N 3.36Å; L66-Y69 PolarHBondContact O-N 2.93Å; L66-T70 WeakPolarHBondContact O-CB 3.41Å; L66-T70 PolarHBondContact O-N 2.89Å; L66-T70 PolarHBondContact O-OG1 2.95Å
67	I	80.1	Confident	75.3	Confident	103 Å²	103	102.1 Å²	102.1	53%	0.528	52%	0.524	S	S	.	.	H	α-helix	trans	-64.6	-42.9	175.4	-66.7	163.8	0	0	0	110.5	D63 T64 N65 T70 N71	D63-I67 VanDerWaalsContact O-CG1 3.3Å; D63-I67 WeakPolarHBondContact O-CG1 3.26Å; D63-I67 PolarHBondContact O-N 2.94Å; T64-I67 PolarHBondContact O-N 3.39Å; N65-I67 VanDerWaalsContact C-N 3.34Å; N65-I67 PolarHBondContact O-N 2.88Å; I67-T70 PolarHBondContact O-N 3.32Å; I67-N71 PolarHBondContact O-N 3.32Å
68	E	76.6	Confident	73.8	Confident	112 Å²	112	105.4 Å²	105.4	52%	0.523	54%	0.541	S	S	.	.	H	α-helix	trans	-63.2	-43.5	177.6	-168	174.2	-179.8	0	0	111.9	T64 N65 T70 N71 N72	T64-E68 PolarHBondContact O-N 2.78Å; N65-E68 PolarHBondContact O-N 2.83Å; E68-T70 VanDerWaalsContact C-N 3.32Å; E68-T70 PolarHBondContact O-N 3.42Å; E68-N71 PolarHBondContact O-N 3.43Å; E68-N72 WeakPolarHBondContact O-CB 3.45Å; E68-N72 PolarHBondContact O-N 2.92Å; E68-N72 PolarHBondContact O-ND2 3.34Å
69	Y	75.9	Confident	73.8	Confident	158 Å²	158	108.2 Å²	108.2	62%	0.62	56%	0.555	S	S	*	*	H	α-helix	trans	-60.6	-40.1	172.8	-75.4	-66.7	0	0	0	112.4	N65 L66 N73	N65-Y69 HydrophobicContact CB-CD2 4.43Å; N65-Y69 HydrophobicContact CB-CE2 4.2Å; N65-Y69 WeakPolarHBondContact O-CD2 3.28Å; N65-Y69 PolarHBondContact O-N 3.4Å; L66-Y69 PolarHBondContact O-N 2.93Å; Y69-N73 WeakPolarHBondContact O-CB 3.46Å; Y69-N73 PolarHBondContact O-N 3.03Å
70	T	79.4	Confident	73.6	Confident	84 Å²	84	111.4 Å²	111.4	52%	0.515	56%	0.564	S	S	.	*	H	α-helix	trans	-68.4	-43.3	-179.8	-55	0	0	0	0	111.5	L66 I67 E68 N73 H74	L66-T70 WeakPolarHBondContact O-CB 3.41Å; L66-T70 PolarHBondContact O-N 2.89Å; L66-T70 PolarHBondContact O-OG1 2.95Å; I67-T70 PolarHBondContact O-N 3.32Å; E68-T70 VanDerWaalsContact C-N 3.32Å; E68-T70 PolarHBondContact O-N 3.42Å; T70-N73 PolarHBondContact O-N 2.99Å; T70-H74 WeakPolarHBondContact O-CB 3.24Å; T70-H74 PolarHBondContact O-N 2.82Å
71	N	77.2	Confident	73.4	Confident	91 Å²	91	112.8 Å²	112.8	49%	0.487	57%	0.571	S	S	.	*	H	α-helix	trans	-65.7	-40.9	177	-77.1	-22.8	0	0	0	112.2	I67 E68 N73 H74 N75	I67-N71 PolarHBondContact O-N 3.32Å; E68-N71 PolarHBondContact O-N 3.43Å; N71-N73 PolarHBondContact O-N 3.26Å; N71-H74 PolarHBondContact O-N 3.18Å; N71-N75 PolarHBondContact O-N 2.92Å; N71-N75 VanDerWaalsContact O-N 3.08Å
72	N	77	Confident	73.1	Confident	83 Å²	83	114.9 Å²	114.9	44%	0.444	58%	0.58	S	S	.	*	H	α-helix	trans	-63.1	-41.5	175.9	-75.5	-23.2	0	0	0	111.7	E68 I76	E68-N72 WeakPolarHBondContact O-CB 3.45Å; E68-N72 PolarHBondContact O-N 2.92Å; E68-N72 PolarHBondContact O-ND2 3.34Å; N72-I76 WeakPolarHBondContact O-CD1 3.13Å; N72-I76 WeakPolarHBondContact O-CG1 3.38Å; N72-I76 PolarHBondContact O-N 2.82Å
73	N	70.8	Confident	72.9	Confident	98 Å²	98	113.6 Å²	113.6	52%	0.524	57%	0.574	S	S	.	*	H	α-helix	trans	-69.8	-35.4	176.4	-75.4	-15.9	0	0	0	112.9	Y69 T70 N71 I76	Y69-N73 WeakPolarHBondContact O-CB 3.46Å; Y69-N73 PolarHBondContact O-N 3.03Å; T70-N73 PolarHBondContact O-N 2.99Å; N71-N73 PolarHBondContact O-N 3.26Å; N73-I76 PolarHBondContact O-N 2.75Å
74	H	72.1	Confident	72.5	Confident	114 Å²	114	114.6 Å²	114.6	53%	0.528	58%	0.578	S	S	.	*	H	α-helix	trans	-65.9	-39.8	177.2	-167.4	8.8	0	0	0	112	T70 N71 I76 M77	T70-H74 WeakPolarHBondContact O-CB 3.24Å; T70-H74 PolarHBondContact O-N 2.82Å; N71-H74 PolarHBondContact O-N 3.18Å; H74-I76 PolarHBondContact O-N 3.49Å; H74-M77 PolarHBondContact O-N 3.5Å
75	N	65.2	Low	71.8	Confident	108 Å²	108	117.4 Å²	117.4	58%	0.578	59%	0.586	S	S	*	*	H	α-helix	trans	-65.4	-21.5	176.5	-79.4	-14	0	0	0	113.9	N71	N71-N75 PolarHBondContact O-N 2.92Å; N71-N75 VanDerWaalsContact O-N 3.08Å
76	I	65.9	Low	71.4	Confident	135 Å²	135	120.2 Å²	120.2	69%	0.692	60%	0.598	S	S	*	*	H	α-helix	trans	-82.2	-18.3	177.4	-64.5	164.3	0	0	0	111.7	N72 N73 H74	N72-I76 WeakPolarHBondContact O-CD1 3.13Å; N72-I76 WeakPolarHBondContact O-CG1 3.38Å; N72-I76 PolarHBondContact O-N 2.82Å; N73-I76 PolarHBondContact O-N 2.75Å; H74-I76 PolarHBondContact O-N 3.49Å
77	M	59.8	Low	70.8	Confident	164 Å²	164	121 Å²	121	81%	0.808	60%	0.599	S	S	*	*			trans	-96.5	-2.6	-179.6	-64.3	-167.1	-168.5	0	0	114.5	H74	H74-M77 PolarHBondContact O-N 3.5Å
78	Q	50	Low	70	Confident	202 Å²	202	122.6 Å²	122.6	94%	0.944	61%	0.606	S	S	*	*			trans	-95.6	0	170.5	-71.6	-167.5	-32.7	0	0	110.6

Retrieved 78 of 78 residues in 24 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).